transient receptor potential cation channel subfamily A member-1

Overview
Nametransient receptor potential cation channel subfamily A member-1 (AFJ24864.1)
Smed IDSMED30035258
Length (bp)3622
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of transient receptor potential cation channel subfamily A member-1 (SMED30035258) t-SNE clustered cells

Violin plots show distribution of expression levels for transient receptor potential cation channel subfamily A member-1 (SMED30035258) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of transient receptor potential cation channel subfamily A member-1 (SMED30035258) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for transient receptor potential cation channel subfamily A member-1 (SMED30035258) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 475.322 bits (1222), Expect = 1.523e-147
Identity = 346/1110 (31.17%), Postives = 554/1110 (49.91%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADK----NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQRTV-----ASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMI-TMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILF--KAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFP---------YRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSK--------NWKTVIAS 3447
            D+     +HYAAA  +IE+M+   I R       +  D  GNTP+H AV  N+I+++ +L+  GA+PN+ N + MAP+H+ V     +V+K LL H  ++ N     GN+A+ IAC  +N EAL  LLK GA  C  N +G +P+H A    +++C+E+++    + G S    +NF +     PLH AV  GD + ++MCL  GA+ID  +    T +H+A T+G  +IVKLM+ +     D+V    D    T LH+A +F+H ELA+YLI  G++I   D  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL+ ++  F+       ++ ++DN GCTPLHY+ R+G       L+       +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + +G TALH AA    +  V LLL+H A I  +KQ  +F    L  K       ++ + RW+E ++I   N     CP+  MI+ +P  + + +D   + +   +  +D+ I YNF  LQ  +        +D+  +P   +  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I      +    I+ +++ S I      +T    ++   MI     SI    KE+  IF +   YF    N +  +++ T II    +      H   Q  A+ ++  W N LL L  FE  G+F++M   IL T+L    +F  L + F  SF IL   + P SS +LS                              +++   MM+G+I +  +++ P        L +P L++  L+ F IF+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP+    W  +++ +    V+P         +    +  C+ E +      D        +L   +   + +L +L     +Q +L+KLI+QKME+  E E  D+       F K         W TV+ +
Sbjct:   60 DDMDTFFLHYAAAEGQIELME--KITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIV-NTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHL--------TVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEI-----LDTTNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLS------------------------------IIQTFSMMLGDINYRESFLEPYLRNE---LAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPL----WFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNAD-------KSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRA 1109          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Human
Match: TRPA1 (transient receptor potential cation channel subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:497])

HSP 1 Score: 412.149 bits (1058), Expect = 4.636e-126
Identity = 287/900 (31.89%), Postives = 456/900 (50.67%), Query Frame = 1
Query:  511 LLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQRTV-----ASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMI-TMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILF--KAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEI 3156
            LL H  ++ N     GN+A+ IAC  +N EAL  LLK GA  C  N +G +P+H A    +++C+E+++    + G S    +NF +     PLH AV  GD + ++MCL  GA+ID  +    T +H+A T+G  +IVKLM+ +     D+V    D    T LH+A +F+H ELA+YLI  G++I   D  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL+ ++  F+       ++ ++DN GCTPLHY+ R+G       L+       +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + +G TALH AA    +  V LLL+H A I  +KQ  +F    L  K       ++ + RW+E ++I   N     CP+  MI+ +P  + + +D   + +   +  +D+ I YNF  LQ  +        +D+  +P   +  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I      +    I+ +++ S I      +T    ++   MI     SI    KE+  IF +   YF    N +  +++ T II    +      H   Q  A+ ++  W N LL L  FE  G+F++M   IL T+L    +F  L + F  SF IL   + P SS +LS                              +++   MM+G+I +  +++ P        L +P L++  L+ F IF+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP+    W  +++
Sbjct:    2 LLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIV-NTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHL--------TVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEI-----LDTTNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLS------------------------------IIQTFSMMLGDINYRESFLEPYLRNE---LAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPL----WFLRKV 850          

HSP 2 Score: 88.5817 bits (218), Expect = 4.436e-17
Identity = 108/444 (24.32%), Postives = 189/444 (42.57%), Query Frame = 1
Query:  310 VLMIYRA-DKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPE-------VNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAV------------MFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHL-FSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLL 1578
            VL+ +R  D N    NGNT +  A   N  +AL  L+  GA P   NK    PIH   +    + ++ +LR  E       ++ N   +   + +H+A +  + E +   L  GA +          +H A      + +++++ S +      + I+N +D      LH A      +     +  GA I+   ++  +PL  A      +IV L+L      K   + I+DN G   LH  V                 ++ E +++E       D++G TPL  A  +        LL +  +I+++ K +++ +H   S   +N     L  +   +     ++NE D  G TPLH + + G  ++  +L+K G L ++ +N   T LH A+  G   T + +L+T   +K  +  D  G   +H AA  GH K + +LL
Sbjct:    1 VLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYS----GSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLS-----KGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDE-------DNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTR-----LLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGW-TALHHASMGGYTQTMKVILDT--NLKCTDRLDEDGNTALHFAAREGHAKAVALLL 420          

HSP 3 Score: 74.7146 bits (182), Expect = 9.158e-13
Identity = 79/359 (22.01%), Postives = 137/359 (38.16%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADP--------NILNKDNMAPIHLTVYKSKLDVLKELLRHP------EVNR------------------------------NQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEML------VESKNKKG--------CSPMQILNF----------------SDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPL 1104
            ENG T +  A   +  E + +L+   A     +  G  PIH A  +   + +  ++  G +         N +N     P+HL V    L+++K  L +       E  R                              N T  C  + +H A   D+ E  D L+  GA +   +  G  P+ +A    +   + +L      V+ K+  G          P  + N                  D +G  PLH A   G   +V   L +   I  +  D  +PLH+A + G ++  + +L+   + +  +L   D +G TPLH A    H ++ + L+++G+ + ++D NGWT L
Sbjct:   15 ENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTR--LLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGA-LFLSDHNGWTAL 370          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 181.415 bits (459), Expect = 2.986e-45
Identity = 140/522 (26.82%), Postives = 241/522 (46.17%), Query Frame = 1
Query:  115 EMQLHDEVCLMSDNPN--RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            EM L     ++S   N   P   A  G+ +   +L++ ++  +     + +T +H AA     +V  VL+  +A+ NA+  NG TP+H A   N IK +  L+ +GA    + +  + PIH+  +   ++++ +L+ H   + N T   G +A+H+A      E +  L++ GA V +       P+H++ +      ++ L++    +G SP    N +   G  PLH +   G        L +GA + +      TPLH A   G+L++  L+L+     K         +G TPLH A  +++ ++A  L+++G++      NG+TPL +AA +  M++  TLL+YGA+  A  +     +HL +     D V+ L+G         + +N  +  G TPLH + +   + +  +L+  G     Q     TPLH    YG +     LL        +N+    G  P+H AA+ GHT II +LL      +    +GNT L  A   G+I     L
Sbjct:  318 EMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQ----QGASP----NAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQ-----KSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRN-------ANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQH---SAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 2 Score: 167.548 bits (423), Expect = 6.071e-41
Identity = 148/572 (25.87%), Postives = 256/572 (44.76%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKN------KKGCSPMQI-------------------LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLML--------RTRHEVKDVVLKIQ--------------------DNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI---SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            ++NG+  +H A+    +EV+  L+   A+ +A    GNT +H A L  + + +  L+ NGA+ N  +++   P+++   ++ L+V+K LL +   +++  T  G + + +A +  + + +  LL+      +     +  +H+A +  + K   +L+++ N      K G +P+ I                   ++F+ +    PLH A   G+   V++ L  GAKID +  D  TPLH     G   +V+++L        +T++ +  + +  Q                     N+  T LH A    H ++A+ L+++ +N      NG+TPL +A  +  ++V + LLK+GA+I A  ++    IH          V   MG   I    +   +  N  +  G T LH + R G   +   L++ G     +  D  TPLH +AR G+    ++LL       + N+  + G  P+H +A  GH  +   LLD G         G TPLH AA  G +E    L++ + S  D     G T LH AA  D   V  LLL  GAS
Sbjct:   71 NQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLEND----TKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIH----------VAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ---GASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSAS-PDAAGKSGLTPLHVAAHYDNQKVALLLLDQGAS 623          

HSP 3 Score: 164.851 bits (416), Expect = 4.319e-40
Identity = 132/515 (25.63%), Postives = 251/515 (48.74%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKA-MNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            +G+T +H  A +   +V+++L+   A   ++  NG +P+H A   + +  +  L+ +    + +  D +  +H+  +     V K LL   + N N     G + +HIAC+ +  + ++ LLK GA + +    G+ P+HVA    +   +  L+      G SP    N ++  G   LH A  +G  + V+  +  GA+++ +  D+ TPLH +   G+ DIV+ +L+     +         +G+TPLH +    H ++A +L++ G+++ +T   G+TPL +AA    +EV   LL+  A+  A  K+    +H+ + +  N KV  L+ L++      +  N     G TPLH + ++  + +   L++ G             +H AA+ G V     LL    G  A +N ++  G  P+H AA+     + ++L+++G  +  +   G TPLH     G+I+   +L++ + + ++ +   G T LH AA    +H++ +LL + AS
Sbjct:  300 DGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL-DKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMH----HGASP----NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQ-----QGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHV-AAHYDNQKVALLL-LDQGASPHAAAKN-----GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLL----GRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQ-HSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 788          

HSP 4 Score: 143.28 bits (360), Expect = 1.726e-33
Identity = 131/469 (27.93%), Postives = 215/469 (45.84%), Query Frame = 1
Query:  397 KALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLN--TFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI 1794
            KAL Y I NG D NI N++ +  +HL   +  ++V+ ELL+  E N +  T  GN+A+HIA      E +  L+  GA V + +  G  P+++A +  + + ++ L+++   +        + + ++G  PL  A+  G  + V + L    K  VR       LH A  K +     L+L+      D    ++  +G TPLH A  + ++ +A  L+   + ++ T  N  TPL +A+ R N  + K LL  GA I A+ +     +H  + +     V  L+          + I  K   G +PLH +T+   L    +L++         ND  T LH AA  G     + LL+       KA+N     G  P+H A +    K++++LL  G         G TP+H AA  GH+     L+    S  +  N  G+TALH AA + ++ VV  L+  GA +
Sbjct:   56 KALDY-IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQR-EANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQ--------SLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRL----PALHIAARKDDTKAAALLLQN-----DNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRA-------APILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALN-----GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS-PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQV 492          

HSP 5 Score: 65.0846 bits (157), Expect = 1.043e-9
Identity = 79/273 (28.94%), Postives = 115/273 (42.12%), Query Frame = 1
Query: 1009 KAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLP-IHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLT 1818
            +A    H+E A   I+ G +I + + NG   L LA+   ++EV   LL+  AN+ A  K     +H+ SL    + V  L+       +  + +N +   G TPL+ + +   L +   L+  G        D  TPL  A + G       LL         N T    RLP +H AA    TK   +LL            G TPLH AA  G+I     L+    + +D       T LH A+    +++V LLL  GA I  K + GLT
Sbjct:   47 RAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLV-------TNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE--------NDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLN-RAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLT 303          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 177.948 bits (450), Expect = 3.791e-44
Identity = 151/512 (29.49%), Postives = 230/512 (44.92%), Query Frame = 1
Query:  148 SDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH---PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYL 1671
            + N   P   AA G+ +E  K ++ +   +     + +T +H AA      V  +L+  RA+ NAR  NG TP+H A   N IK +  L+  GA    + +  + PIH+  +   L+++  LL++   P+V    T   G +A+H+A      E + CLL+ GALV +       P+H+A +    + +++L++         M   + +   G  PLH +   G      + L  GA   +      TPLH A   G LD+ KL+L+ R             NG TPLH A  +++ ++A  L+E+G++   T  NG+TPL +AA +  M++  TLL YGA      K     +HL S     D V  L  L+K        I+     G T LH + +   + +  IL K G           TPL  A  YG V     LL        +N+    G  P+H AA+ GHT II +LL  G   +    +GNT L  A   G+I     L
Sbjct:  344 TKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV----TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH--------MAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA-----GKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL--LDKGAN-----IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQ---GANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 828          

HSP 2 Score: 164.466 bits (415), Expect = 4.685e-40
Identity = 166/622 (26.69%), Postives = 283/622 (45.50%), Query Frame = 1
Query:  160 NRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH-------PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS----LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV-IGMIKDMPNILSLAMDK 1983
            N     A+     E+ K+++     I++  +NG T ++ AA  + I+V+  L+   A+++    +G TP+  A+     +A+  L+ N    +   K  +  +H+   K        LL++        ++  N+TT  G + +HIA    N      LL  GA V      GI P+HVA K  N   +++L++   +        ++   ++G  PLH A  +G  + V++ L  GA +  R  +  +PLH A     ++ VK +L+ +  V DV L        T LH A    H  + + L+++ +N      NG+TPL +A  +  ++V + L+KYGA+I A  ++    IH+ +    LN+V      L+ L+      ++ I      G T LH + R G + +   L++ G L   +  ++ TPLH A+R G+    + LL     M   ++  + G  P+H +A  G   +  +LL+ G         G TPLH AA  G ++  + L++   +  D+    G T LH AA  D   V  LLL  GAS     K G T   HI   KN       + N   E    IV + G+ P+ +   +   ++++L +DK
Sbjct:  113 NTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ--------IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYL-----TALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIV------LLLLQNGASPDVTNIR-----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH---MAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPL-HIAAKKNQMQIASTLLNYGAE--TNIVTKQGVTPLHLASQEGHTDMVTLLLDK 699          

HSP 3 Score: 162.54 bits (410), Expect = 1.808e-39
Identity = 141/515 (27.38%), Postives = 244/515 (47.38%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH---GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            +G+T +H AA +   +V+++L+   A   AR  NG +P+H A   + ++ + +L+ + A  + +  D +  +H+  +     V K LL     N N     G + +HIAC+ +  + ++ L+K GA + +    G+ P+HVA    +   + +L+++    G SP    + ++  G   LH A   G  + V+  L  GA +D R  +  TPLH A   G+ +IV+L+L+               NG+TPLH +     V++A  L+E G+   +    G+TPL +AA   +++V K LL+  A   +  K     +H+ + +  N KV  L+ LEK      +  N     G TPLH + ++  +++   L+  G           TPLH A++ G       LL+   G     ST S G   +H AA+     +  +L   G    +  H   G TPL  A   G+++   +L++   ++ + +   G T LH AA    +H++ +LL HGA
Sbjct:  313 DGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTK-LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQN----GASP----DVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-----TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHV-AAHYDNQKVALLL-LEKGASPHATAKN-----GYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK--GANIHMSTKS-GLTSLHLAAQEDKVNVADILTKHGA--DQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANV-NAKTKNGYTPLHQAAQQGHTHIINVLLQHGA 800          

HSP 4 Score: 134.42 bits (337), Expect = 8.464e-31
Identity = 137/514 (26.65%), Postives = 226/514 (43.97%), Query Frame = 1
Query:  343 RDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELL-RHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDN----NGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNF-------LMGLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            R S+ N     A     +  +   +  G D N  N++ +  +HL   +  + +++ELL R   V  +  T  GN+A+HIA      E +  L+K GA + + +  G  P+++A +  +   ++ L+E+   +          + ++G  PL  A+  G  +AV + L    K  VR       LH A  K +     L+L+  H   DV  K+  N    +G TPLH A  + +V +A  L+  G+ ++ T  NG TPL +A+ R N  + K LL  G  I A+ +     +H  + +  +  V         L+   K   S + +  + D++ C                   T LH +   G  R+T +L+        +  +  TPLH A +  R+     L+     ++A+  +   G  PIH AA  GH  I+ +LL  G         G T LH AA  G +E  + L+  N +L+D +  E +T LH A+   K+ +V LLL H A
Sbjct:   42 RKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSV--DSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST--------ATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNA-DVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITES---GLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR-NGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMA 536          

HSP 5 Score: 65.4698 bits (158), Expect = 8.534e-10
Identity = 80/318 (25.16%), Postives = 133/318 (41.82%), Query Frame = 1
Query:  973 KIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTP-----------------------------LHFAARYGRVHTCRRLLNT-----FDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG-CIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF-KDKQGLT 1818
            K + ++  + L  A   N  ++ EYL + G +I   + NG   L LAA   ++ + + LL  G+++ +  K     +H+ SL    + V  L     +++   + IN +   G TPL+ + +   + +   L++ G    T   D  TP                             LH AAR     +   LL             +N T   G  P+H AA  G+  +  +LL+RG  +     +G TPLH A+  G+    + L++     +D +  +G T LH AA +    VV LLL  GA +  + K GL+
Sbjct:   41 KRKSDSNASFLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVL-----VKEG--ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLS 349          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 177.948 bits (450), Expect = 3.821e-44
Identity = 151/512 (29.49%), Postives = 230/512 (44.92%), Query Frame = 1
Query:  148 SDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH---PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYL 1671
            + N   P   AA G+ +E  K ++ +   +     + +T +H AA      V  +L+  RA+ NAR  NG TP+H A   N IK +  L+  GA    + +  + PIH+  +   L+++  LL++   P+V    T   G +A+H+A      E + CLL+ GALV +       P+H+A +    + +++L++         M   + +   G  PLH +   G      + L  GA   +      TPLH A   G LD+ KL+L+ R             NG TPLH A  +++ ++A  L+E+G++   T  NG+TPL +AA +  M++  TLL YGA      K     +HL S     D V  L  L+K        I+     G T LH + +   + +  IL K G           TPL  A  YG V     LL        +N+    G  P+H AA+ GHT II +LL  G   +    +GNT L  A   G+I     L
Sbjct:  308 TKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV----TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH--------MAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA-----GKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL--LDKGAN-----IHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQ---GANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 2 Score: 164.466 bits (415), Expect = 4.682e-40
Identity = 166/622 (26.69%), Postives = 283/622 (45.50%), Query Frame = 1
Query:  160 NRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH-------PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS----LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV-IGMIKDMPNILSLAMDK 1983
            N     A+     E+ K+++     I++  +NG T ++ AA  + I+V+  L+   A+++    +G TP+  A+     +A+  L+ N    +   K  +  +H+   K        LL++        ++  N+TT  G + +HIA    N      LL  GA V      GI P+HVA K  N   +++L++   +        ++   ++G  PLH A  +G  + V++ L  GA +  R  +  +PLH A     ++ VK +L+ +  V DV L        T LH A    H  + + L+++ +N      NG+TPL +A  +  ++V + L+KYGA+I A  ++    IH+ +    LN+V      L+ L+      ++ I      G T LH + R G + +   L++ G L   +  ++ TPLH A+R G+    + LL     M   ++  + G  P+H +A  G   +  +LL+ G         G TPLH AA  G ++  + L++   +  D+    G T LH AA  D   V  LLL  GAS     K G T   HI   KN       + N   E    IV + G+ P+ +   +   ++++L +DK
Sbjct:   77 NTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ--------IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYL-----TALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIV------LLLLQNGASPDVTNIR-----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH---MAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPL-HIAAKKNQMQIASTLLNYGAE--TNIVTKQGVTPLHLASQEGHTDMVTLLLDK 663          

HSP 3 Score: 162.54 bits (410), Expect = 1.822e-39
Identity = 141/515 (27.38%), Postives = 244/515 (47.38%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH---GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            +G+T +H AA +   +V+++L+   A   AR  NG +P+H A   + ++ + +L+ + A  + +  D +  +H+  +     V K LL     N N     G + +HIAC+ +  + ++ L+K GA + +    G+ P+HVA    +   + +L+++    G SP    + ++  G   LH A   G  + V+  L  GA +D R  +  TPLH A   G+ +IV+L+L+               NG+TPLH +     V++A  L+E G+   +    G+TPL +AA   +++V K LL+  A   +  K     +H+ + +  N KV  L+ LEK      +  N     G TPLH + ++  +++   L+  G           TPLH A++ G       LL+   G     ST S G   +H AA+     +  +L   G    +  H   G TPL  A   G+++   +L++   ++ + +   G T LH AA    +H++ +LL HGA
Sbjct:  277 DGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTK-LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQN----GASP----DVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-----TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHV-AAHYDNQKVALLL-LEKGASPHATAKN-----GYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDK--GANIHMSTKS-GLTSLHLAAQEDKVNVADILTKHGA--DQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANV-NAKTKNGYTPLHQAAQQGHTHIINVLLQHGA 764          

HSP 4 Score: 133.65 bits (335), Expect = 1.248e-30
Identity = 142/523 (27.15%), Postives = 233/523 (44.55%), Query Frame = 1
Query:  316 MIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELL-RHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDN----NGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNF-------LMGLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            M+ ++D NA      + +  A   N  K + YL   G D N  N++ +  +HL   +  + +++ELL R   V  +  T  GN+A+HIA      E +  L+K GA + + +  G  P+++A +  +   ++ L+E+   +          + ++G  PL  A+  G  +AV + L    K  VR       LH A  K +     L+L+  H   DV  K+  N    +G TPLH A  + +V +A  L+  G+ ++ T  NG TPL +A+ R N  + K LL  G  I A+ +     +H  + +  +  V         L+   K   S + +  + D++ C                   T LH +   G  R+T +L+        +  +  TPLH A +  R+     L+     ++A+  +   G  PIH AA  GH  I+ +LL  G         G T LH AA  G +E  + L+  N +L+D +  E +T LH A+   K+ +V LLL H A
Sbjct:    4 MLQKSDSNA------SFLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSV--DSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST--------ATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNA-DVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITES---GLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR-NGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMA 500          

HSP 5 Score: 66.2402 bits (160), Expect = 5.061e-10
Identity = 82/320 (25.62%), Postives = 135/320 (42.19%), Query Frame = 1
Query:  967 VLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTP-----------------------------LHFAARYGRVHTCRRLLNT-----FDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG-CIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF-KDKQGLT 1818
            +L+  D+N  + L  A   N  ++ EYL + G +I   + NG   L LAA   ++ + + LL  G+++ +  K     +H+ SL    + V  L     +++   + IN +   G TPL+ + +   + +   L++ G    T   D  TP                             LH AAR     +   LL             +N T   G  P+H AA  G+  +  +LL+RG  +     +G TPLH A+  G+    + L++     +D +  +G T LH AA +    VV LLL  GA +  + K GL+
Sbjct:    4 MLQKSDSNA-SFLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVL-----VKEG--ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLS 313          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 239.195 bits (609), Expect = 3.465e-64
Identity = 269/1101 (24.43%), Postives = 469/1101 (42.60%), Query Frame = 1
Query:  172 QFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHA------------VLNNE------------IKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPL-HYACTKGELDIVKLMLRT---RHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEE-GSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRN-----------------LIHLFSLNVVNDKV--------NFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVD-------ENGI-----CPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTV-------------------ASKEDL-----------NSDPFYV---VKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHET-----AKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQ-----VAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYT----LHYPTLTYI---FLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKL 3120
            Q A  GN   +++ ++     +++ D + MT +HYAA     + + +L+   A  N ++  G+TP+H A            +++ +             K +  L+   A+ + +NK  + P+H    KS    L  L++  + + +       + + +AC   +QE +  L+KA + V   +       H+       + LEM+++         ++ LN  + E   PL  AV     + ++  L    K   +  D    L H+A  KG L+++K ++     ++E+ +V           PLH A   N +E+  YLIEE   NI+V D+ G TPL++A +  + +  + L+   AN+   DK +R                  L HL   N   ++            +  E ++++ +++++   N   TP+H     G L +  +L K G      N D++T LH AA  G+    R+LL     ++ +   D  G   +H AA +GH    ++LLD G     +  +  TPL  A  +G +ETCQ L+     +    + + KT LH AA      +V   +  G +I  +D++G T F    +  + + A+  +  ++W+ ++   D        N +      P   ++   P + S  MD  I+           + YNF  L  T                    A  ED            N D  Y    +K M D  ++ LL HPLS A LK KW R GR + Y  + +Y++F+ +L+       +   +    N+       + + F  +ET       K  +V  +I    ++  ++ E   +F +  AY  +++N++   ++ T++I               Q     +AA+ IF GW NLL ++    + G+FV+MFV I+ T      +F +  I F+ SF +         IL N+P F+  +       + P            +K  VMM+GE EF     T ++ G+  T    +  P  T +       F I M++LLMNLL+GLAV DI+ VQ+ A LKR+++QV  + + E  L
Sbjct:   55 QSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIK-LKADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHD---PVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEV--------KAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQN---TPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEW--DIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQI--ESSSDTKTVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCIEKSKEETDSTQSVAYNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLT------QYVRHTKAPYNVWNEESYYDSEYFDENETCPQINTTKPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYV---------ILQNRPEFSTIF-------MSP------------LKTTVMMIGEFEF-----TGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASL 1097          

HSP 2 Score: 88.5817 bits (218), Expect = 2.323e-17
Identity = 120/538 (22.30%), Postives = 228/538 (42.38%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVM-DVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTV-----YKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVV--LKIQDNNGHTPLHKAVMFNHVE-LAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMN------STDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--KDKQG 1812
            +N  +++H +A    +  + + L+      NA+D +  TP+H+A       A+  L+   A PN  N++   P+H+       Y     ++ E       ++  +    N+A         ++ ++ L+   A +   N Y + P+H A    N   L  L++ K          ++  D     PL  A   G  + +Q  +   + +  R    +T  H    +GE + +++M+   H+  + +  L + +N   TPL  AV  NH E L + L  E  N     D     +  AA +  +EV K L++ G N    ++ +   +H+ +     + V++L+  EK     I +++E+   G TPL  +      +    LI         + D+ TP+   A++  + +   +L   D ++  N      +  S  R  +   +E+    ++ M+ DR          NTP+H  A+NG++E  Q L++ + + +   N + +TALH AAI  ++  V  LL     +   KD+ G
Sbjct:   47 DNLRSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDE-------DQADSARKYNTA--------TKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKAD--------VDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMD--HDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDN---IDVVDEQ---GLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYIL---DHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMV-DRD--------QNTPMHIVASNGYLEMMQ-LLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMG 540          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Celegans
Match: trpa-1 (Transient receptor potential cation channel subfamily A member 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18297])

HSP 1 Score: 239.195 bits (609), Expect = 3.903e-64
Identity = 269/1101 (24.43%), Postives = 469/1101 (42.60%), Query Frame = 1
Query:  172 QFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHA------------VLNNE------------IKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPL-HYACTKGELDIVKLMLRT---RHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEE-GSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRN-----------------LIHLFSLNVVNDKV--------NFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVD-------ENGI-----CPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTV-------------------ASKEDL-----------NSDPFYV---VKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHET-----AKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQ-----VAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYT----LHYPTLTYI---FLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKL 3120
            Q A  GN   +++ ++     +++ D + MT +HYAA     + + +L+   A  N ++  G+TP+H A            +++ +             K +  L+   A+ + +NK  + P+H    KS    L  L++  + + +       + + +AC   +QE +  L+KA + V   +       H+       + LEM+++         ++ LN  + E   PL  AV     + ++  L    K   +  D    L H+A  KG L+++K ++     ++E+ +V           PLH A   N +E+  YLIEE   NI+V D+ G TPL++A +  + +  + L+   AN+   DK +R                  L HL   N   ++            +  E ++++ +++++   N   TP+H     G L +  +L K G      N D++T LH AA  G+    R+LL     ++ +   D  G   +H AA +GH    ++LLD G     +  +  TPL  A  +G +ETCQ L+     +    + + KT LH AA      +V   +  G +I  +D++G T F    +  + + A+  +  ++W+ ++   D        N +      P   ++   P + S  MD  I+           + YNF  L  T                    A  ED            N D  Y    +K M D  ++ LL HPLS A LK KW R GR + Y  + +Y++F+ +L+       +   +    N+       + + F  +ET       K  +V  +I    ++  ++ E   +F +  AY  +++N++   ++ T++I               Q     +AA+ IF GW NLL ++    + G+FV+MFV I+ T      +F +  I F+ SF +         IL N+P F+  +       + P            +K  VMM+GE EF     T ++ G+  T    +  P  T +       F I M++LLMNLL+GLAV DI+ VQ+ A LKR+++QV  + + E  L
Sbjct:   56 QSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIK-LKADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHD---PVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEV--------KAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQN---TPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEW--DIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQI--ESSSDTKTVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCIEKSKEETDSTQSVAYNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLT------QYVRHTKAPYNVWNEESYYDSEYFDENETCPQINTTKPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYV---------ILQNRPEFSTIF-------MSP------------LKTTVMMIGEFEF-----TGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASL 1098          

HSP 2 Score: 88.5817 bits (218), Expect = 2.285e-17
Identity = 120/538 (22.30%), Postives = 228/538 (42.38%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVM-DVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTV-----YKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVV--LKIQDNNGHTPLHKAVMFNHVE-LAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMN------STDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--KDKQG 1812
            +N  +++H +A    +  + + L+      NA+D +  TP+H+A       A+  L+   A PN  N++   P+H+       Y     ++ E       ++  +    N+A         ++ ++ L+   A +   N Y + P+H A    N   L  L++ K          ++  D     PL  A   G  + +Q  +   + +  R    +T  H    +GE + +++M+   H+  + +  L + +N   TPL  AV  NH E L + L  E  N     D     +  AA +  +EV K L++ G N    ++ +   +H+ +     + V++L+  EK     I +++E+   G TPL  +      +    LI         + D+ TP+   A++  + +   +L   D ++  N      +  S  R  +   +E+    ++ M+ DR          NTP+H  A+NG++E  Q L++ + + +   N + +TALH AAI  ++  V  LL     +   KD+ G
Sbjct:   48 DNLRSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDE-------DQADSARKYNTA--------TKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKAD--------VDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMD--HDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDN---IDVVDEQ---GLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYIL---DHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMV-DRD--------QNTPMHIVASNGYLEMMQ-LLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMG 541          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 160.229 bits (404), Expect = 4.361e-39
Identity = 144/514 (28.02%), Postives = 242/514 (47.08%), Query Frame = 1
Query:  259 MTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLL-NTFD-GMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            +T +H AA +   +V+D+L++  A  +A+  NG  P+H A   + + A   L+ + A  + +  D + P+H+  +   + V K LL     + N     G + +HIAC+ +  + ++ LLK  A + +    G+ P+HVA        +  L++    +G +P    +     G  PLH A     T  V++ +  GAK+D +  +  TPLH A   G  DIV L+L+            +DN  ++PLH A      E+A  L++  ++  +    G+TPL LA+   N+EV + LL+ G  +    K Q   +H+ + +  NDKV  L+ LE    +  +  N     G TPLH + ++  + +   L++       ++    TPLH +A+ G       L+ N  D G KA N     G   +H  A+  H  + Q+L + G  I  +   G TPLH A   G +   ++L+E N + +  +     T LH AA    ++ V  LL +GAS
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ----QGANP----DVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT---RDN--YSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHV-AAHYNNDKVAMLL-LENGASAKAAAKN-----GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANN-----GLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE-NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 154.836 bits (390), Expect = 2.028e-37
Identity = 135/494 (27.33%), Postives = 230/494 (46.56%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTAL 1728
            +NG+  +H AA    ++    L+ +RA  +    +  TP+H A     ++    L+   ADPN    +   P+H+   K+++ V++ LL++       TT  G + +H+A  +     +  LL+ GA      V G  P+H+A +      + +L+ +  K        ++   +E   PLH A   G+T  V + L  GA  +    DN +PLH A  +G+ ++  ++L   H     +L      G TPLH A  + ++E+   L+E G+ +++   N  TPL +AA   N +V   LL+ GA+  A  K     +H+ +      K N  M +      F +  N K   G TPLH S + G   ++G+LI+ G     + N+  T +H  A+   V   + L N  +G + +NS  + G  P+H A   G   +++ L++ G  +  +     TPLH AA  GH    +YL+E N +  + Q   G+T L
Sbjct:  324 KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK--------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL--DHNADKTLLT---KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA------KKN-QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYN--NGAE-INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE-NGASPNEQTATGQTPL 792          

HSP 3 Score: 154.451 bits (389), Expect = 2.444e-37
Identity = 129/472 (27.33%), Postives = 217/472 (45.97%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL--NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQML 1575
            P   AA    + + KL++  S   +S   NG T +H A   +RI+V+++L+ YRA   A   +G TP+H A     I  + YL+  GA+P++       P+HL    ++ DV++ L+R+      Q      + +HIA  + N + +  LL+AGA   +       P+H+A K   E+   +L++    K            K+G  PLH A   G+ + V++ L  G  +D+   +  TPLH A       +  L+L      K         NG+TPLH A   N +E+A  L++  ++       G+TPL L+A   + E+   L++ G+++ A+       +HL +   +V   ++ +  G E         IN K N G TPLH +   G L +   L++ G     +     TPLH AA+ G  +  R LL   +   + N   + G+ P+  A   G+  +++ L
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADK--------TLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-----KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE---------INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 149.828 bits (377), Expect = 6.590e-36
Identity = 151/575 (26.26%), Postives = 254/575 (44.17%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNS-----------------------------AIHIACEIDNQEALDCLLKAGALVCSPNVY---GIYPVHVAIKYCNEKCLEMLVES------KNKKGCSPMQ-------------------ILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC---IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            + NG+  +H A+     EV+  L+  +A  +A    GNT +H A L  +   +T L+ NGA+ N+ + +   P+++   ++  +V+K LL+H   N+  +T  G +                             A+HIA + D+  A   LL+      +P+V    G  P+H+A  Y +E   ++L+E       + +   SP+                    I++   K+   PLH A  +G  + V + +  GA I  +  +   PLH A     +D  + +L  R  V DV +        TPLH A    HV +A+ L++  ++      NG+TPL +A  +  ++V + LLKY A I A  ++    +H+ +     + V +L  L++     +  +      G TPLH + R     +  +LI+ G     Q  +  TPLH A+R G       LL    G  + N+T      P+H AA+ G  ++  +LLD      +  +   G TPLH A+  G++E  + L+E   + +D +     T LH AA  +   V  LLL +GAS
Sbjct:   63 NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL-----TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYL--LQQGANPDVETVR-----GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA--GANS-NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK--KGFTPLHLASKYGNLEVVRLLLERG-TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 5 Score: 134.806 bits (338), Expect = 2.233e-31
Identity = 134/498 (26.91%), Postives = 222/498 (44.58%), Query Frame = 1
Query:  349 SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLD-RGCIFHRCYHGNTPLHYAATNGHIETCQYLIEM--NPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHI 1833
            + G+     A    +++ +  L+  G D N  N + +  +HL   +   +V++EL++  +   +  T  GN+A+HIA        +  L++ GA V   +V G  P+++A +  +E+ ++ L++    +          S ++G  PL  A+  G  + V + L   +K  VR       LH A  K +     L+L+  H   DV  K    +G TPLH A  + H  + + L+E+G+N+     +  +PL +A       +   LL  GA I +R K     +H  + +  +  V+ L+    +Q + IS    K   G  PLH + +   +     L+           D  TPLH AA  G V   + LL   D     NS    G  P+H A +    K++++LL  R  I      G TPLH AA  G I    YL++   NP   D +   G+T LH AA  +++ VV +L+ +GA +    + L    HI
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKR-QAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQA--------LSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHN-PDVTSK----SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV----VQGAPIS---AKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL---DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANP---DVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHI 497          

HSP 6 Score: 75.485 bits (184), Expect = 2.572e-13
Identity = 58/226 (25.66%), Postives = 100/226 (44.25%), Query Frame = 1
Query:  154 NPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQ 831
            N   P   AA  N  ++  L++ N     ++ +NG T +H AA  +++E+   L+ ++AD NA+   G TP+H +      +    LI NG+D      + +  +HL   +  + V  ++L +     N  T+ G + +H+AC       +  L++ GA V         P+H A +  +  C+  L+E+    G SP    N     G  PL  A   G    V+
Sbjct:  589 NQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN----GASP----NEQTATGQTPLSIAQRLGYVSVVE 805          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 160.229 bits (404), Expect = 4.361e-39
Identity = 144/514 (28.02%), Postives = 242/514 (47.08%), Query Frame = 1
Query:  259 MTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLL-NTFD-GMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            +T +H AA +   +V+D+L++  A  +A+  NG  P+H A   + + A   L+ + A  + +  D + P+H+  +   + V K LL     + N     G + +HIAC+ +  + ++ LLK  A + +    G+ P+HVA        +  L++    +G +P    +     G  PLH A     T  V++ +  GAK+D +  +  TPLH A   G  DIV L+L+            +DN  ++PLH A      E+A  L++  ++  +    G+TPL LA+   N+EV + LL+ G  +    K Q   +H+ + +  NDKV  L+ LE    +  +  N     G TPLH + ++  + +   L++       ++    TPLH +A+ G       L+ N  D G KA N     G   +H  A+  H  + Q+L + G  I  +   G TPLH A   G +   ++L+E N + +  +     T LH AA    ++ V  LL +GAS
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ----QGANP----DVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATT---RDN--YSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHV-AAHYNNDKVAMLL-LENGASAKAAAKN-----GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANN-----GLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE-NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 154.836 bits (390), Expect = 2.028e-37
Identity = 135/494 (27.33%), Postives = 230/494 (46.56%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTAL 1728
            +NG+  +H AA    ++    L+ +RA  +    +  TP+H A     ++    L+   ADPN    +   P+H+   K+++ V++ LL++       TT  G + +H+A  +     +  LL+ GA      V G  P+H+A +      + +L+ +  K        ++   +E   PLH A   G+T  V + L  GA  +    DN +PLH A  +G+ ++  ++L   H     +L      G TPLH A  + ++E+   L+E G+ +++   N  TPL +AA   N +V   LL+ GA+  A  K     +H+ +      K N  M +      F +  N K   G TPLH S + G   ++G+LI+ G     + N+  T +H  A+   V   + L N  +G + +NS  + G  P+H A   G   +++ L++ G  +  +     TPLH AA  GH    +YL+E N +  + Q   G+T L
Sbjct:  324 KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK--------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL--DHNADKTLLT---KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA------KKN-QMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYN--NGAE-INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE-NGASPNEQTATGQTPL 792          

HSP 3 Score: 154.451 bits (389), Expect = 2.444e-37
Identity = 129/472 (27.33%), Postives = 217/472 (45.97%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL--NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQML 1575
            P   AA    + + KL++  S   +S   NG T +H A   +RI+V+++L+ YRA   A   +G TP+H A     I  + YL+  GA+P++       P+HL    ++ DV++ L+R+      Q      + +HIA  + N + +  LL+AGA   +       P+H+A K   E+   +L++    K            K+G  PLH A   G+ + V++ L  G  +D+   +  TPLH A       +  L+L      K         NG+TPLH A   N +E+A  L++  ++       G+TPL L+A   + E+   L++ G+++ A+       +HL +   +V   ++ +  G E         IN K N G TPLH +   G L +   L++ G     +     TPLH AA+ G  +  R LL   +   + N   + G+ P+  A   G+  +++ L
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADK--------TLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-----KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE---------INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 149.828 bits (377), Expect = 6.590e-36
Identity = 151/575 (26.26%), Postives = 254/575 (44.17%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNS-----------------------------AIHIACEIDNQEALDCLLKAGALVCSPNVY---GIYPVHVAIKYCNEKCLEMLVES------KNKKGCSPMQ-------------------ILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC---IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            + NG+  +H A+     EV+  L+  +A  +A    GNT +H A L  +   +T L+ NGA+ N+ + +   P+++   ++  +V+K LL+H   N+  +T  G +                             A+HIA + D+  A   LL+      +P+V    G  P+H+A  Y +E   ++L+E       + +   SP+                    I++   K+   PLH A  +G  + V + +  GA I  +  +   PLH A     +D  + +L  R  V DV +        TPLH A    HV +A+ L++  ++      NG+TPL +A  +  ++V + LLKY A I A  ++    +H+ +     + V +L  L++     +  +      G TPLH + R     +  +LI+ G     Q  +  TPLH A+R G       LL    G  + N+T      P+H AA+ G  ++  +LLD      +  +   G TPLH A+  G++E  + L+E   + +D +     T LH AA  +   V  LLL +GAS
Sbjct:   63 NANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEH---NPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL-----TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYL--LQQGANPDVETVR-----GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA--GANS-NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTK--KGFTPLHLASKYGNLEVVRLLLERG-TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 5 Score: 134.806 bits (338), Expect = 2.233e-31
Identity = 134/498 (26.91%), Postives = 222/498 (44.58%), Query Frame = 1
Query:  349 SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLD-RGCIFHRCYHGNTPLHYAATNGHIETCQYLIEM--NPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHI 1833
            + G+     A    +++ +  L+  G D N  N + +  +HL   +   +V++EL++  +   +  T  GN+A+HIA        +  L++ GA V   +V G  P+++A +  +E+ ++ L++    +          S ++G  PL  A+  G  + V + L   +K  VR       LH A  K +     L+L+  H   DV  K    +G TPLH A  + H  + + L+E+G+N+     +  +PL +A       +   LL  GA I +R K     +H  + +  +  V+ L+    +Q + IS    K   G  PLH + +   +     L+           D  TPLH AA  G V   + LL   D     NS    G  P+H A +    K++++LL  R  I      G TPLH AA  G I    YL++   NP   D +   G+T LH AA  +++ VV +L+ +GA +    + L    HI
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKR-QAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQA--------LSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHN-PDVTSK----SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV----VQGAPIS---AKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL---DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANP---DVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHI 497          

HSP 6 Score: 75.485 bits (184), Expect = 2.572e-13
Identity = 58/226 (25.66%), Postives = 100/226 (44.25%), Query Frame = 1
Query:  154 NPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQ 831
            N   P   AA  N  ++  L++ N     ++ +NG T +H AA  +++E+   L+ ++AD NA+   G TP+H +      +    LI NG+D      + +  +HL   +  + V  ++L +     N  T+ G + +H+AC       +  L++ GA V         P+H A +  +  C+  L+E+    G SP    N     G  PL  A   G    V+
Sbjct:  589 NQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPV-AQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLEN----GASP----NEQTATGQTPLSIAQRLGYVSVVE 805          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 153.295 bits (386), Expect = 4.278e-37
Identity = 144/514 (28.02%), Postives = 243/514 (47.28%), Query Frame = 1
Query:  259 MTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLL-NTFD-GMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            +T +H AA +   +V+D+L++  A  +A+  NG  P+H A   + + A   L+ + A  + +  D + P+H+  +   + V K LL     + N     G + +HIAC+ +  + ++ LLK  A + +    G+ P+HVA        +  L++    +G +P    +     G  PLH A     T  V++ +  GAK+D +  +  TPLH A   G  DIV L+L+      +     +DN  ++PLH A      E+A  L++  ++  +    G+TPL LA+   N+EV + LL+ G  +    K Q   +H+ + +  NDKV  L+ LE    +  +  N     G TPLH + ++  + +   L++       ++    TPLH +A+ G       L+ N  D G KA N     G   +H  A+  H  + Q+L + G  I  +   G TPLH A   G +   ++L+E N + +  +     T LH AA    ++ V  LL +GAS
Sbjct:  294 LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ----QGANP----DVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAG---ANSNATTRDN--YSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHV-AAHYNNDKVAMLL-LENGASAKAAAKN-----GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANN-----GLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE-NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS 780          

HSP 2 Score: 148.673 bits (374), Expect = 9.619e-36
Identity = 133/494 (26.92%), Postives = 230/494 (46.56%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTAL 1728
            +NG+  +H AA    ++    L+ +RA  +    +  TP+H A     ++    L+   ADPN    +   P+H+   K+++ V++ LL++       TT  G + +H+A  +     +  LL+ GA      V G  P+H+A +      + +L+ +  K        ++   +E   PLH A   G+T  V + L  GA  +    DN +PLH A  +G+ ++  ++L   H     +L      G TPLH A  + ++E+   L+E G+ +++   N  TPL +AA   N +V   LL+ GA+  A  K     +H+ +     +  + L+        F +  N K   G TPLH S + G   ++G+LI+ G     + N+  T +H  A+   V   + L N  +G + +NS  + G  P+H A   G   +++ L++ G  +  +     TPLH AA  GH    +YL+E N +  + Q   G+T L
Sbjct:  324 KNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKY-RAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK--------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL--DHNADKTLLT---KKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLL-------QFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYN--NGAE-INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE-NGASPNEQTATGQTPL 792          

HSP 3 Score: 147.517 bits (371), Expect = 2.232e-35
Identity = 129/472 (27.33%), Postives = 217/472 (45.97%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL--NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQML 1575
            P   AA    + + KL++  S   +S   NG T +H A   +RI+V+++L+ YRA   A   +G TP+H A     I  + YL+  GA+P++       P+HL    ++ DV++ L+R+      Q      + +HIA  + N + +  LL+AGA   +       P+H+A K   E+   +L++    K            K+G  PLH A   G+ + V++ L  G  +D+   +  TPLH A       +  L+L      K         NG+TPLH A   N +E+A  L++  ++       G+TPL L+A   + E+   L++ G+++ A+       +HL +   +V   ++ +  G E         IN K N G TPLH +   G L +   L++ G     +     TPLH AA+ G  +  R LL   +   + N   + G+ P+  A   G+  +++ L
Sbjct:  362 PLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQAREL-QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADK--------TLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAA-----KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAE---------INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL---ENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 142.51 bits (358), Expect = 7.921e-34
Identity = 162/596 (27.18%), Postives = 256/596 (42.95%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNS-----------------------------AIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNI-EVTDD--------------------------------NGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKN 1848
            NG+  +H A+     EV+  L+  +A  +A    GNT +H A L  +   +T L+ NGA+ N+ + +   P+++   ++  +V+K LL+H   N+  +T  G +                             A+HIA + D+  A   LL+        +  G  P+H+A  Y +E   ++L+E    KG +    +N+  +    PLH A   G T    + L  GA ID R  D  TPLH A   G   +V L++     V+   +  +  NG  PLH A   +HV+ A  L+   + + +VT D                                NG+TPL +A  +  ++V + LLKY A I A  ++    +H+ +     + V +L  L++     +  +      G TPLH + R     +  +LI+ G     Q  +  TPLH A+R G       LL    G  + N+T      P+H AA+ G  ++  +LLD           G TPLH A+  G++E  + L+E   + +D +     T LH AA  +   V  LLL +GAS     K G T   HI   KN
Sbjct:   65 NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLE----KGAN----VNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-----VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYL--LQQGANPDVETVR-----GETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA--GANS-NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERG-TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPL-HIAAKKN 634          

HSP 5 Score: 129.798 bits (325), Expect = 6.092e-30
Identity = 138/498 (27.71%), Postives = 224/498 (44.98%), Query Frame = 1
Query:  349 SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLD-RGCIFHRCYHGNTPLHYAATNGHIETCQYLIEM--NPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHI 1833
            + G+     A    +++ +  L+  G D N  N + +  +HL   +   +V++EL++  +   +  T  GN+A+HIA        +  L++ GA V   +V G  P+++A +  +E+ ++ L+    K G +  Q L+  D  G  PL  A+  G  + V + L   +K  VR       LH A  K +     L+L+  H   DV  K    +G TPLH A  + H  + + L+E+G+N+     +  +PL +A       +   LL  GA I +R K     +H  + +  +  V+ L+    +Q + IS    K   G  PLH + +   +     L+           D  TPLH AA  G V   + LL   D     NS    G  P+H A +    K++++LL  R  I      G TPLH AA  G I    YL++   NP   D +   G+T LH AA  +++ VV +L+ +GA +    + L    HI
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKR-QAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLL----KHGAN--QALSTED--GFTPLAVALQQGHDRVVAVLLENDSKGKVRL----PALHIAAKKDDTTAATLLLQNEHN-PDVTSK----SGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV----VQGAPISA---KTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL---DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANP---DVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHI 497          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331824)

HSP 1 Score: 547.354 bits (1409), Expect = 7.163e-174
Identity = 386/1142 (33.80%), Postives = 617/1142 (54.03%), Query Frame = 1
Query:  133 EVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEV-NRNQTTSCGNSAIHIACEIDNQEALDCLL-KAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN--VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVV-FNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQRTV----ASKEDLNSD-----PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFL------SALSFNTYAITF-----------TALSHVDKNISTSAE-CSNIDIFYGHETAKK--AVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMD--INHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFK-EIWEVFPYRCPTYKICS-SEAQVIYKK---NDYEESRDLGNL-FET--------LNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEA-EISDNIIP 3402
            EVCL+ D+P R  + A +GN  + ++L + ++  I+  D  G T  H AAA +R+ ++  +     D NA+D+ GNTP+H AV ++   AL YL+    D  +LN+   AP+HL    +K+  L+ + ++  V +  Q    G +A+H+A   D++E    L+ +  A    P   G YP+H A K  + K +E+  +   ++GC+  ++++F D EGNVPLH+AV+ GD KAV++CL  GAKI  +Q+D STP+H AC +G +DIVKLM   +   K + L   D    TPLH A MF+H ++  YL+ EG++I   D    +PLLLAASR   +    L++ GA I  +D   RN++H   +N   + D    +   +  Q     ++NEKD+MGC+PLHY++R G +R    LI+LG     +NN+ ++PLHFAARYGR +T R+LL++  G   +N +D  G  P+H +++ GHT+++Q+LL+RG + HR + G  PL  AA +G+ ET + L  ++  LLD  + +G TALH A + +K H + +L++ G  +  +   ++   + +  K    A  +V    R  EV+ +  +   C  + +I  MP +     DK I K    +  K F I Y+F   Q+T     A +++ N       P  VV TMV   R++LL HPLS  YL+MKW  +G++     +L+Y IFL      S+L  N   +                  +  N+S +    S I +    E   +  A+L  A++ + Y ++N ++E   I+ + L Y     N ++ VL+I+++++ +   + D  IN      A++ +FL WF LLL L  F+++G++V+MF++IL T++ VL +FSIL I F  +F IL      S+I+  QP           N L      +  +P  L++   MM+GE++F+ TYV   Y      L  P  +++ L VF+I M +LLMNLLIGLAVGDIE+V++NA LKR+++QV   +E E KLP     W  + +  E+  Y  P    C       I +K   N + E   +  + F+         L    ++L ++     QQ  L++LI+QKME+  EA ++ + I P
Sbjct:   84 EVCLLRDSPFRILRAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQ-TQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL-----SKIIDPQP-----------NHLS-----FSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ---LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP---HVWLQRVDKMELIEY--PNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKMEIKTEADDVDEGISP 1195          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331823)

HSP 1 Score: 544.273 bits (1401), Expect = 1.253e-172
Identity = 384/1143 (33.60%), Postives = 614/1143 (53.72%), Query Frame = 1
Query:  133 EVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEV-NRNQTTSCGNSAIHIACEIDNQEALDCLL-KAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN--VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVV-FNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ----------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFL------SALSFNTYAITF-----------TALSHVDKNISTSAE-CSNIDIFYGHETAKK--AVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMD--INHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFK-EIWEVFPYRCPTYKICS-SEAQVIYKK---NDYEESRDLGNL-FET--------LNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEA-EISDNIIP 3402
            EVCL+ D+P R  + A +GN  + ++L + ++  I+  D  G T  H AAA +R+ ++  +     D NA+D+ GNTP+H AV ++   AL YL+    D  +LN+   AP+HL    +K+  L+ + ++  V +  Q    G +A+H+A   D++E    L+ +  A    P   G YP+H A K  + K +E+  +   ++GC+  ++++F D EGNVPLH+AV+ GD KAV++CL  GAKI  +Q+D STP+H AC +G +DIVKLM   +   K + L   D    TPLH A MF+H ++  YL+ EG++I   D    +PLLLAASR   +    L++ GA I  +D   RN++H   +N   + D    +   +  Q     ++NEKD+MGC+PLHY++R G +R    LI+LG     +NN+ ++PLHFAARYGR +T R+LL++  G   +N +D  G  P+H +++ GHT+++Q+LL+RG + HR + G  PL  AA +G+ ET + L  ++  LLD  + +G TALH A + +K H + +L++ G  +  +   ++   + +  K    A  +V    R  EV+ +  +   C  + +I  MP +     DK I K    +  K F I Y+F  LQ          +T  S    +  P   + TMV   R++LL HPLS  YL+MKW  +G++     +L+Y IFL      S+L  N   +                  +  N+S +    S I +    E   +  A+L  A++ + Y ++N ++E   I+ + L Y     N ++ VL+I+++++ +   + D  IN      A++ +FL WF LLL L  F+++G++V+MF++IL T++ VL +FSIL I F  +F IL      S+I+  QP           N L      +  +P  L++   MM+GE++F+ TYV   Y      L  P  +++ L VF+I M +LLMNLLIGLAVGDIE+V++NA LKR+++QV   +E E KLP     W  + +  E+  Y  P    C       I +K   N + E   +  + F+         L    ++L ++     QQ  L++LI+QKME+  EA ++ + I P
Sbjct:   84 EVCLLRDSPFRILRAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQ-TQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL-----SKIIDPQP-----------NHLS-----FSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ---LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP---HVWLQRVDKMELIEY--PNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKMEIKTEADDVDEGISP 1196          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331826)

HSP 1 Score: 535.028 bits (1377), Expect = 1.512e-169
Identity = 383/1142 (33.54%), Postives = 612/1142 (53.59%), Query Frame = 1
Query:  145 MSDNPNRP----FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEV-NRNQTTSCGNSAIHIACEIDNQEALDCLL-KAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN--VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVV-FNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQRTV----ASKEDLNSD-----PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFL------SALSFNTYAITF-----------TALSHVDKNISTSAE-CSNIDIFYGHETAKK--AVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMD--INHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFK-EIWEVFPYRCPTYKICS-SEAQVIYKK---NDYEESRDLGNL-FET--------LNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEA-EISDNIIP 3402
            MS  P  P     + A +GN  + ++L + ++  I+  D  G T  H AAA +R+ ++  +     D NA+D+ GNTP+H AV ++   AL YL+    D  +LN+   AP+HL    +K+  L+ + ++  V +  Q    G +A+H+A   D++E    L+ +  A    P   G YP+H A K  + K +E+  +   ++GC+  ++++F D EGNVPLH+AV+ GD KAV++CL  GAKI  +Q+D STP+H AC +G +DIVKLM   +   K + L   D    TPLH A MF+H ++  YL+ EG++I   D    +PLLLAASR   +    L++ GA I  +D   RN++H   +N   + D    +   +  Q     ++NEKD+MGC+PLHY++R G +R    LI+LG     +NN+ ++PLHFAARYGR +T R+LL++  G   +N +D  G  P+H +++ GHT+++Q+LL+RG + HR + G  PL  AA +G+ ET + L  ++  LLD  + +G TALH A + +K H + +L++ G  +  +   ++   + +  K    A  +V    R  EV+ +  +   C  + +I  MP +     DK I K    +  K F I Y+F   Q+T     A +++ N       P  VV TMV   R++LL HPLS  YL+MKW  +G++     +L+Y IFL      S+L  N   +                  +  N+S +    S I +    E   +  A+L  A++ + Y ++N ++E   I+ + L Y     N ++ VL+I+++++ +   + D  IN      A++ +FL WF LLL L  F+++G++V+MF++IL T++ VL +FSIL I F  +F IL      S+I+  QP           N L      +  +P  L++   MM+GE++F+ TYV   Y      L  P  +++ L VF+I M +LLMNLLIGLAVGDIE+V++NA LKR+++QV   +E E KLP     W  + +  E+  Y  P    C       I +K   N + E   +  + F+         L    ++L ++     QQ  L++LI+QKME+  EA ++ + I P
Sbjct:   49 MSSTPKIPIVDYLEAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQ-TQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFWPYQKTPEQIEAKRKEFNDPKWRPAPLAVVNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL-----SKIIDPQP-----------NHLS-----FSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ---LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP---HVWLQRVDKMELIEY--PNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKMEIKTEADDVDEGISP 1160          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331825)

HSP 1 Score: 531.946 bits (1369), Expect = 1.948e-168
Identity = 381/1143 (33.33%), Postives = 609/1143 (53.28%), Query Frame = 1
Query:  145 MSDNPNRP----FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEV-NRNQTTSCGNSAIHIACEIDNQEALDCLL-KAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN--VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVV-FNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ----------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFL------SALSFNTYAITF-----------TALSHVDKNISTSAE-CSNIDIFYGHETAKK--AVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMD--INHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFK-EIWEVFPYRCPTYKICS-SEAQVIYKK---NDYEESRDLGNL-FET--------LNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEA-EISDNIIP 3402
            MS  P  P     + A +GN  + ++L + ++  I+  D  G T  H AAA +R+ ++  +     D NA+D+ GNTP+H AV ++   AL YL+    D  +LN+   AP+HL    +K+  L+ + ++  V +  Q    G +A+H+A   D++E    L+ +  A    P   G YP+H A K  + K +E+  +   ++GC+  ++++F D EGNVPLH+AV+ GD KAV++CL  GAKI  +Q+D STP+H AC +G +DIVKLM   +   K + L   D    TPLH A MF+H ++  YL+ EG++I   D    +PLLLAASR   +    L++ GA I  +D   RN++H   +N   + D    +   +  Q     ++NEKD+MGC+PLHY++R G +R    LI+LG     +NN+ ++PLHFAARYGR +T R+LL++  G   +N +D  G  P+H +++ GHT+++Q+LL+RG + HR + G  PL  AA +G+ ET + L  ++  LLD  + +G TALH A + +K H + +L++ G  +  +   ++   + +  K    A  +V    R  EV+ +  +   C  + +I  MP +     DK I K    +  K F I Y+F  LQ          +T  S    +  P   + TMV   R++LL HPLS  YL+MKW  +G++     +L+Y IFL      S+L  N   +                  +  N+S +    S I +    E   +  A+L  A++ + Y ++N ++E   I+ + L Y     N ++ VL+I+++++ +   + D  IN      A++ +FL WF LLL L  F+++G++V+MF++IL T++ VL +FSIL I F  +F IL      S+I+  QP           N L      +  +P  L++   MM+GE++F+ TYV   Y      L  P  +++ L VF+I M +LLMNLLIGLAVGDIE+V++NA LKR+++QV   +E E KLP     W  + +  E+  Y  P    C       I +K   N + E   +  + F+         L    ++L ++     QQ  L++LI+QKME+  EA ++ + I P
Sbjct:   49 MSSTPKIPIVDYLEAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQ-TQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL-----SKIIDPQP-----------NHLS-----FSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ---LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP---HVWLQRVDKMELIEY--PNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKMEIKTEADDVDEGISP 1161          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Fly
Match: TrpA1 (gene:FBgn0035934 transcript:FBtr0331827)

HSP 1 Score: 529.25 bits (1362), Expect = 2.433e-167
Identity = 377/1132 (33.30%), Postives = 603/1132 (53.27%), Query Frame = 1
Query:  133 EVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEV-NRNQTTSCGNSAIHIACEIDNQEALDCLL-KAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN--VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVV-FNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFL------SALSFNTYAITF-----------TALSHVDKNISTSAE-CSNIDIFYGHETAKK--AVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMD--INHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFK-EIWEVFPYRCPTYKICS-SEAQVIYKK---NDYEESRDLGNL-FET--------LNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEA-EISDNIIP 3402
            EVCL+ D+P R  + A +GN  + ++L + ++  I+  D  G T  H AAA +R+ ++  +     D NA+D+ GNTP+H AV ++   AL YL+    D  +LN+   AP+HL    +K+  L+ + ++  V +  Q    G +A+H+A   D++E    L+ +  A    P   G YP+H A K  + K +E+  +   ++GC+  ++++F D EGNVPLH+AV+ GD KAV++CL  GAKI  +Q+D STP+H AC +G +DIVKLM   +   K + L   D    TPLH A MF+H ++  YL+ EG++I   D    +PLLLAASR   +    L++ GA I  +D   RN++H   +N   + D    +   +  Q     ++NEKD+MGC+PLHY++R G +R    LI+LG     +NN+ ++PLHFAARYGR +T R+LL++  G   +N +D  G  P+H +++ GHT+++Q+LL+RG + HR + G  PL  AA +G+ ET + L  ++  LLD  + +G TALH A + +K H + +L++ G  +  +   ++   + +  K    A  +V    R  EV+ +  +   C  + +I  MP +     DK I     +  KD K  Y                        TMV   R++LL HPLS  YL+MKW  +G++     +L+Y IFL      S+L  N   +                  +  N+S +    S I +    E   +  A+L  A++ + Y ++N ++E   I+ + L Y     N ++ VL+I+++++ +   + D  IN      A++ +FL WF LLL L  F+++G++V+MF++IL T++ VL +FSIL I F  +F IL      S+I+  QP           N L      +  +P  L++   MM+GE++F+ TYV   Y      L  P  +++ L VF+I M +LLMNLLIGLAVGDIE+V++NA LKR+++QV   +E E KLP     W  + +  E+  Y  P    C       I +K   N + E   +  + F+         L    ++L ++     QQ  L++LI+QKME+  EA ++ + I P
Sbjct:   84 EVCLLRDSPFRILRAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQ-TQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCK--KDSKSFY------------------------TMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL-----SKIIDPQP-----------NHLS-----FSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ---LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP---HVWLQRVDKMELIEY--PNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKMEIKTEADDVDEGISP 1159          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Zebrafish
Match: trpa1a (transient receptor potential cation channel, subfamily A, member 1a [Source:ZFIN;Acc:ZDB-GENE-050105-6])

HSP 1 Score: 500.36 bits (1287), Expect = 3.598e-157
Identity = 366/1136 (32.22%), Postives = 583/1136 (51.32%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMD--VLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQ-QSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSIK-TEGSRGQKDFKIIYNFGILQ------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNI-STSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEV----FPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQL----YNLMVDS---HQQTDLLKLILQKMEMDPEAEISDNI-----IPEMAGFSKNW----KTVIASKSIICKMQKS 3477
            F++   GN   +EK    NS  + + D  G + +HYA+AN    ++   V ++   + N RD  GNTP+H AV  ++  + + L+  GADPN+LN  + APIH+ V   K  VL++L+ H + + N     GN+ + ++  +DN EAL  L K GA  C  N  G +P+H A     +K +E+++    + G S    +N+ DK  + PLH AV  G+   +++C+ YGAKID +Q D ST LH+AC++G  ++VK+ML +  +V D++  I D    TPLHKAV+F+H EL+EYL+ +G+NI+  D  G +PLLLA S         LL +GA++  +DK+  N +HL  L     K    +  E +Q +S   ++N++D  GCTPLHY+ R G+      ++ L      ++ +K + LHFAA +GR++TC RLL      + +N  D  G  P+H A+  GH K++++LL +G +FH  Y G + LH+AA+ G+ +T   L+  N  LL+  + +G TALH AA       V LLL  GA I  +K   +F    +          V+ ++R EE +     N    C V+ MI+ +P      +D  I+ +E      ++ I YNF  LQ      +    ++D+   P   +  MV+ NR++LL HP+   YL+MKW  +G     L M +Y + +  L++    +  T ++   +N+ S +  C+++     + T    +LV+AM     ++  + KE   +F + L Y     NYM     I +++    ++    +    Q  A+     W NLLL L  FE+IG++V+MF +I  T+L ++ +F  L +GFA SF  L         +  Q  F + + +                   L++  VMM+GE+ + + ++ P   G+   L +P LT    + F++ + +LLMNLLIGLAVGDI  VQ NA LKRI++Q+   +  E +LP     W  K + +V    +P RC      S + +  +  N+ +    LG  F  L   E++L    Y L   S    +Q +LLKLI+QKME+  EA+  D       + E       W    + V A K  IC   K+
Sbjct:   47 FEWTKQGNAAALEK----NSRYLDTRDNIGASPLHYASANGHFRIIRHIVQIVGHQELNVRDEEGNTPLHWAVQKDQPGSCSVLLSLGADPNVLNNSHQAPIHMAVSLGKNFVLEQLVSHKQTDVNLEGDLGNTPVILSAALDNHEALGILYKHGAKFCRQNNLGHFPIHAAAFSGAKKSMEVILLKGEEAGLSIDAHINYVDKSCSSPLHLAVRGGNLDIIKLCIGYGAKIDQQQCDKSTALHFACSQGATEVVKIMLSSYPKVCDLI-NITDGANQTPLHKAVIFDHFELSEYLMSQGANIDFVDCKGHSPLLLATSCGAWRTVNLLLSHGADLTKKDKSGCNFLHLAILQPRGLKN---LPTEVLQHESVRELLNDEDIEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKEKKSALHFAAEFGRINTCHRLLEMVTDTRLLNEGDEKGLTPLHLASREGHVKVVELLLRKGALFHSDYRGWSGLHHAASEGYTQTMDTLLTSNIKLLNKTDGDGNTALHLAARAGHVAAVRLLLYRGAKIILNKNDASFLHEAVHNARREVTNMVIESDRCEEAMTTYKPNSTKRCIVMDMIEFLPESFKHLLDTCIRESEEDVNCTNYYIEYNFRWLQHPLQNLKKTGMEKDMAYKPLSALNAMVNFNRVNLLTHPVCKKYLEMKWSAYGIKAHLLNMTVYALGVFPLTYLIVNLKPTLVT--SRNVTSVNMVCTSL-YKQSYLTTSSMLLVLAM-----NMYAVGKEILQMFQQRLNYLRDLSNYMDWAAAICALLFVVPLLMNLKSSWHWQAGALAALTSWLNLLLYLQRFERIGIYVVMFREISRTLLSIIVLFFYLILGFALSFYAL---------MIEQQHFGRMFLS-------------------LLQTFVMMVGEMNYQDNFMKPYLQGD---LPFPDLTLAIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKRIAMQIELHTNLEERLPY----WFMKRVDQVTIREYPNRC-----FSGKKRWFFGGNEVKSRTRLGPTFHQLTPLERELTKQKYRLKEISETMEKQHNLLKLIVQKMEISSEADEHDGPPVFQELKEKLLTKSKWGPLLRAVTARKKGICSFGKT 1126          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 488.804 bits (1257), Expect = 5.486e-153
Identity = 345/1130 (30.53%), Postives = 577/1130 (51.06%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQRTVASKEDLNSD------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRM--DINHT-TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTY---KICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVK 3483
            F+ A  G    I++LI      +S  DENG +++HYA+A   ++++ +++     +  N +D  G TP+H AV  ++ ++   L+  GADPNILN   M P+HL V K    + + LL   + N N     GN+ + +AC  +N +AL  L+K GA +C  N  G YP+H       ++ +EM+++   + G S    +N+ DK  + PLH AV  G+ + +++C+  GAK++  Q+   T LH+AC++G L+ VK+ML + +  +D+V  I+D    TPLH+A +F+HVELAEYLI +G+ I+  D  G +PLLLA+S    +    LL  GA+   ++KT RN +H   L           GL+ + ++ +       +++++D  GCTPLHY+ + G+      ++ L      ++ +K + LHFAA YGR++TC RLL T    K +N  D  G  P+H A+  GH +++ +LL +G +F   Y G T LH+AA  G+ +T + L+  N  LLD +N +G TALH AA       V LLL  GA I  +    +F    ++ +        + + R +E +        C V+ +I+ +P      +D+ I +++     +D+ I+YNF  LQ  +  K+   +D      P   +  MV  NR++LL+HPLS  YL+MKW  +G  V +L + +Y++ L  L++    +         K   TS     +  F   +      ++M ++   YSI    KE   +  + + YFT F N       I++++   +++ M   +  T   +  A  I   W   LL    FE+IG++V+MF  I+ T++ ++ +F  L + F  +F  L         + ++P F+                    +   L +  VM +GE+ + +T++    +G+   + +P +TY+  + F++ M +LLMNL+IGLAVGDI  VQ+NA LKRI++Q+   +  E KLP     W  K + +    V+P +C       +   E Q   +      SR  G L   L+  + +L  +     +Q +LLKLI+QKME+  EA+  D   P+  G  K   +  + KS    + +++K
Sbjct:   30 FELAFKGKASAIDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIV-NIRDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLLLASSCSAWKTVAYLLSIGADFKIKEKTGRNFLHFVILQP--------KGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQSDYKGWTCLHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLI--LNLRPSQDFSKGNGTSVIMVPVS-FSEQQYLISVCIIMVIVMNVYSIC---KEVVQLAQQRVNYFTDFSNPADWSAAISALV---FVVPMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYAL---------MLHRPEFS-------------------SISLALAQTFVMTVGELNYQSTFLNSYEEGH---MAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPY----WFLKRVDKPSTVVYPNKCKKVLLEALVHGEIQNTVRTRLNLCSRKEGLLERELHKQKNRLKEMSCMLEKQHNLLKLIIQKMEITSEADEYDG--PQNHGALKQHTSSTSQKSKWVPLLQAIK 1104          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 488.804 bits (1257), Expect = 5.486e-153
Identity = 345/1130 (30.53%), Postives = 577/1130 (51.06%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQRTVASKEDLNSD------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRM--DINHT-TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTY---KICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVK 3483
            F+ A  G    I++LI      +S  DENG +++HYA+A   ++++ +++     +  N +D  G TP+H AV  ++ ++   L+  GADPNILN   M P+HL V K    + + LL   + N N     GN+ + +AC  +N +AL  L+K GA +C  N  G YP+H       ++ +EM+++   + G S    +N+ DK  + PLH AV  G+ + +++C+  GAK++  Q+   T LH+AC++G L+ VK+ML + +  +D+V  I+D    TPLH+A +F+HVELAEYLI +G+ I+  D  G +PLLLA+S    +    LL  GA+   ++KT RN +H   L           GL+ + ++ +       +++++D  GCTPLHY+ + G+      ++ L      ++ +K + LHFAA YGR++TC RLL T    K +N  D  G  P+H A+  GH +++ +LL +G +F   Y G T LH+AA  G+ +T + L+  N  LLD +N +G TALH AA       V LLL  GA I  +    +F    ++ +        + + R +E +        C V+ +I+ +P      +D+ I +++     +D+ I+YNF  LQ  +  K+   +D      P   +  MV  NR++LL+HPLS  YL+MKW  +G  V +L + +Y++ L  L++    +         K   TS     +  F   +      ++M ++   YSI    KE   +  + + YFT F N       I++++   +++ M   +  T   +  A  I   W   LL    FE+IG++V+MF  I+ T++ ++ +F  L + F  +F  L         + ++P F+                    +   L +  VM +GE+ + +T++    +G+   + +P +TY+  + F++ M +LLMNL+IGLAVGDI  VQ+NA LKRI++Q+   +  E KLP     W  K + +    V+P +C       +   E Q   +      SR  G L   L+  + +L  +     +Q +LLKLI+QKME+  EA+  D   P+  G  K   +  + KS    + +++K
Sbjct:   30 FELAFKGKASAIDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIV-NIRDGANRTPLHRATLFDHVELAEYLISKGAEIDSIDCKGLSPLLLASSCSAWKTVAYLLSIGADFKIKEKTGRNFLHFVILQP--------KGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQSDYKGWTCLHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLLGLLPLTYLI--LNLRPSQDFSKGNGTSVIMVPVS-FSEQQYLISVCIIMVIVMNVYSIC---KEVVQLAQQRVNYFTDFSNPADWSAAISALV---FVVPMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYAL---------MLHRPEFS-------------------SISLALAQTFVMTVGELNYQSTFLNSYEEGH---MAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPY----WFLKRVDKPSTVVYPNKCKKVLLEALVHGEIQNTVRTRLNLCSRKEGLLERELHKQKNRLKEMSCMLEKQHNLLKLIIQKMEITSEADEYDG--PQNHGALKQHTSSTSQKSKWVPLLQAIK 1104          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Zebrafish
Match: trpa1b (transient receptor potential cation channel, subfamily A, member 1b [Source:ZFIN;Acc:ZDB-GENE-050106-1])

HSP 1 Score: 479.559 bits (1233), Expect = 2.319e-149
Identity = 344/1143 (30.10%), Postives = 574/1143 (50.22%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEE-------------GSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQRTVASKEDLNSD------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRM--DINHT-TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTY---KICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVK 3483
            F+ A  G    I++LI      +S  DENG +++HYA+A   ++++ +++     +  N +D  G TP+H AV  ++ ++   L+  GADPNILN   M P+HL V K    + + LL   + N N     GN+ + +AC  +N +AL  L+K GA +C  N  G YP+H       ++ +EM+++   + G S    +N+ DK  + PLH AV  G+ + +++C+  GAK++  Q+   T LH+AC++G L+ VK+ML + +  +D+V  I+D    TPLH+A +F+HVELAEYLI +             G+ I+  D  G +PLLLA+S    +    LL  GA+   ++KT RN +H   L           GL+ + ++ +       +++++D  GCTPLHY+ + G+      ++ L      ++ +K + LHFAA YGR++TC RLL T    K +N  D  G  P+H A+  GH +++ +LL +G +F   Y G T LH+AA  G+ +T + L+  N  LLD +N +G TALH AA       V LLL  GA I  +    +F    ++ +        + + R +E +        C V+ +I+ +P      +D+ I +++     +D+ I+YNF  LQ  +  K+   +D      P   +  MV  NR++LL+HPLS  YL+MKW  +G  V +L + +Y++    L      +         K   TS     +  F   +      ++M ++   YSI    KE   +  + + YFT F N       I++++   +++ M   +  T   +  A  I   W   LL    FE+IG++V+MF  I+ T++ ++ +F  L + F  +F  L         + ++P F+                    +   L +  VM +GE+ + +T++    +G+   + +P +TY+  + F++ M +LLMNL+IGLAVGDI  VQ+NA LKRI++Q+   +  E KLP     W  K + +    V+P +C       +   E Q   +      SR  G L   L+  + +L  +     +Q +LLKLI+QKME+  EA+  D   P+  G  K   +  + KS    + +++K
Sbjct:   30 FELAFKGKASAIDRLIQKGPEHLSLRDENGASLLHYASAGGNLDIIRLIVSIVGPEVLNVQDEQGRTPLHWAVEQDQQQSCAVLLDLGADPNILNNALMGPLHLAVTKQYNHLAEVLLSCDKTNSNLEGDLGNTPVMLACSNNNCQALQILIKRGAKMCIQNKLGHYPIHTVAFAGAKEAMEMVLKIGEELGVSSTLHINYLDKSKSTPLHLAVRGGNIEVIKLCILKGAKVEQHQSGKCTALHFACSQGSLEAVKIMLSSYNRTEDIV-NIRDGANRTPLHRATLFDHVELAEYLISKPNTLSLDLICLGKGAEIDSIDCKGLSPLLLASSCSAWKTVAYLLSIGADFKIKEKTGRNFLHFVILQP--------KGLKNLPETVLQSTAVKEMLSDEDVEGCTPLHYACKLGIHDSVKNMLGLNICLGQKSREKKSALHFAAEYGRINTCHRLLETLTDSKMLNDWDEKGLTPLHLASRAGHAQVVDLLLRKGALFQSDYKGWTCLHHAAAEGYTQTMKILLAANVKLLDEKNEDGNTALHIAAQAGHVSAVLLLLDRGAEIALNDADNSFLHEAVRNERREVVNATIEHERCDESMTSFKAKSRCVVLDIIEFLPESFQHLLDQCITESDHDANSQDYHIMYNFQWLQAPIQLKKYAKTDKTKAFQPLAALNAMVRYNRLELLIHPLSRKYLEMKWTAYGSKVHFLNLAIYLL--GLLPLTYLILNLRPSQDFSKGNGTSVIMVPVS-FSEQQYLISVCIIMVIVMNVYSIC---KEVVQLAQQRVNYFTDFSNPADWSAAISALV---FVVPMCCSVEATWQWEAGAYAILTSWIGFLLYFQRFERIGIYVVMFNGIVRTLVCIMVLFVFLLLAFGLAFYAL---------MLHRPEFSS-------------------ISLALAQTFVMTVGELNYQSTFLNSYEEGH---MAFPAITYLVFVFFVLLMPILLMNLMIGLAVGDIAEVQRNAELKRIAMQIDLHTALEEKLPY----WFLKRVDKPSTVVYPNKCKKVLLEALVHGEIQNTVRTRLNLCSRKEGLLERELHKQKNRLKEMSCMLEKQHNLLKLIIQKMEITSEADEYDG--PQNHGALKQHTSSTSQKSKWVPLLQAIK 1117          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 180.259 bits (456), Expect = 3.635e-45
Identity = 153/553 (27.67%), Postives = 266/553 (48.10%), Query Frame = 1
Query:  136 VCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            V  M+ N   P   A+      + KL++     I +  ++G+T +H  A +   +V+++L+   A   ++  NG +P+H A   + +  +  L+ + A  + +  D +  +H+  +     V K ++   + N N     G + +HIAC+ +  + ++ LLK GA + +    G+ P+HVA    +E  ++ L       G SP    N ++  G   LH A   G    V+  L  GAK+D++  D+ T LH A   G+L+IV+ +L+     K  +      +G+TPLH +    H E+A  L+E+GS++      G+TPL +AA    +EV   LL+  A   A  K+    +H+ + +  N +V  L+ L++         N     G TPLH + ++  L +   L++ G  C T      +PLH AA+ G V     LL        +N  +  G  P+H AA++    + ++LL+ G  I  +   G TPLH A   G+++   +L+E N +  + +   G T LH AA    +H++ +LL +GAS
Sbjct:  262 VDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDK-KANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTH----HGASP----NTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ-----KGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHV-AAHYDNQRVALLL-LDQGASPHSPAKN-----GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTK---QANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLE-NQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGAS 789          

HSP 2 Score: 165.236 bits (417), Expect = 1.237e-40
Identity = 141/522 (27.01%), Postives = 241/522 (46.17%), Query Frame = 1
Query:  115 EMQLHDEVCLMSDNPN--RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            EM L     ++S   N   P   A  G+ +   +L++ ++  +     + +T +H AA     +V  V++  +A+ NA+  NG TP+H A   N +K +  L+ +GA    + +  + PIH+  +    +++K+L  H   + N T   G +A+H+A      + +  LL+ GA V          +H+A +    + ++ L++    KG  P    N +   G  PLH +   G  +   + L  G+ +        TPLH A   G+L++  L+L+     K         +G TPLH A  +++  +A  L+++G++      NG+TPL +AA +  +E+  TLL+YGA      +   + +HL +     D V+ L+     +Q+ +++ N+    G TPLH + +     +T +L+  G     Q     TPLH A  YG +     LL   +     N+    G  P+H AA+ GHT II MLL  G   +    +GNT L  A   G+I     L
Sbjct:  319 EMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHH-GASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQ----KGALP----NAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQ-----KKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLL----TKQANVNMGNKN---GLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLL---ENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL 816          

HSP 3 Score: 159.073 bits (401), Expect = 1.058e-38
Identity = 157/595 (26.39%), Postives = 259/595 (43.53%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNS-------------------------------AIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEML------VESKNKKGCSPMQI-------------------LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI---SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCY-HGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKN 1848
            ++NG+  +H A+    +EV+  L+   A+ +A    GNT +H A L  + + +  L+ NGA+ N  +++   P+++   ++ LDV++ LL   E N +Q+ +  +                                A+HIA   D+ ++   LL+        +  G  P+H+A  Y N     +L      V+   +   +P+ +                   +    K+G  PLH    +G  + V+M L  GA I  +  +  +PLH A     L+ V+L+L+    V DV      N+  T LH A    H ++A+ ++++ +N      NG+TPL +A  +  ++V + LLK+GA++ A  ++    IH          V   MG E I +      +  N  +  G T LH + R G + +   L++ G     +  D  T LH A+R G++   ++LL         N+  + G  P+H +A  GH +I  +LL++G         G TPLH AA  G +E    L++   +  D     G T LH AA  D   V  LLL  GAS     K G T   HI   KN
Sbjct:   72 NQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLL---ENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVT-----NDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIH----------VAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKG---ALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKK-AAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPL-HIAAKKN 643          

HSP 4 Score: 149.828 bits (377), Expect = 8.518e-36
Identity = 164/641 (25.59%), Postives = 259/641 (40.41%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLR------------HPEVNRNQTTSC----------------GNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDV------------------VLKI----------QDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLM------------------------GLEKIQQSFI--SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYLIEMNPS--------------------------LLDNQ------NHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFT 1827
            + G T +H A+   + EV+  L+   A+ NA+  NG TP++ A   N +  + +L+ N +  +I  +D   P+ + + +    V+  LL             H    ++ T S                 G + +HIA    N      LL  GA V       I P+HVA K  N   +++L++  +K        +    K+G  PLH    +G  + V+M L  GA I  +  +  +PLH A     L+ V+L+L+    V DV                  V K+          +  NG TPLH A   N V++ E L++ G++++   ++G TP+ +AA   +  + K L  +GA+    +      +H+ +     D V +L+                         LE +QQ     ++ N     G TPLH S R G   +  +L++ G           TPLH AA+YG++     LL       A ++    G  P+H AA   + ++  +LLD+G   H    +G TPLH AA    +E    L+E                              LL  Q      N  G T LH AA +DK+ V  +LL HGA I  D Q  + +T
Sbjct:  106 KKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSK--------IEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQK---KAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEI--DAQTKSGYT 733          

HSP 5 Score: 132.109 bits (331), Expect = 2.362e-30
Identity = 137/514 (26.65%), Postives = 227/514 (44.16%), Query Frame = 1
Query:  325 RADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKK------GCSPM---------QILNF---SDKEGNV---PLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS----LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            R  K   DSN +  +  A   N  K L YL   G D NI N++ +  +HL   +  ++V+ ELL+    N +  T  GN+A+HIA      E +  L+  GA V + +  G  P+++A +  +   +  L+E+ + +      G +P+         Q+++    +D +G V    LH A    DTK+  + L      DV      TPLH A   G +++  L+L      +   +     N  TPLH A    +  + + L++ GS IE    +G TPL   A   + +V + LL  GA I ++ K   + +H+ +    LN V   +     ++ +   +++ ++   + G    HY   + ++                     TPLH A +  RV     LL     ++A+  +   G  PIH AA  GH  I++ L   G   +     G T LH AA  G I+  +YL++ N + +D +  + +TALH A+   K  +V  LL  GA
Sbjct:   34 RDQKKKSDSNASY-LRAARAGNLEKVLDYL-KTGVDINICNQNGLNALHLASKEGHVEVVAELLKL-GANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLN-----RGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCG----HYKVAKVIVDKKANPNAKALNGF-------TPLHIACKKNRVKVMELLLKHGASLQAVTES---GLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQ-NGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGA 524          

HSP 6 Score: 92.8189 bits (229), Expect = 1.908e-18
Identity = 88/333 (26.43%), Postives = 151/333 (45.35%), Query Frame = 1
Query:  865 RQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLM-------------------GLEKIQQSFISIINEKDNMG---CTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI 1794
            +++D++     A   G L+ V   L+T      V + I + NG   LH A    HVE+   L++ G+N++     G T L +A+     EV + L+  GAN+ A+ +     +++ +     D V FL+                    L++     +S++ E D  G      LH + R+   +   +L++       ++    TPLH AA YG ++    LLN    +  M   D     P+H A++ G+  ++++LLDRG  I  +   G TPLH  A +GH +  + L++    +L ++   G + LH A   D  + V LLL H A +
Sbjct:   38 KKSDSNASYLRAARAGNLEKVLDYLKT-----GVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDI---TPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPIL-SKTKNGLSPLHMATQGDHLNCVQLLLQHNAPV 361          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 508.834 bits (1309), Expect = 5.200e-160
Identity = 374/1126 (33.21%), Postives = 595/1126 (52.84%), Query Frame = 1
Query:  136 VCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL---NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ-----RTVASKE-DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLY--------IIFLSALSFNTYAITFTALSHVDK----NISTSAECSNI----DIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI--NHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLN----THEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            VC + DNP   F+  A GN   +   ++ N G +++ D++  T +H+AA    I++M +++   A++  NA DS GNTP+H AV  N++  L  L+  GADPNI N   ++P+HL +      + + L+ H   + N     GN+ +  AC  DN EAL+ LL  GA +C  N  G YP+H+     + KC++++++   + G +    +NF++ E + PLH AV  G+   V+ C+ YGAKID+RQ+DN+T LH+A T+G  +IVK M+ +  +   +V  + D N  TPLHK+V+F+HVELAEYLI EG+NI+  D    TPLLLA S    +    LL  GA++  +D   RN +HL  L    + N    FL  +E I++    +++++D  GCTPLHY+ R G+      L+ L     +++ +K +PLHFAA YGR +TC+RLL      + +N  D  G  P+H AAENGH KI+ +LL RG +    + G T LHYAA +G+  T + L+E +  L+D  + E  TA+H A     +  V LLL +GASI  +  G ++    ++    +T    + + RWEE+++         C ++ MI  +P      +D+ + ++ G +   DF + YNF  LQ     R    +E +++ +P   +  MV   R+DLL HP+   YL MKW  +G     L + +Y        ++ ++A+   + AI      H+ +    N S   EC+N+    D+    +T    V  M ++  C S+  ++KE+  +  + LAY     N +   ++I+SII  S +    I  +    Q  A+ +F  W N L+ L  FE  G++++MF +IL T+L ++ +F  L + F  SF + F  P   ++  ++P F                         LM++  MM+G+I +   ++ PL D  +    YP  T+I L++F + + +LLMNLLIGLAVGDI  VQ+NA LKRI++QVS  +  E KLP     W  K + +    V+P R   + I  +     Y  +  +   ++    ET+       + +L +L     +Q DL+KLI+QKME+  EAE  D 
Sbjct:   29 VCSLDDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIV-DLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQ-MENIKK----LVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGLIPLTLLIINAVRPESLAI-IEECEHLKRTDFYNSSMKQECANVSRKLDLLQLKDTQYTRV-CMGLV-FCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYV-FLYP---QVTFSRPYF------------------------ALMQSFTMMLGDINYEEGFLKPLLDDQI---EYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPF----WFLKRVDKISITVYPNRPRIWGITFTSNFFHYFSSCDDVKAEIPINDETMELELWKQKNRLKDLTTMMQKQNDLIKLIIQKMEIVSEAEDEDG 1110          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 496.893 bits (1278), Expect = 6.161e-156
Identity = 370/1112 (33.27%), Postives = 579/1112 (52.07%), Query Frame = 1
Query:  136 VCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL---NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ-----RTVASKED-LNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI--NHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKI--CSSEAQVIYKKNDYEESRDLGNLFETLN----THEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            VC + DNP   F+  A GN   +   ++ N G +++ D++  T +H+AA    I++M +++   A++  NA DS GNTP+H AV  N++  L  L+  GADPNI N   ++P+HL +      +   L+ H   + N     GN+ +  AC  DN EAL+ LL  GA +C  N  G YP+H+     + KC++++++   + G +    +NF++ E + PLH AV  G+   V+ C+ YGAKID+RQ+DN+T LH+A T+G  +IVK M+ +  +   +V  + D N  TPLHK+V+F+HVELAEYLI EG+NI+  D    TPLLLA S    +    LL  GA++  +D   RN +HL  L    + N    FL  +E I++    +++++D  GCTPLHY+ R G+      L+ L     +++ +K +PLHFAA YGR +TC+RLL      + +N  D  G  P+H AAENGH KI+ +LL RG +    + G T LHYAA +G+  T + L+E +  L+D  + E  TA+H A     +  V LLL +GASI  +  G ++    ++    +T    + + RWEE+++         C ++ MI  +P      +D+ + ++ G +   DF + YNF  LQ     R    +E+ ++ +P   +  MV   R+DLL HP+   YL MKW  +G     L + +Y + L         I  T +   D              FY  +  +    V   +  C S+  ++KE+  +  + LAY     N +   ++I+SII  S +    I  +    Q  A+ +F  W N L+ L  FE  G++++MF +IL T+L ++ +F  L + F  SF +          L  Q  F++ Y A                   LM++  MM+G+I +   ++ PL D  +    YP  T+I L++F + + +LLMNLLIGLAVGDI  VQ+NA LKRI++QVS  +  E KLP     W  K + +    V+P R   + I   S     ++   + E   ++    ET+       + +L +L     +Q DL+KLI+QKME+  EAE  D 
Sbjct:   29 VCSLDDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSI--ALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIV-DLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQ-MENIKK----LVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGL---------IPLTLMISND--------------FYDTQYTR----VCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVF---------LYPQVTFSRPYFA-------------------LMQSFTMMLGDINYEEGFLKPLLDDQI---EYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPF----WFLKRVDKISITVYPNRPRIWGITFTSVSGICLFALQEGENISEIPINDETMELELWKQKNRLKDLTTMMQKQNDLIKLIIQKMEIVSEAEDEDG 1070          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 493.041 bits (1268), Expect = 2.461e-154
Identity = 365/1110 (32.88%), Postives = 580/1110 (52.25%), Query Frame = 1
Query:  136 VCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL---NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQ-----RTVASKE-DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVD-KNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI--NHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLN----THEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            VC + DNP   F+  A GN   +   ++ N G +++ D++  T +H+AA    I++M +++   A++  NA DS GNTP+H AV  N++  L  L+  GADPNI N   ++P+HL +      + + L+ H   + N     GN+ +  AC  DN EAL+ LL  GA +C  N  G YP+H+     + KC++++++   + G +    +NF++ E + PLH AV  G+   V+ C+ YGAKID+RQ+DN+T LH+A T+G  +IVK M+ +  +   +V  + D N  TPLHK+V+F+HVELAEYLI EG+NI+  D    TPLLLA S    +    LL  GA++  +D   RN +HL  L    + N    FL  +E I++    +++++D  GCTPLHY+ R G+      L+ L     +++ +K +PLHFAA YGR +TC+RLL      + +N  D  G  P+H AAENGH KI+ +LL RG +    + G T LHYAA +G+  T + L+E +  L+D  + E  TA+H A     +  V LLL +GASI  +  G ++    ++    +T    + + RWEE+++         C ++ MI  +P    + +    +             YNF  LQ     R    +E +++ +P   +  MV   R+DLL HP+   YL MKW  +G     L + +Y       S     +T   ++ V  ++++   EC ++     + ++ K    M ++  C S+  ++KE+  +  + LAY     N +   ++I+SII  S +    I  +    Q  A+ +F  W N L+ L  FE  G++++MF +IL T+L ++ +F  L + F  SF +          L  Q  F++ Y A                   LM++  MM+G+I +   ++ PL D  +    YP  T+I L++F + + +LLMNLLIGLAVGDI  VQ+NA LKRI++QVS  +  E KLP     W  K + +    V+P R   + I  +     Y  +  +   ++    ET+       + +L +L     +Q DL+KLI+QKME+  EAE  D 
Sbjct:   29 VCSLDDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSIAEALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIV-DLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQ-MENIKK----LVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKVGILNVSQ-------------YNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIY-------SLGLIPLTLLIINAVRPESLAIIEECEHLKRTDFYNSSMKQEFCMGLV-FCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVF---------LYPQVTFSRPYFA-------------------LMQSFTMMLGDINYEEGFLKPLLDDQI---EYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPF----WFLKRVDKISITVYPNRPRIWGITFTSNFFHYFSSCDDVKAEIPINDETMELELWKQKNRLKDLTTMMQKQNDLIKLIIQKMEIVSEAEDEDG 1076          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 477.248 bits (1227), Expect = 6.652e-149
Identity = 364/1100 (33.09%), Postives = 571/1100 (51.91%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL---NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ-----RTVASKE-DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI--NHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKIC-SSEAQVIYKKNDYEESRDLGNLFETLN----THEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
             +  A GN   +   ++ N G +++ D++  T +H+AA    I++M +++   A++  NA DS GNTP+H AV  N++  L  L+  GADPNI N   ++P+HL +      +   L+ H   + N     GN+ +  AC  DN EAL+ LL  GA +C  N  G YP+H+     + KC++++++   + G +    +NF++ E + PLH AV  G+   V+ C+ YGAKID+RQ+DN+T LH+A T+G  +IVK M+ +  +   +V  + D N  TPLHK+V+F+HVELAEYLI EG+NI+  D    TPLLLA S    +    LL  GA++  +D   RN +HL  L    + N    FL  +E I++    +++++D  GCTPLHY+ R G+      L+ L     +++ +K +PLHFAA YGR +TC+RLL      + +N  D  G  P+H AAENGH KI+ +LL RG +    + G T LHYAA +G+  T + L+E +  L+D  + E  TA+H A     +  V LLL +GASI  +  G ++    ++    +T    + + RWEE+++         C ++ MI  +P      +D+ + ++ G +   DF + YNF  LQ     R    +E +++ +P   +  MV   R+DLL HP+   YL MKW  +G     L + +Y + L         I  T +   D              FY             +I + + IV   KE+  +  + LAY     N +   ++I+SII  S +    I  +    Q  A+ +F  W N L+ L  FE  G++++MF +IL T+L ++ +F  L + F  SF +          L  Q  F++ Y A                   LM++  MM+G+I +   ++ PL D  +    YP  T+I L++F + + +LLMNLLIGLAVGDI  VQ+NA LKRI++QVS  +  E KLP     W  K + +    V+P R   + I  +S + +    +D +    + +  ET+       + +L +L     +Q DL+KLI+QKME+  EAE  D 
Sbjct:   18 LELIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSI--ALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIV-DLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQ-MENIKK----LVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKEQNTAMHLAGREGHAKAVSLLLENGASILLNANGASYIHEAIRFGKKDTVLVSIQSERWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIYSLGL---------IPLTLMISND--------------FY------------VLIQLLFGIV---KEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYVF---------LYPQVTFSRPYFA-------------------LMQSFTMMLGDINYEEGFLKPLLDDQI---EYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPF----WFLKRVDKISITVYPNRPRIWGITFTSVSGICLSCDDVKAEIPIND--ETMELELWKQKNRLKDLTTMMQKQNDLIKLIIQKMEIVSEAEDEDG 1034          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Xenopus
Match: trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:NCBI gene;Acc:100158526])

HSP 1 Score: 472.241 bits (1214), Expect = 9.638e-147
Identity = 366/1112 (32.91%), Postives = 574/1112 (51.62%), Query Frame = 1
Query:  136 VCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSL---NVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ-----RTVASKE-DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVD-KNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI--NHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKIC-SSEAQVIYKKNDYEESRDLGNLFETLN----THEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            VC + DNP   F+  A GN   +   ++ N G +++ D++  T +H+AA    I++M +++   A++  NA DS GNTP+H AV  N++  L  L+  GADPNI N   ++P+HL +      +   L+ H   + N     GN+ +  AC  DN EAL+ LL  GA +C  N  G YP+H+     + KC++++++   + G +    +NF++ E + PLH AV  G+   V+ C+ YGAKID+RQ+DN+T LH+A T+G  +IVK M+ +  +   +V  + D N  TPLHK+V+F+HVELAEYLI EG+NI+  D    TPLLLA S    +    LL  GA++  +D   RN +HL  L    + N    FL  +E I++    +++++D  GCTPLHY+ R G+      L+ L     +++ +K +PLHFAA YGR +TC+RLL      + +N  D  G  P+H AAENGH KI+ +LL RG +    + G T LHYAA +G+  T + L+E +  L+D  + E +    N    +  H+V         IFK+   L  F              +   + WEE+++         C ++ MI  +P      +D+ + ++ G +   DF + YNF  LQ     R    +E +++ +P   +  MV   R+DLL HP+   YL MKW  +G     L + +Y       S     +T   ++  D  N S   EC+N D  Y          V   +  C S+  ++KE+  +  + LAY     N +   ++I+SII  S +    I  +    Q  A+ +F  W N L+ L  FE  G++++MF +IL T+L ++ +F  L + F  SF + F  P   ++  ++P F                         LM++  MM+G+I +   ++ PL D  +    YP  T+I L++F + + +LLMNLLIGLAVGDI  VQ+NA LKRI++QVS  +  E KLP     W  K + +    V+P R   + I  +S + +    +D +    + +  ET+       + +L +L     +Q DL+KLI+QKME+  EAE  D 
Sbjct:   29 VCSLDDNPLLIFKLIAEGNVCRVRNFVLKNPGSLAARDDSEATPLHHAAKLGNIDLMLMIVNESAEEGINALDSRGNTPLHWAVQKNKLDCLKVLLCRGADPNIQNCYRLSPLHLAIQLFHNSI--ALILHSTTDINLEGDLGNTPVMQACCKDNHEALNLLLGRGAKLCKQNKLGCYPIHMTAFMGSLKCMDIILKKGEEMGYTIDHHINFTNNEKSSPLHLAVQNGNIDVVKACISYGAKIDLRQSDNATALHFAATQGATEIVKFMVSSYSDDNKIV-DLPDGNDETPLHKSVLFDHVELAEYLISEGANIDSEDKESRTPLLLATSCSAWKSVNLLLSKGADVKLKDHYGRNFLHLMVLQPGGLKNLNSEFLQ-MENIKK----LVSDEDCEGCTPLHYACRHGVPNSVNNLLGLNMSLYSKSKNKRSPLHFAACYGRFNTCQRLLRFMSDGRLLNDGDEKGMTPLHLAAENGHEKIVFLLLKRGALLLSDHRGWTALHYAALSGYTRTIKTLLETSIGLIDKTDKE-QVREKNCNYYNPKHMV---------IFKNLANLLTF-------------RLFHKSWWEEILQTFSHTSSYKCAILEMIYHLPESFKTLLDRCMTESIGDKKSPDFHVEYNFTYLQCPLSFRKAHKRENNVHYEPLTTLNAMVQHQRIDLLSHPVCKEYLLMKWMAYGFKAHLLNLAIY-------SLGLIPLTLLIINRTDFYNSSMKQECAN-DTQYTR--------VCMGLVFCMSLFGIVKEAVQLCQQKLAYIGDGSNIIDWSIYISSIIFVSSLCHSPIVVSGLQWQFGAIAVFASWVNFLIYLQRFESYGIYIVMFWEILRTLLRIVFLFFFLILAFGLSFYV-FLYP---QVTFSRPYF------------------------ALMQSFTMMLGDINYEEGFLKPLLDDQI---EYPFFTFIHLIMFTLLIPILLMNLLIGLAVGDIAEVQRNACLKRIAMQVSLHTSLEKKLPF----WFLKRVDKISITVYPNRPRIWGITFTSVSGICLSCDDVKAEIPIND--ETMELELWKQKNRLKDLTTMMQKQNDLIKLIIQKMEIVSEAEDEDG 1056          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 501.516 bits (1290), Expect = 1.885e-157
Identity = 354/1113 (31.81%), Postives = 575/1113 (51.66%), Query Frame = 1
Query:  151 DNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQ------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAI----TFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDIN---HTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVIL--FKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEK-QLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            D     F+    G+   +E  I     +    DEN +  +H+AAA  ++E+M++++   + +  N  D  GNTP+H A   N+++++ +L+  GA+PN+ N++ M+P+H+ V+    +V+K L  H   N N     GN+A+   C  DN EAL  LL+ GA +C  N +G YPVH A     +KC+E+++    K G S    +NF + +   PLH AV +GD   ++MCL  GA ID+ +N     LH+A T+G  DIVKLM+ +     D+V  + D N  T LH+A +F+H +LAEYLI  G++I  TD  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL  ++  F+       ++ ++DN GCTPLHY+ R+G+      L+       +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + EG TALH AA    +  V +LL++ A I  +K+  +F    L  K        + N RW+E +++   N     CP++ M++ +P  + + +D   I +   +  +D+ I YNF  LQ      + VA  +D+  +P  ++  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I     F +   ++   ST  E   ID    +    K  +++  ++   SI    KE   IF +   YF  + N +  V++ TSII   +++ + +N   +   Q  A+ IF  W N LL L  FE  G+F++M   I  T+L    +F  L + F  SF +L  F+   S+ +LS                              L++   MM+G+I + + ++ PL+      L YP LT+  L+ F +F+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP+    W  +++ +    V+P R    ++       +  +   +E  ++    E     +K +L +L     +Q +L+KLI+QKME+  E E  DN
Sbjct:   30 DCSKESFKVDIEGDMCRLEDFIKNRRKLSKYEDEN-LCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAV-DGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHL--------TVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINGTSSTHEE--RIDTL--NSFPIKICMILVFLS---SIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSII---FVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLS------------------------------LIQTFSMMLGDINYRDAFLEPLFRNE---LAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPL----WYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLNMQETRQEVPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDN 1085          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Mouse
Match: Trpa1 (transient receptor potential cation channel, subfamily A, member 1 [Source:MGI Symbol;Acc:MGI:3522699])

HSP 1 Score: 485.723 bits (1249), Expect = 6.877e-152
Identity = 347/1111 (31.23%), Postives = 560/1111 (50.41%), Query Frame = 1
Query:  151 DNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQ------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLA--YFTSFQNYMTLVLHITSIILSSYIIRMDIN---HTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVIL--FKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEK-QLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            D     F+    G+   +E  I     +    DEN +  +H+AAA  ++E+M++++   + +  N  D  GNTP+H A   N+++++ +L+  GA+PN+ N++ M+P+H+ V+    +V+K L  H   N N     GN+A+   C  DN EAL  LL+ GA +C  N +G YPVH A     +KC+E+++    K G S    +NF + +   PLH AV +GD   ++MCL  GA ID+ +N     LH+A T+G  DIVKLM+ +     D+V  + D N  T LH+A +F+H +LAEYLI  G++I  TD  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL  ++  F+       ++ ++DN GCTPLHY+ R+G+      L+       +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + EG TALH AA    +  V +LL++ A I  +K+  +F    L  K        + N RW+E +++   N     CP++ M++ +P  + + +D   I +   +  +D+ I YNF  LQ      + VA  +D+  +P  ++  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I                                      M      I+N    +H     TL   YF  + N +  V++ TSII   +++ + +N   +   Q  A+ IF  W N LL L  FE  G+F++M   I  T+L    +F  L + F  SF +L  F+   S+ +LS                              L++   MM+G+I + + ++ PL+      L YP LT+  L+ F +F+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP+    W  +++ +    V+P R    ++       +  +   +E  ++    E     +K +L +L     +Q +L+KLI+QKME+  E E  DN
Sbjct:   30 DCSKESFKVDIEGDMCRLEDFIKNRRKLSKYEDEN-LCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAV-DGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHL--------TVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQ-----------------------------------PGMAFNSTGIINGTSSTHEERIDTLKRNYFLDYNNALEWVIYTTSII---FVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLS------------------------------LIQTFSMMLGDINYRDAFLEPLFRNE---LAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPL----WYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLNMQETRQEVPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDN 1055          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 178.718 bits (452), Expect = 1.695e-44
Identity = 154/532 (28.95%), Postives = 236/532 (44.36%), Query Frame = 1
Query:  115 EMQLHDEVCLMSDNPN--RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH---PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKD-------TPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYL 1671
            E+ L  +  L++   N   P   AA G+ +E  K ++     +     + +T +H AA      V  +L+  RA+ NAR  NG TP+H A   N IK +  L+  GA    + +  + PIH+  +   L+++  LL++   P+V    T   G +A+H+A      E + CLL+ GALV +       P+H+A +    + +++L++         M   + +   G  PLH +   G      + L  GA   +      TPLH A   G LD+ KL+L+ R             NG TPLH A  +++ ++A  L+E+G++   T  NG+TPL +AA +  M++  TLL YGA      K     +HL S     D V  L  L+K        I+     G T LH + +   + +  IL            D+D       TPL  A  YG V     LL        +N+    G  P+H AA+ GHT II +LL  G   +    +GNT L  A   G+I     L
Sbjct:  316 ELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV----TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH--------MAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSA-----GKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLL--LDKGAN-----IHMSTKSGLTSLHLAAQEDKVNVADILT-------KHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQ---GANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 2 Score: 165.622 bits (418), Expect = 1.545e-40
Identity = 142/514 (27.63%), Postives = 244/514 (47.47%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH--GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            +G+T +H AA +   +V+++L+  +A   AR  NG +P+H A   + ++ + +L+   A  + +  D +  +H+  +     V K LL     N N     G + +HIAC+ +  + ++ L+K GA + +    G+ P+HVA    +   + +L+++    G SP    + ++  G   LH A   G  + V+  L  GA +D R  +  TPLH A   G+ +IV+L+L+               NG+TPLH +     V++A  L+E G+   +    G+TPL +AA   +++V K LL+  A   +  K     +H+ + +  N KV  L+ LEK      +  N     G TPLH + ++  +++   L+  G    T      TPLH A++ G       LL+   G     ST S G   +H AA+     +  +L   G      Y   G TPL  A   G+++   +L++   ++ + +   G T LH AA    +H++ +LL HGA
Sbjct:  298 DGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTK-LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQN----GASP----DVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-----TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHV-AAHYDNQKVALLL-LEKGASPHATAKN-----GYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDK--GANIHMSTKS-GLTSLHLAAQEDKVNVADILTKHGAD-RDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANV-NAKTKNGYTPLHQAAQQGHTHIINVLLQHGA 785          

HSP 3 Score: 160.229 bits (404), Expect = 7.679e-39
Identity = 164/622 (26.37%), Postives = 281/622 (45.18%), Query Frame = 1
Query:  160 NRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH-------PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS----LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV-IGMIKDMPNILSLAMDK 1983
            N     A+     E+ K+++     I++  +NG T ++ AA  + I+V+  L+   A+++    +G TP+  A+     +A+  L+ N    +   K  +  +H+   K        LL++        ++  N+TT  G + +HIA    N      LL  GA V      GI P+HVA K  N   +++L++   +        ++   ++G  PLH A  +G  + V++ L   A +  R  +  +PLH A     ++ VK +L+ +  V DV L        T LH A    H  + + L+++ +N      NG+TPL +A  +  ++V + L+KYGA+I A  ++    IH+ +    LN+V      L+ L+      ++ I      G T LH + R G + +   L++ G L   +  ++ TPLH A+R G+    + LL     M   ++  + G  P+H +A  G   +  +LL+ G         G TPLH AA  G ++  + L++   +  D+    G T LH AA  D   V  LLL  GAS     K G T   HI   KN       + N   E     V + G+ P+ +   +   ++++L +DK
Sbjct:   98 NTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ--------IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYL-----TALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIV------LLLLQNGASPDVTNIR-----GETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQH---MAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAA-ADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPL-HIAAKKNQMQIASTLLNYGAE--TNTVTKQGVTPLHLASQEGHTDMVTLLLDK 684          

HSP 4 Score: 134.806 bits (338), Expect = 4.386e-31
Identity = 136/517 (26.31%), Postives = 229/517 (44.29%), Query Frame = 1
Query:  334 KNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELL-RHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDN----NGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS-------LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            K  + S+ N     A     +  +   +  G D N  N++ +  +HL   +  + +++ELL R   V  +  T  GN+A+HIA      E +  L+K GA + + +  G  P+++A +  +   ++ L+E+   +          + ++G  PL  A+  G  +AV + L    K  VR       LH A  K +     L+L+  H   DV  K+  N    +G TPLH A  + +V +A  L+  G+ ++ T  NG TPL +A+ R N  + K LL  G  I A+ +     +H  +       + ++ ++   L+   K   S + +  + D++ C                   T LH +   G  R+T +L+        +  +  TPLH A +  R+     L+     ++A+  +   G  PIH AA  GH  I+ +LL  G         G T LH AA  G +E  + L+  N +L+D +  E +T LH A+   K+ +V LLL H A
Sbjct:   24 KRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSV--DSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST--------ATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNA-DVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITES---GLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLR-NGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMA 521          

HSP 5 Score: 62.7734 bits (151), Expect = 3.550e-9
Identity = 81/318 (25.47%), Postives = 132/318 (41.51%), Query Frame = 1
Query:  973 KIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTP-----------------------------LHFAARYGRVHTCRRLLNT-----FDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG-CIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF-KDKQGLT 1818
            K  D+N  + L  A   N  ++ EYL + G +I   + NG   L LAA   ++ + + LL  G+++ +  K     +H+ SL    + V  L     +++   + IN +   G TPL+ + +   + +   L++ G    T   D  TP                             LH AAR     +   LL             +N T   G  P+H AA  G+  +  +LL+RG  +     +G TPLH A+  G+    + L++     +D +  +G T LH AA +    VV LLL   A +  + K GL+
Sbjct:   27 KKSDSNA-SFLRAARAGNLDKVVEYL-KGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVL-----VKEG--ANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQ-IDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLS 334          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 171.014 bits (432), Expect = 2.554e-42
Identity = 158/543 (29.10%), Postives = 252/543 (46.41%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVY---GIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAK 1863
            + G T +H AA   + EV+  L+ Y A+ NA+   G TP++ A   N ++ + +L+ NGA+ N+  +D   P+ + + +   +V+  L     +N          A+HIA   D+      LL+      +P+V    G  P+H+A  Y N    ++L+     +G S    +NF+ + G  PLH A   G+   V++ L  GA+I+ R  D  TPLH A   G + I +++L          ++ +  NG +P+H A   +H++    L++  + I+    +  TPL +AA   +  V K LL  GA   +R       +H+        K N +  +E + ++  S I+     G TPLH ++  G L +   L++ G      N   +TPLH AAR G     + LL       A    D   + P+H AA  GHT ++++LL+ G   +     G+TPLH AA  GH++T   L+E   S       +G T LH AA   K  +  LLL H A      K GLT     +   NL+  K
Sbjct:   72 KKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHL-----INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDP---NPDVLSKTGFTPLHIAAHYENLNVAQLLL----NRGAS----VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLD-----HGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIAC------KKNHIRVMELLLKTGAS-IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDD---QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQA-CMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVK 582          

HSP 2 Score: 144.05 bits (362), Expect = 4.555e-34
Identity = 152/613 (24.80%), Postives = 270/613 (44.05%), Query Frame = 1
Query:   79 KVPNVHMIELDEEMQLHDEVCLMSDNPN---------RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLR-----------------------HPEVNR---------NQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            ++P +H+   +++ +      L+ ++PN          P   AA    + + +L++     ++ + +NG+T +H A+    + ++ +L+   A    R  +  TP+H A  N  ++    L+ +GA      K+ ++PIH+      LD ++ LL+                       H  V +         N     G + +HIAC+ ++   ++ LLK GA + +    G+ P+HVA    +   ++ L++    +G SP    N S+ +   PLH A   G T+  +  L   AK + +  D+ TPLH A   G   +VKL+L            +    GHTPLH A    HV+ A  L+E+ ++       G+TPL +AA    + + + LL++ A+  A  K     +H+   +   D V  L  L +         N     G TPLH + ++  + +   L++ GG    ++    TPLH AA+ G       LL+        N  +  G  P+H  ++ GH  +  +L+  G         G TPLH A+  G+I+  ++L++     ++ +   G + LH AA    + +V LLL +GAS
Sbjct:  169 RLPALHIAARNDDTRT--AAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ----RGASP----NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLEN-----GASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL--LPRGGSPHSPAWN-----GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSK---QANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 755          

HSP 3 Score: 133.265 bits (334), Expect = 9.091e-31
Identity = 135/492 (27.44%), Postives = 225/492 (45.73%), Query Frame = 1
Query:  397 KALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN-------VVNDKVNFLMGLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            KAL +L  NG D N  N++ +  +HL   +  + ++ ELL H E+    TT  GN+A+HIA      E +  L+  GA V + +  G  P+++A +  + + ++ L+E+   +        N + ++G  PL  A+  G    V   ++YG K  VR       LH A    +     ++L+      D    +    G TPLH A  + ++ +A+ L+  G+++  T  NG TPL +A+ R N+ + + LL  GA I  R K +   +H  + N       ++ D    +    K   S I +  + D++ C                   TPLH +   G  R+  +L+  G    ++  +  TPLH A +   +     LL T   + A+  +   G  P+H A+  GH  I++ LL RG   +       TPLH AA  GH E  +YL++   +  + +  + +T LH AA    + +V LLL +GAS
Sbjct:   23 KALDHL-RNGVDINTCNQNGLNGLHLASKEGHVKMVVELL-HKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQ--------NVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQN-----DPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTES---GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK-AKANAKAKDDQTPLHCAARIGHTGMVKLLLENGAS 491          

HSP 4 Score: 114.005 bits (284), Expect = 8.091e-25
Identity = 90/362 (24.86%), Postives = 165/362 (45.58%), Query Frame = 1
Query:  256 GMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSC-GNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLN----MEVFKTLLKYGANIYARDKTQRNLIHLFS--LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTP 1320
            G T +H AA    ++    L+   A +      G TP+H A    +++    L+ + A PN   K+ + P+H+ V+ + LD++K LL  P      + +  G + +HIA + +  E    LL+ G    + +V G+ P+H+A +  + + + +L+ SK   G       N  +K G  PLH     G      + + +G  +D       TPLH A   G + +VK +L+ + +V       +   G++PLH+A    H ++   L++ G++      NG TPL + A RL      +V K +    + +   DK + +        L+V  D+ + L+G +  ++    +  EK+ +   P
Sbjct:  499 GHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLL--PRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLL-SKQANG-------NLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADV-----NAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAI-AKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETVDEILDVSEDEGDELVGSKAERRDSRDVGEEKELLDFVP 844          

HSP 5 Score: 93.2041 bits (230), Expect = 1.586e-18
Identity = 107/390 (27.44%), Postives = 173/390 (44.36%), Query Frame = 1
Query:  838 LHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGA--NIYARDKTQRNLIHLFS--LNVVNDKVNF-LMGLEKIQQSFISIINEK-----------------DNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFT--HILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV 1932
            L  G  I+    +    LH A  +G + +V  +L      K+++L+     G+T LH A +    E+   L+  G+N+      G+TPL +AA   ++EV K LL+ GA  N+   D      + L     NVV   +N+   G  ++    I+  N+                     G TPLH +     L +  +L+  G        +  TPLH A+R G V   R LL+    ++   + D     P+H AA NGH +I ++LLD G  I  +  +G +P+H AA   H++  + L++ N + +D+   +  T LH AA      V  +LL  GA    + + L  FT  HI   KN     E++   +    +  V E+G+ P+
Sbjct:   28 LRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLH-----KEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-RTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYN-AEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAK--PNSRALNGFTPLHIACKKNHIRVMELLL--KTGASIDAVTESGLTPL 404          

HSP 6 Score: 77.411 bits (189), Expect = 1.304e-13
Identity = 62/216 (28.70%), Postives = 98/216 (45.37%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTG 813
            P   A   N ++I KL++   G   S   NG T +H AA  ++IEV   L+ Y    NA    G TP+H A      + +  L+   A+ N+ NK  + P+HL   +  + V   L++H  V  + TT  G + +H+A    N + +  LL+  A V +    G  P+H A +  +   + +L+    K G SP ++       G  PL  A   G
Sbjct:  568 PLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKH-GVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLL----KNGASPNEV----SSNGTTPLAIAKRLG 774          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 171.014 bits (432), Expect = 2.838e-42
Identity = 158/543 (29.10%), Postives = 252/543 (46.41%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVY---GIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAK 1863
            + G T +H AA   + EV+  L+ Y A+ NA+   G TP++ A   N ++ + +L+ NGA+ N+  +D   P+ + + +   +V+  L     +N          A+HIA   D+      LL+      +P+V    G  P+H+A  Y N    ++L+     +G S    +NF+ + G  PLH A   G+   V++ L  GA+I+ R  D  TPLH A   G + I +++L          ++ +  NG +P+H A   +H++    L++  + I+    +  TPL +AA   +  V K LL  GA   +R       +H+        K N +  +E + ++  S I+     G TPLH ++  G L +   L++ G      N   +TPLH AAR G     + LL       A    D   + P+H AA  GHT ++++LL+ G   +     G+TPLH AA  GH++T   L+E   S       +G T LH AA   K  +  LLL H A      K GLT     +   NL+  K
Sbjct:   80 KKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHL-----INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDP---NPDVLSKTGFTPLHIAAHYENLNVAQLLL----NRGAS----VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLD-----HGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIAC------KKNHIRVMELLLKTGAS-IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDD---QTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQA-CMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVK 590          

HSP 2 Score: 149.828 bits (377), Expect = 8.017e-36
Identity = 139/507 (27.42%), Postives = 229/507 (45.17%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGN----SAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            P   AA G+ ++  +L++  +  I     + +T +H AA      V  VL+   A  N+R  NG TP+H A   N I+ +  L+  GA  + + +  + P+H+  +   L ++K LL+     R  + +  N    + +H+A    + E    LL+  A   +       P+H A +  +   +++L+E+    G SP    N +   G+ PLHTA   G        L   A          TPLH A   G++ + +L+L       D        NG TPLH AV  N++++ + L+  G +      NG+TPL +AA +  +EV ++LL+YG +  A        +HL +     + V  L+     +Q+  ++ N+    G TPLH  ++ G + +  +LIK G           TPLH A+ YG +   + LL        +N+    G  P+H AA+ GHT I+ +LL  G   +    +G TPL  A   G+I     L
Sbjct:  312 PIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ-----RGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLEN----GASP----NLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLE-----HDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLS----KQANGNLGNKS---GLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQH---QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 790          

HSP 3 Score: 144.436 bits (363), Expect = 4.356e-34
Identity = 152/613 (24.80%), Postives = 270/613 (44.05%), Query Frame = 1
Query:   79 KVPNVHMIELDEEMQLHDEVCLMSDNPN---------RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLR-----------------------HPEVNR---------NQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            ++P +H+   +++ +      L+ ++PN          P   AA    + + +L++     ++ + +NG+T +H A+    + ++ +L+   A    R  +  TP+H A  N  ++    L+ +GA      K+ ++PIH+      LD ++ LL+                       H  V +         N     G + +HIAC+ ++   ++ LLK GA + +    G+ P+HVA    +   ++ L++    +G SP    N S+ +   PLH A   G T+  +  L   AK + +  D+ TPLH A   G   +VKL+L            +    GHTPLH A    HV+ A  L+E+ ++       G+TPL +AA    + + + LL++ A+  A  K     +H+   +   D V  L  L +         N     G TPLH + ++  + +   L++ GG    ++    TPLH AA+ G       LL+        N  +  G  P+H  ++ GH  +  +L+  G         G TPLH A+  G+I+  ++L++     ++ +   G + LH AA    + +V LLL +GAS
Sbjct:  177 RLPALHIAARNDDTRT--AAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQ----RGASP----NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLE-----NGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLL--LPRGGSPHSPAWN-----GYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSK---QANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQAD-VNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 763          

HSP 4 Score: 133.265 bits (334), Expect = 9.005e-31
Identity = 135/492 (27.44%), Postives = 225/492 (45.73%), Query Frame = 1
Query:  397 KALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN-------VVNDKVNFLMGLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            KAL +L  NG D N  N++ +  +HL   +  + ++ ELL H E+    TT  GN+A+HIA      E +  L+  GA V + +  G  P+++A +  + + ++ L+E+   +        N + ++G  PL  A+  G    V   ++YG K  VR       LH A    +     ++L+      D    +    G TPLH A  + ++ +A+ L+  G+++  T  NG TPL +A+ R N+ + + LL  GA I  R K +   +H  + N       ++ D    +    K   S I +  + D++ C                   TPLH +   G  R+  +L+  G    ++  +  TPLH A +   +     LL T   + A+  +   G  P+H A+  GH  I++ LL RG   +       TPLH AA  GH E  +YL++   +  + +  + +T LH AA    + +V LLL +GAS
Sbjct:   31 KALDHL-RNGVDINTCNQNGLNGLHLASKEGHVKMVVELL-HKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQ--------NVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQ-----NDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTES---GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNK-AKANAKAKDDQTPLHCAARIGHTGMVKLLLENGAS 499          

HSP 5 Score: 93.2041 bits (230), Expect = 1.659e-18
Identity = 104/373 (27.88%), Postives = 168/373 (45.04%), Query Frame = 1
Query:  889 LHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGA--NIYARDKTQRNLIHLFS--LNVVNDKVNF-LMGLEKIQQSFISIINEK-----------------DNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFT--HILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV 1932
            LH A  +G + +V  +L      K+++L+     G+T LH A +    E+   L+  G+N+      G+TPL +AA   ++EV K LL+ GA  N+   D      + L     NVV   +N+   G  ++    I+  N+                     G TPLH +     L +  +L+  G        +  TPLH A+R G V   R LL+    ++   + D     P+H AA NGH +I ++LLD G  I  +  +G +P+H AA   H++  + L++ N + +D+   +  T LH AA      V  +LL  GA    + + L  FT  HI   KN     E++   +    +  V E+G+ P+
Sbjct:   53 LHLASKEGHVKMVVELLH-----KEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIET-RTKDEL--TPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYN-AEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAK--PNSRALNGFTPLHIACKKNHIRVMELLL--KTGASIDAVTESGLTPL 412          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. UniProt/SwissProt
Match: sp|Q7Z020|TRPA1_DROME (Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster OX=7227 GN=TrpA1 PE=2 SV=4)

HSP 1 Score: 531.946 bits (1369), Expect = 1.953e-167
Identity = 381/1143 (33.33%), Postives = 609/1143 (53.28%), Query Frame = 1
Query:  145 MSDNPNRP----FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEV-NRNQTTSCGNSAIHIACEIDNQEALDCLL-KAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN--VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVV-FNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQ----------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFL------SALSFNTYAITF-----------TALSHVDKNISTSAE-CSNIDIFYGHETAKK--AVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMD--INHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFK-EIWEVFPYRCPTYKICS-SEAQVIYKK---NDYEESRDLGNL-FET--------LNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEA-EISDNIIP 3402
            MS  P  P     + A +GN  + ++L + ++  I+  D  G T  H AAA +R+ ++  +     D NA+D+ GNTP+H AV ++   AL YL+    D  +LN+   AP+HL    +K+  L+ + ++  V +  Q    G +A+H+A   D++E    L+ +  A    P   G YP+H A K  + K +E+  +   ++GC+  ++++F D EGNVPLH+AV+ GD KAV++CL  GAKI  +Q+D STP+H AC +G +DIVKLM   +   K + L   D    TPLH A MF+H ++  YL+ EG++I   D    +PLLLAASR   +    L++ GA I  +D   RN++H   +N   + D    +   +  Q     ++NEKD+MGC+PLHY++R G +R    LI+LG     +NN+ ++PLHFAARYGR +T R+LL++  G   +N +D  G  P+H +++ GHT+++Q+LL+RG + HR + G  PL  AA +G+ ET + L  ++  LLD  + +G TALH A + +K H + +L++ G  +  +   ++   + +  K    A  +V    R  EV+ +  +   C  + +I  MP +     DK I K    +  K F I Y+F  LQ          +T  S    +  P   + TMV   R++LL HPLS  YL+MKW  +G++     +L+Y IFL      S+L  N   +                  +  N+S +    S I +    E   +  A+L  A++ + Y ++N ++E   I+ + L Y     N ++ VL+I+++++ +   + D  IN      A++ +FL WF LLL L  F+++G++V+MF++IL T++ VL +FSIL I F  +F IL      S+I+  QP           N L      +  +P  L++   MM+GE++F+ TYV   Y      L  P  +++ L VF+I M +LLMNLLIGLAVGDIE+V++NA LKR+++QV   +E E KLP     W  + +  E+  Y  P    C       I +K   N + E   +  + F+         L    ++L ++     QQ  L++LI+QKME+  EA ++ + I P
Sbjct:   49 MSSTPKIPIVDYLEAAESGNLDDFKRLFMADNSRIALKDAKGRTAAHQAAARNRVNILRYIRDQNGDFNAKDNAGNTPLHIAVESDAYDALDYLLSIPVDTGVLNEKKQAPVHLATELNKVKSLRVMGQYRNVIDIQQGGEHGRTALHLAAIYDHEECARILITEFDACPRKPCNNGYYPIHEAAKNASSKTMEVFFQWGEQRGCTREEMISFYDSEGNVPLHSAVHGGDIKAVELCLKSGAKISTQQHDLSTPVHLACAQGAIDIVKLMFEMQPMEKRLCLSCTDVQKMTPLHCASMFDHPDIVSYLVAEGADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGGRLTDFAEQVANCQ-TQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLKNNNNESPLHFAARYGRYNTVRQLLDSEKGSFIINESDGAGMTPLHISSQQGHTRVVQLLLNRGALLHRDHTGRNPLQLAAMSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMSAIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITKANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTHGRVELLAHPLSQKYLQMKWNSYGKYFHLANLLIYSIFLVFVTIYSSLMMNNIELKAGDNKTMSQYCNMGWEQLTMNLSQNPSVASQIRLDSCEERINRTTAILFCAVVIVVYILLNSMRELIQIYQQKLHYILETVNLISWVLYISALVMVTPAFQPDGGINTIHYSAASIAVFLSWFRLLLFLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL-----SKIIDPQP-----------NHLS-----FSNIPMSLLRTFSMMLGELDFVGTYVNTYYRDQ---LKVPMTSFLILSVFMILMPILLMNLLIGLAVGDIESVRRNAQLKRLAMQVVLHTELERKLP---HVWLQRVDKMELIEY--PNETKCKLGFCDFILRKWFSNPFTEDSSMDVISFDNNDDYINAELERQRRKLRDISRMLEQQHHLVRLIVQKMEIKTEADDVDEGISP 1161          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. UniProt/SwissProt
Match: sp|Q8BLA8|TRPA1_MOUSE (Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Trpa1 PE=1 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 1.319e-156
Identity = 354/1113 (31.81%), Postives = 575/1113 (51.66%), Query Frame = 1
Query:  151 DNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQ------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAI----TFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDIN---HTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVIL--FKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEK-QLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            D     F+    G+   +E  I     +    DEN +  +H+AAA  ++E+M++++   + +  N  D  GNTP+H A   N+++++ +L+  GA+PN+ N++ M+P+H+ V+    +V+K L  H   N N     GN+A+   C  DN EAL  LL+ GA +C  N +G YPVH A     +KC+E+++    K G S    +NF + +   PLH AV +GD   ++MCL  GA ID+ +N     LH+A T+G  DIVKLM+ +     D+V  + D N  T LH+A +F+H +LAEYLI  G++I  TD  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL  ++  F+       ++ ++DN GCTPLHY+ R+G+      L+       +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + EG TALH AA    +  V +LL++ A I  +K+  +F    L  K        + N RW+E +++   N     CP++ M++ +P  + + +D   I +   +  +D+ I YNF  LQ      + VA  +D+  +P  ++  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I     F +   ++   ST  E   ID    +    K  +++  ++   SI    KE   IF +   YF  + N +  V++ TSII   +++ + +N   +   Q  A+ IF  W N LL L  FE  G+F++M   I  T+L    +F  L + F  SF +L  F+   S+ +LS                              L++   MM+G+I + + ++ PL+      L YP LT+  L+ F +F+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP+    W  +++ +    V+P R    ++       +  +   +E  ++    E     +K +L +L     +Q +L+KLI+QKME+  E E  DN
Sbjct:   30 DCSKESFKVDIEGDMCRLEDFIKNRRKLSKYEDEN-LCPLHHAAAEGQVELMELIINGSSCEVLNIMDGYGNTPLHCAAEKNQVESVKFLLSQGANPNLRNRNMMSPLHIAVHGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKKCMELILAYGEKNGYSRETHINFVNHKKASPLHLAVQSGDLDMIKMCLDNGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAV-DGNQETLLHRASLFDHHDLAEYLISVGADINSTDSEGRSPLILATASASWNIVNLLLCKGAKVDIKDHLGRNFLHL--------TVQQPYGLRNLRPEFMQMQHIKELVMDEDNDGCTPLHYACRQGVPVSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRNKRWDECLQVFTHNSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVAPTQDVVYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINGTSSTHEE--RIDTL--NSFPIKICMILVFLS---SIFGYCKEVIQIFQQKRNYFLDYNNALEWVIYTTSII---FVLPLFLNIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLS------------------------------LIQTFSMMLGDINYRDAFLEPLFRNE---LAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPL----WYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLNMQETRQEVPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDN 1085          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. UniProt/SwissProt
Match: sp|Q6RI86|TRPA1_RAT (Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Trpa1 PE=2 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 3.551e-156
Identity = 353/1112 (31.74%), Postives = 570/1112 (51.26%), Query Frame = 1
Query:  151 DNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQ------RTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAI----TFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMI-TMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI-NHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVIL--FKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEK-QLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            D     F+    G+   +E  I     +    DEN + ++H+AAA  ++E+M +++   + +  N  D  GNTP+H A   N+++++ +L+  GA+PN+ N++ MAP+H+ V     +V+K L  H   N N     GN+A+   C  DN EAL  LL+ GA +C  N +G YPVH A     ++C+E+++    K G S    +NF + +   PLH AV +GD   ++MCL  GA ID+ +N     LH+A T+G  DIVKLM+ +     D+V  + D N  T LH+A +F+H +LA+YLI  G++I  TD  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL  ++  F+       ++ ++DN GCTPLHY+ R+G       L++      +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + EG TALH AA    +  V +LL++ A I  +K+  +F    L  K        + + RW+E +++   +     CP++ M++ +P  + + +D   I +   +  +D+ I YNF  LQ      + V   +D+  +P  ++  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I     F +   +++ IST  E  N        T     L + MI     SI    KE   IF +   YF  + N +  V++ TS+I    +  +DI  +   Q  A+ IF  W N LL L  FE  G+F++M   I  T+L    +F  L + F  SF +L  F+   S+ +LS                              L++   MM+G+I + + ++ PL+      L YP LT+  L+ F +F+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP     W  +++ +    V+P R    ++       +  +   +E+ ++    E     +K +L +L     +Q +L+KLI+QKME+  E E  DN
Sbjct:   30 DCSKESFKVDIEGDMCRLEAFIKNRRKLSKYEDEN-LCLLHHAAAEGQVELMQLIINGSSCEALNVMDDYGNTPLHWAAEKNQVESVKFLLSQGANPNLRNRNMMAPLHIAVQGMYNEVIKVLTEHKATNINLEGENGNTALMSTCAKDNSEALQILLEKGAKLCKSNKWGDYPVHQAAFSGAKRCMELILAYGEKTGYSREAHINFVNHKKASPLHLAVQSGDLDMIKMCLDSGAHIDMMENAKCMALHFAATQGATDIVKLMISSYTGSSDIVNAV-DGNQETLLHRASLFDHHDLADYLISVGADINSTDSEGRSPLILATASASWNIVNLLLSKGAKVDIKDHLGRNFLHL--------TVQQPYGLRNLRPEFLQMQHIKELVMDEDNDGCTPLHYACRQGAPVSVNNLLRFNVSVHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEEGNTALHFAAREGHAKAVAMLLSYNADILLNKKQASFLHIALHNKRKEVVLTTIRSKRWDECLQVFTHDSPSNRCPIMEMVEYLPECMKVLLDFCMIPSTEDKSCQDYHIEYNFKYLQCPLSMTKKVTPTQDVIYEPLTILNVMVQHNRIELLNHPVCREYLLMKWCAYGFRAHMMNLGSYCLGLIPMTLLVVKIQPGMAFNSTGIINETISTHEERIN--------TLNSFPLKICMILVFLSSIFGYCKEVVQIFQQKRNYFLDYNNALEWVIYTTSMIFVLPLF-LDIPAYMQWQCGAIAIFFYWMNFLLYLQRFENCGIFIVMLEVIFKTLLRSTGVFIFLLLAFGLSFYVLLNFQDAFSTPLLS------------------------------LIQTFSMMLGDINYRDAFLEPLFRNE---LAYPVLTFGQLIAFTMFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPF----WYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDN 1085          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. UniProt/SwissProt
Match: sp|O75762|TRPA1_HUMAN (Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=TRPA1 PE=1 SV=3)

HSP 1 Score: 475.322 bits (1222), Expect = 7.312e-147
Identity = 346/1110 (31.17%), Postives = 554/1110 (49.91%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADK----NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI---CPVIGMIKDMPNILSLAMDKS-IKTEGSRGQKDFKIIYNFGILQRTV-----ASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMI-TMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILF--KAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWE----VFP---------YRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSK--------NWKTVIAS 3447
            D+     +HYAAA  +IE+M+   I R       +  D  GNTP+H AV  N+I+++ +L+  GA+PN+ N + MAP+H+ V     +V+K LL H  ++ N     GN+A+ IAC  +N EAL  LLK GA  C  N +G +P+H A    +++C+E+++    + G S    +NF +     PLH AV  GD + ++MCL  GA+ID  +    T +H+A T+G  +IVKLM+ +     D+V    D    T LH+A +F+H ELA+YLI  G++I   D  G +PL+LA +  +  +   LL  GA +  +D   RN +HL         V    GL+ ++  F+       ++ ++DN GCTPLHY+ R+G       L+       +++ DK +PLHFAA YGR++TC+RLL      + +N  D  G  P+H AA+NGH K++Q+LL +G +F   ++G T LH+A+  G+ +T + +++ N    D  + +G TALH AA    +  V LLL+H A I  +KQ  +F    L  K       ++ + RW+E ++I   N     CP+  MI+ +P  + + +D   + +   +  +D+ I YNF  LQ  +        +D+  +P   +  MV  NR++LL HP+   YL MKW  +G     + +  Y + L  ++     I      +    I+ +++ S I      +T    ++   MI     SI    KE+  IF +   YF    N +  +++ T II    +      H   Q  A+ ++  W N LL L  FE  G+F++M   IL T+L    +F  L + F  SF IL   + P SS +LS                              +++   MM+G+I +  +++ P        L +P L++  L+ F IF+ ++LMNLLIGLAVGDI  VQK+A+LKRI++QV   +  E KLP+    W  +++ +    V+P         +    +  C+ E +      D        +L   +   + +L +L     +Q +L+KLI+QKME+  E E  D+       F K         W TV+ +
Sbjct:   60 DDMDTFFLHYAAAEGQIELME--KITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVDIV-NTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFGRNFLHL--------TVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTIIRSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEI-----LDTTNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSSPLLS------------------------------IIQTFSMMLGDINYRESFLEPYLRNE---LAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPL----WFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNAD-------KSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRA 1109          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. UniProt/SwissProt
Match: sp|Q18297|TRPA1_CAEEL (Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans OX=6239 GN=trpa-1 PE=2 SV=5)

HSP 1 Score: 239.195 bits (609), Expect = 4.965e-63
Identity = 269/1101 (24.43%), Postives = 469/1101 (42.60%), Query Frame = 1
Query:  172 QFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHA------------VLNNE------------IKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPL-HYACTKGELDIVKLMLRT---RHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEE-GSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRN-----------------LIHLFSLNVVNDKV--------NFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVD-------ENGI-----CPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTV-------------------ASKEDL-----------NSDPFYV---VKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHET-----AKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQ-----VAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYT----LHYPTLTYI---FLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKL 3120
            Q A  GN   +++ ++     +++ D + MT +HYAA     + + +L+   A  N ++  G+TP+H A            +++ +             K +  L+   A+ + +NK  + P+H    KS    L  L++  + + +       + + +AC   +QE +  L+KA + V   +       H+       + LEM+++         ++ LN  + E   PL  AV     + ++  L    K   +  D    L H+A  KG L+++K ++     ++E+ +V           PLH A   N +E+  YLIEE   NI+V D+ G TPL++A +  + +  + L+   AN+   DK +R                  L HL   N   ++            +  E ++++ +++++   N   TP+H     G L +  +L K G      N D++T LH AA  G+    R+LL     ++ +   D  G   +H AA +GH    ++LLD G     +  +  TPL  A  +G +ETCQ L+     +    + + KT LH AA      +V   +  G +I  +D++G T F    +  + + A+  +  ++W+ ++   D        N +      P   ++   P + S  MD  I+           + YNF  L  T                    A  ED            N D  Y    +K M D  ++ LL HPLS A LK KW R GR + Y  + +Y++F+ +L+       +   +    N+       + + F  +ET       K  +V  +I    ++  ++ E   +F +  AY  +++N++   ++ T++I               Q     +AA+ IF GW NLL ++    + G+FV+MFV I+ T      +F +  I F+ SF +         IL N+P F+  +       + P            +K  VMM+GE EF     T ++ G+  T    +  P  T +       F I M++LLMNLL+GLAV DI+ VQ+ A LKR+++QV  + + E  L
Sbjct:   56 QSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDEDQADSARKYNTATKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIK-LKADVDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMDHD---PVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEV--------KAVPLHVAAQMNQLEVVSYLIEEEKDNIDVVDEQGLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYILDHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMVDRDQN---TPMHIVASNGYLEMMQLLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEW--DIRLLLMKDEMGNSALHLAARSGHDATTKVLLDNGADKEAKNSYQKTPLQVAVDSGKLETCQRLVAKGAQI--ESSSDTKTVLHTAAFYGNESIVRYFIAEGVTIDRRDEEGKTAFDIACENDHKDVARAFLETDQWKNLMIPCDVIPLDKHRNPVNMKRRTPFRTLLTKFPELASFVMDNCIEKSKEETDSTQSVAYNFEFLDDTYMMRCVSDDGTGEQLIGCKSAYDEDFKLEKDAQSYASNYDRVYKYHPLKLMADAEKLHLLNHPLSKALLKYKWNRLGRPMYYFALFMYLVFIVSLT------QYVRHTKAPYNVWNEESYYDSEYFDENETCPQINTTKPDVVWKIIIQTLAVCQILVECFQLFQRKFAYLVNWENWIDCFIYSTALITVYDFSECSATSGVRQNWQWILAALCIFFGWINLLFMIRKMPRFGIFVVMFVDIVKTFFRFFPVFVLFIIAFSSSFYV---------ILQNRPEFSTIF-------MSP------------LKTTVMMIGEFEF-----TGIFHGDETTHAEKMFGPAHTAVACALFFFFCIIMTILLMNLLVGLAVDDIKGVQEKAELKRLAMQVDLVLQIEASL 1098          

HSP 2 Score: 88.5817 bits (218), Expect = 2.906e-16
Identity = 120/538 (22.30%), Postives = 228/538 (42.38%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVM-DVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTV-----YKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVV--LKIQDNNGHTPLHKAVMFNHVE-LAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMN------STDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--KDKQG 1812
            +N  +++H +A    +  + + L+      NA+D +  TP+H+A       A+  L+   A PN  N++   P+H+       Y     ++ E       ++  +    N+A         ++ ++ L+   A +   N Y + P+H A    N   L  L++ K          ++  D     PL  A   G  + +Q  +   + +  R    +T  H    +GE + +++M+   H+  + +  L + +N   TPL  AV  NH E L + L  E  N     D     +  AA +  +EV K L++ G N    ++ +   +H+ +     + V++L+  EK     I +++E+   G TPL  +      +    LI         + D+ TP+   A++  + +   +L   D ++  N      +  S  R  +   +E+    ++ M+ DR          NTP+H  A+NG++E  Q L++ + + +   N + +TALH AAI  ++  V  LL     +   KD+ G
Sbjct:   48 DNLRSIIHQSAREGNVNALQEALLKAPLAVNAQDGDFMTPLHYAARYGNYDAVKLLLSKNALPNTKNREGDTPLHIASKYIYGYSDICSIIDE-------DQADSARKYNTA--------TKKIINALVSENAEIDPVNKYQLTPLHYAAMKSNFSALHALIKLKAD--------VDAEDDNKMTPLLLACVHGSQEIIQELIKANSNVTKRDQRLNTVFHIVALRGEPEYLEMMMD--HDPVEAIKALNLFNNEKKTPLRMAVEGNHPETLKKILQMEKKNSCKWMDREKELIHFAAEKGFLEVLKALVEAGGNKNELNEVKAVPLHVAAQMNQLEVVSYLIEEEKDN---IDVVDEQ---GLTPLMMAVTHDSKKCVEYLIAKKANLTITDKDERTPVFIGAKFNALSSVEYIL---DHLRKKNKETERSALKSPTRNTLRIVSEDVRRTMVNMV-DRD--------QNTPMHIVASNGYLEMMQ-LLQKHGASITQVNEDEETALHRAAIGGQTGAVRQLLEWDIRLLLMKDEMG 541          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. TrEMBL
Match: A0A291IA19 (Transient receptor potential cation channel subfamily A, member 1 OS=Schmidtea mediterranea OX=79327 GN=TRPA1 PE=2 SV=1)

HSP 1 Score: 2271.89 bits (5886), Expect = 0.000e+0
Identity = 1153/1161 (99.31%), Postives = 1153/1161 (99.31%), Query Frame = 1
Query:   16 KNLFREFSCFCFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF 3498
            K  F  F    FVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF
Sbjct:    9 KTSFGNFLASVFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF 1169          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. TrEMBL
Match: I1ZIL0 (Transient receptor potential cation channel subfamily A member-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 641/654 (98.01%), Postives = 645/654 (98.62%), Query Frame = 1
Query:   16 KNLFREFSCFCFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAM 1977
            K  F  F    FVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMD+LMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIE+NPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILS+ +
Sbjct:    9 KTSFGNFLASVFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMDILMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSVQI 662          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. TrEMBL
Match: A0A1S3HWE1 (transient receptor potential cation channel subfamily A member 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158805 PE=3 SV=1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 407/1180 (34.49%), Postives = 648/1180 (54.92%), Query Frame = 1
Query:   70 SEKKVPNVHMIELDEEMQLHDE-----VCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSR-GQKDFKIIYNFGILQRTVASKEDLNSD-----PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDK----NISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIV----NLIKESHPIFTKTLAYFTSFQNYMTLVLHITS-IILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFP------YRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIP-----------EMAGFSKNWKTVIASKSIICKMQKSVKPDNN 3495
            +E++   + M +   E   HD+     VC M D+P R  + A +GN    E+L   +   +   D  G T+MH+AA+  RI +MD ++ +  D NA+D  GNTP+H AV      ++ YLI +GAD  ILN D MAPIH  V    +  LK L+ HPEV+         +A+H A   D+++ ++ LL+  A +C  +  G+YP+HVA+K  + K +++LVE   K G +  Q+++F DK+ N+ LH+AVN  + KAVQ+CL  GA ID +Q D STP+H AC +G +D+VKLM   + E K + +K +D NG TPLHKA MF+H ELA+YL+EEG+ ++ +D +  +PLLLAASR +      LL+  A I  +DK  RN +HL   N    + +F             ++N+KD +GCTPLHY+++ G L   G L++ G   + +NN K++ LHFAA+YGR +TC +LLN+ +G   +N TD +G+  +H A  +GHTK++Q+LL +G +   C+ G TPLH AA NG+ +T + L+ M+  LL+  N EG T LH AA+  +   V LLLT  A I  ++   +TFF   +  K    A  +V + RW + + +  E   CP +GMI ++P+I  + +++ +   G     K+F   Y+F  LQ  +   + L  +     P   +  MV  NR+ LL HPL   YL MKW+ +G W+   ++ LYI+FL+AL+  ++      + H D      ++ + E      F     +   V     I + Y +V    N+IKE   +  +   YF  + NYM  +L++T+ I +  YI  +++ H   +  A+ IFL WFNLLL L  F+  G++V+MF++I  T++ V  +F IL + F   F IL     +   ++                  P I         L + ++MM+GEI+ +N++V PL D +  T H+  LT  F++VF++ M +LLMNLLIGLAVGDI+ VQ+NA+LKR+++QV   +E E KLP +I  W  K+  +++P      ++    ++  + +      +    +    ++ E L   + +L ++  +  +Q +L++LI+QKME+  EA+  D  +P                S N +  +A  +++ K  +S+  + N
Sbjct:   22 AEERGLTLEMTKPSTEPPAHDDNFSGAVCHMRDSPFRILKVAKSGNIEAFERLFYEDESRLFLKDAKGQTVMHHAASKDRIVIMDFILDHGGDINAKDCKGNTPLHVAVELTATASIDYLIYHGADTTILNADLMAPIHYAVDLGNVASLKALISHPEVDIALGGENDGTALHYAAAKDDEKCVELLLEHKAPLCKHDSIGLYPIHVAVKNASAKSVDVLVEHAEKNGYTRSQLMSFMDKKKNMALHSAVNAANLKAVQVCLAAGADIDAQQEDKSTPIHLACAQGAMDMVKLMFEKQPEKKHICIKAKDVNGMTPLHKAAMFDHFELAKYLVEEGAWVDESDKDDRSPLLLAASRYSWRTAVLLLEKKAKITLKDKDNRNFLHLAIANGARLE-DFPCQSVMCSTDLKMLLNDKDELGCTPLHYASKEGHLASLGSLLQHGASVIVKNNQKESALHFAAKYGRFNTCLQLLNSPEGHNIINETDQYGKTALHVACCSGHTKVVQLLLQKGALVSGCHMGFTPLHLAAKNGYTQTMKLLLGMHSHLLNLPNSEGNTVLHIAALYGQPAAVSLLLTEEADITHRNNDDMTFFDVAIANKQKEVAHAIVTHKRWHDCMHLRSEYHGCPGMGMIINLPDIFEVVLNQCVTPVGKDIKSKEFHKHYDFSYLQLPMDYVKKLRENGTSYTPLMSLNMMVKHNRVGLLSHPLCLQYLSMKWQAYGGWIHMFVLFLYILFLAALT--SHVTYIRPMDHDDPWAHFGVNRTNETRYCSRFCQSLKSGYQVAPFHRIGLLYILVFCALNIIKEIFQVIQQRAKYFIDWVNYMEWILYVTAGIFVGPYIFEINL-HYQWECGAIAIFLAWFNLLLHLQRFDVFGIYVVMFLEITKTLIQVFVLFMILIVAFGLCFYILLSEENNRSFVT------------------PEI--------SLFRTIIMMLGEIDSINSFVEPLTDDSPITQHFGGLTVFFVIVFVLLMPILLMNLLIGLAVGDIDTVQRNASLKRLAMQVDLHTELELKLPQRILEWVDKKDLDIYPNSRRNMFKRFWSRVSDTSSNAEGCTSGSSTAVCGRSIHEELQKQKARLKDISSNLDKQHELIRLIVQKMEIKSEADYRDEGVPTNRDPAYALRSNFQWLSSNMREKVAQATVVSKWVRSMSKEEN 1171          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. TrEMBL
Match: A0A1S3HWH0 (transient receptor potential cation channel subfamily A member 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158805 PE=3 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 398/1147 (34.70%), Postives = 633/1147 (55.19%), Query Frame = 1
Query:  154 NPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSR-GQKDFKIIYNFGILQRTVASKEDLNSD-----PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDK----NISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIV----NLIKESHPIFTKTLAYFTSFQNYMTLVLHITS-IILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFP------YRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIP-----------EMAGFSKNWKTVIASKSIICKMQKSVKPDNN 3495
            +P   F+ A +GN    E+L   +   +   D  G T+MH+AA+  RI +MD ++ +  D NA+D  GNTP+H AV      ++ YLI +GAD  ILN D MAPIH  V    +  LK L+ HPEV+         +A+H A   D+++ ++ LL+  A +C  +  G+YP+HVA+K  + K +++LVE   K G +  Q+++F DK+ N+ LH+AVN  + KAVQ+CL  GA ID +Q D STP+H AC +G +D+VKLM   + E K + +K +D NG TPLHKA MF+H ELA+YL+EEG+ ++ +D +  +PLLLAASR +      LL+  A I  +DK  RN +HL   N    + +F             ++N+KD +GCTPLHY+++ G L   G L++ G   + +NN K++ LHFAA+YGR +TC +LLN+ +G   +N TD +G+  +H A  +GHTK++Q+LL +G +   C+ G TPLH AA NG+ +T + L+ M+  LL+  N EG T LH AA+  +   V LLLT  A I  ++   +TFF   +  K    A  +V + RW + + +  E   CP +GMI ++P+I  + +++ +   G     K+F   Y+F  LQ  +   + L  +     P   +  MV  NR+ LL HPL   YL MKW+ +G W+   ++ LYI+FL+AL+  ++      + H D      ++ + E      F     +   V     I + Y +V    N+IKE   +  +   YF  + NYM  +L++T+ I +  YI  +++ H   +  A+ IFL WFNLLL L  F+  G++V+MF++I  T++ V  +F IL + F   F IL     +   ++                  P I         L + ++MM+GEI+ +N++V PL D +  T H+  LT  F++VF++ M +LLMNLLIGLAVGDI+ VQ+NA+LKR+++QV   +E E KLP +I  W  K+  +++P      ++    ++  + +      +    +    ++ E L   + +L ++  +  +Q +L++LI+QKME+  EA+  D  +P                S N +  +A  +++ K  +S+  + N
Sbjct:   21 DPAEMFKVAKSGNIEAFERLFYEDESRLFLKDAKGQTVMHHAASKDRIVIMDFILDHGGDINAKDCKGNTPLHVAVELTATASIDYLIYHGADTTILNADLMAPIHYAVDLGNVASLKALISHPEVDIALGGENDGTALHYAAAKDDEKCVELLLEHKAPLCKHDSIGLYPIHVAVKNASAKSVDVLVEHAEKNGYTRSQLMSFMDKKKNMALHSAVNAANLKAVQVCLAAGADIDAQQEDKSTPIHLACAQGAMDMVKLMFEKQPEKKHICIKAKDVNGMTPLHKAAMFDHFELAKYLVEEGAWVDESDKDDRSPLLLAASRYSWRTAVLLLEKKAKITLKDKDNRNFLHLAIANGARLE-DFPCQSVMCSTDLKMLLNDKDELGCTPLHYASKEGHLASLGSLLQHGASVIVKNNQKESALHFAAKYGRFNTCLQLLNSPEGHNIINETDQYGKTALHVACCSGHTKVVQLLLQKGALVSGCHMGFTPLHLAAKNGYTQTMKLLLGMHSHLLNLPNSEGNTVLHIAALYGQPAAVSLLLTEEADITHRNNDDMTFFDVAIANKQKEVAHAIVTHKRWHDCMHLRSEYHGCPGMGMIINLPDIFEVVLNQCVTPVGKDIKSKEFHKHYDFSYLQLPMDYVKKLRENGTSYTPLMSLNMMVKHNRVGLLSHPLCLQYLSMKWQAYGGWIHMFVLFLYILFLAALT--SHVTYIRPMDHDDPWAHFGVNRTNETRYCSRFCQSLKSGYQVAPFHRIGLLYILVFCALNIIKEIFQVIQQRAKYFIDWVNYMEWILYVTAGIFVGPYIFEINL-HYQWECGAIAIFLAWFNLLLHLQRFDVFGIYVVMFLEITKTLIQVFVLFMILIVAFGLCFYILLSEENNRSFVT------------------PEI--------SLFRTIIMMLGEIDSINSFVEPLTDDSPITQHFGGLTVFFVIVFVLLMPILLMNLLIGLAVGDIDTVQRNASLKRLAMQVDLHTELELKLPQRILEWVDKKDLDIYPNSRRNMFKRFWSRVSDTSSNAEGCTSGSSTAVCGRSIHEELQKQKARLKDISSNLDKQHELIRLIVQKMEIKSEADYRDEGVPTNRDPAYALRSNFQWLSSNMREKVAQATVVSKWVRSMSKEEN 1137          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. TrEMBL
Match: A0A267H4H8 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010017g1 PE=3 SV=1)

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 416/1178 (35.31%), Postives = 648/1178 (55.01%), Query Frame = 1
Query:  109 DEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILN-KDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKK-GCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLN-VVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVAS----KEDLNSD-PFY-VVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDI-------FYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHT---TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFK------------APTSSE---------------------ILSNQPMF-NQCYQA-YSSNK---LEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRC---------------------PTYKICSSEAQVIYKKNDYEE-SRDL-----------GNLFETLNTH----EKQLYNLMVDSHQQTDLLKLILQKM 3360
            D  MQL     L +D     F+ A +G   E+ ++  GNS  I +++E G +++H AA   +  ++ +L+   A+ + +D+ G T ++ A+  +++K +  L+  GA+ N+   ++  AP+HL    ++L+ L+ L   PE N N     G +A+H AC  D  +    LL+     C P+ +G +P H+A+   + KCL ++ +   KK G S  Q++N+ D EGNVPLH AVN GD  AV++CL   A ID  Q D+STP+H+AC KGEL++V++M   + +    VL  +D NGHTPLHKAVMFNH ELA++L+ +GS+ E+ D+   T LLLAA +   +   TL   GA+I A D   RN++HL ++N    D+ N    ++K+      ++N KD  GCTPLHY+T++G L +T  L+ LG  C   NND+ TPLHFAARYGR++TCR L+ +   +  +N+ D  G+ P+H AAENGH KI+++LL RG +F +  +GNT LH A  NGH++  + L+ +NP L+D QN E KTALH AA + ++ VV  LL+ GAS+ KD  G  F  +  + K       V+ + RW EV+  V   G CPV   I+ +P   S+A+D+SI  +G      +K +Y+F +LQ  V      +E L    PF  +++ MV+LNR+ LL HPL  AYL MKW R+GRW+  + +L+YIIFL++L+   + ++  +  HVD N + +  CS   +       FYG       + +  M+   +S +N+ KE   +  + + YF    NY+ L L+ ++   + +++   + ++      + A+   L W N LL    +E+ G++VIMF++I  T+  V+++FSIL  GF  SF I+ +            +PT+ E                       SN   F + C+ A YS +K    +P +  W      ++K ++MM+GE +++ T+ + L DG+  T H+    ++ L++FII M +LLMNLLIGLAVGDIE VQ +A L+RI LQV W +E E K P +   +  +  WEVF   C                     P     + + +   +  D+E+ S+DL           G+L ETL       + +L  +  ++  QT  LK+IL KM
Sbjct:   99 DVNMQLLSTSSLPNDTAAHLFKCAVSGMADELRQIFDGNSEAIETTNEYGQSLLHVAAKAGQTSIIALLIEEGANIDFQDNEGKTALYEAIEADQVKTVRLLVELGANVNLATVRERKAPVHLASELNRLECLQALRDSPEWNANLEGYHGYTALHFACSRDAADVCQLLLETECQPCKPDNFGQFPSHIAVTNSSAKCLSLIADFCQKKHGISRKQVINYRDLEGNVPLHAAVNCGDPNAVRLCLELEADIDTEQEDSSTPVHFACLKGELEMVQMMFEFQPKNVRDVLAHRDKNGHTPLHKAVMFNHSELAKFLLSKGSDPELRDNQDNTALLLAARKSAFDCLVTLFCSGADISAVDVDGRNVVHLCTINGTKKDQWNNPCIVKKLA----PLLNLKDQYGCTPLHYATQKGDLMITEKLLHLGAHCRVANNDRSTPLHFAARYGRLNTCRHLVESCPPL--LNTLDRLGQSPLHLAAENGHAKIVRILLQRGAVFQKDTNGNTCLHLAVRNGHMDCIRLLLSVNPILIDAQNREEKTALHLAAQSGQAEVVSHLLSCGASLIKDCNGYLFVNYATRAKEKEVLIAVIQHARWTEVLLSVSV-GCCPVFECIQYLPECASMALDRSITDKG------YKTVYDFSLLQFPVEKIPVYEETLGQKYPFLPILRHMVNLNRVSLLTHPLCEAYLSMKWNRYGRWIHNINILIYIIFLASLTI--FVVSMPSTKHVD-NGNFAEICSLQHVREIRPMDFYG------MIFLPVMLLSAFSFINICKEILQMLQQRMRYFMDGTNYLELTLYGST---AGFVVPFYMGYSMEFQWNLGALATLLAWMNFLLFFQRYEQTGIYVIMFLRIAKTLFRVISLFSILIFGFGLSFYIVLQYKPGEAWQNVPYSPTNDEHEFYVKFYSIANGLQVDNYTAAWSNATAFVSSCFPATYSYSKSLDADPNLDAWNHPVLAILKTLMMMLGEFDYVATFTSKLLDGDPRTNHFYVTNFVLLVLFIILMPILLMNLLIGLAVGDIETVQNDATLQRIRLQVEWFAELESKFPRRFLAFVDRIQWEVFQKSCQRSCFTRCVNWLKRRLCKRGDPESDYAALDEEHAGESCDFEKISQDLLQQQRRQRKGQGDLMETLARQVEETQMKLKKMEAENTAQTQFLKMILAKM 1251          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 477.633 bits (1228), Expect = 6.587e-149
Identity = 359/1127 (31.85%), Postives = 564/1127 (50.04%), Query Frame = 1
Query:   82 VPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQ-QSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSIK-TEGSRGQKDFKIIYNFGILQRTVAS-------KEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTT---MQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEV----FPYRC---PTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            +PN   ++LD+  Q+  +V          F++A  GN M +EK    +   ++  D+ G + +HYAA    +  + +++     +  N  D  GNTP+H AV  ++  + + L+  GADPNILNK  ++P+HL V      ++++L+ H + N N     GN+ + +A  +DN EAL  L + GA +C  N  G +P+H A     +K +E++++   + G S    +N+ DK  + PLH AV  G+   +Q+C+ +GAKI+ +Q D ST LH+ACT+G  + VKLML     V D++  I D    TPLHKA +F+H ELAEYLI +G++I+  D  G +PLLLA S         LL +GA +  RDK   N +HL  L     K    +  E +Q +S   ++N++D+ GCTPLHY+ R G+      ++ L      ++  K + LHFAA YGR++TC RLL      + +N  D  G  P+H A+  GH K++++LL +G +FH  Y G + LH+AA  G  +T + L+  N  LLD  + +G TALH AA       V  LL  GA    +K   +F    +          V+ ++R EE +     N    C V+ MI+ +P      +D  IK ++       + I YNF  LQ T          +ED +  P   +  MV+ NR++LL HP+   +L+MKW+ +G     L M++Y   L  L      +       V+KN++T    +       +       LV+AM T  Y++    KE   +F + L Y     N M     I S++   ++I + +N  +    Q  A+   + W NLLL L  FE+ G++V+MF +I  T+L ++ +F  L + FA +F  L         +  Q  F + + +                   LM+  VMM+GEI + + ++ P        L +P +TY   + F++ + +LLMNLLIGLAVGDI  VQ NA LK+I +Q+   S  E +LP     W  K + +V    FP +C     +  C  E + + +       R    +   L   + +L  +     +Q  LLKLI+QKME+  EA+ +D 
Sbjct:    1 MPNSSQMDLDKSNQMSTDV----------FEWALEGNTMALEK----HPKQLAVRDDTGASPLHYAACKGHLRAIKLIVQIAGQQELNVVDEEGNTPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDII-NITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSCGAWRTVNLLLSHGAELKVRDKAGCNFLHLAILQPRGLKN---LPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKGALFHSDYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLNMIVYT--LGVLPLTYLIVNLRPKLTVNKNVTTVTMVTTSIDKQCYFITSCMFLVLAMNT--YAVG---KEIVQMFQQRLKYLRDMSNLMDWSSTICSLL---FVIPLLLNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYAL---------MVEQRHFGRMFLS-------------------LMQTFVMMVGEISYQDNFLKPYMSSQ---LPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERLPY----WFVKRVDQVSVREFPNKCYNGKRWVCCGGEVRKV-RPRLCPTPRQSTPMERELAKQKHRLKEMTESIEKQHHLLKLIVQKMEICSEADDNDG 1063          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Cavefish
Match: trpa1a (transient receptor potential cation channel subfamily A member 1-like [Source:NCBI gene;Acc:103022174])

HSP 1 Score: 466.077 bits (1198), Expect = 7.293e-145
Identity = 353/1128 (31.29%), Postives = 553/1128 (49.02%), Query Frame = 1
Query:   82 VPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQ-QSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGI--CPVIGMIKDMPNILSLAMDKSIK-TEGSRGQKDFKIIYNFGILQRTVAS-------KEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECS-NIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTT---MQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEV----FPYRC---PTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDN 3393
            +PN   ++LD+  Q+  +V          F++A  GN M +EK    +   ++  D+ G + +HYAA    +  + +++     +  N  D  GNTP+H AV  ++  + + L+  GADPNILNK  ++P+HL V      ++++L+ H + N N     GN+ + +A  +DN EAL  L + GA +C  N  G +P+H A     +K +E++++   + G S    +N+ DK  + PLH AV  G+   +Q+C+ +GAKI+ +Q D ST LH+ACT+G  + VKLML     V D++  I D    TPLHKA +F+H ELAEYLI +G++I+  D  G +PLLLA S         LL +GA +  RDK   N +HL  L     K    +  E +Q +S   ++N++D+ GCTPLHY+ R G+      ++ L      ++  K + LHFAA YGR++TC RLL      + +N  D  G  P+H A+  GH K++++LL +G +FH  Y G + LH+AA  G  +T + L+  N  LLD  + +G TALH AA       V  LL  GA    +K   +F    +          V+ ++R EE +     N    C V+ MI+ +P      +D  IK ++       + I YNF  LQ T          +ED +  P   +  MV+ NR++LL HP+   +L+MKW+ +G     L M++Y   L  L      +       V+KN++T    + +ID                                    K L Y     N M     I S++   ++I + +N  +    Q  A+   + W NLLL L  FE+ G++V+MF +I  T+L ++ +F  L + FA +F  L         +  Q  F + + +                   LM+  VMM+GEI + + ++ P        L +P +TY   + F++ + +LLMNLLIGLAVGDI  VQ NA LK+I +Q+   S  E +LP     W  K + +V    FP +C     +  C  E + + +       R    +   L   + +L  +     +Q  LLKLI+QKME+  EA+ +D 
Sbjct:    1 MPNSSQMDLDKSNQMSTDV----------FEWALEGNTMALEK----HPKQLAVRDDTGASPLHYAACKGHLRAIKLIVQIAGQQELNVVDEEGNTPLHWAVQKDQRGSCSALLSLGADPNILNKSLLSPLHLAVSLRHNGLVEQLVSHSQTNVNLEGDLGNTPVILAASVDNHEALCILQRNGAKLCRQNKLGHFPIHAAAFAGAKKTMEVVLQKGQEAGMSIESHINYVDKSISSPLHLAVRGGNLDVIQLCIAHGAKINQQQCDKSTALHFACTQGATEAVKLMLLAYDRVCDII-NITDGACQTPLHKATIFDHYELAEYLISQGADIDFIDCKGHSPLLLATSCGAWRTVNLLLSHGAELKVRDKAGCNFLHLAILQPRGLKN---LPTEVLQHESVRELLNDEDSEGCTPLHYACRLGIPDSVKNMLGLEVSLDQKSKQKKSALHFAAEYGRINTCHRLLEPMTDTRLLNEGDEKGMTPLHLASRGGHVKVVELLLRKGALFHSDYKGWSCLHHAAAEGFTQTMETLLISNIKLLDKIDGDGNTALHLAARAGHVAAVRQLLCRGAQFVLNKGDASFLHEAVHNGRKEVTSAVIDSDRCEEAITTFKVNSAKRCIVLDMIEFLPESYKHLLDTCIKESDDDVNSCTYNIEYNFQWLQHTNHRIQNTDNIEEDDDYKPLAALNAMVEFNRVELLTHPVCKKFLEMKWKAYGMKAHLLNMIVYT--LGVLPLTYLIVNLRPKLTVNKNVTTVTMVTTSID------------------------------------KRLKYLRDMSNLMDWSSTICSLL---FVIPLLLNVESSWHWQAGALAGLISWINLLLYLQRFERFGIYVVMFREICRTLLSIIVLFIYLILAFALAFYAL---------MVEQRHFGRMFLS-------------------LMQTFVMMVGEISYQDNFLKPYMSSQ---LPFPLMTYGIFVWFVLLVPILLMNLLIGLAVGDIAEVQTNACLKQIGMQIELHSNLEERLPY----WFVKRVDQVSVREFPNKCYNGKRWVCCGGEVRKV-RPRLCPTPRQSTPMERELAKQKHRLKEMTESIEKQHHLLKLIVQKMEICSEADDNDG 1033          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 454.907 bits (1169), Expect = 2.030e-140
Identity = 340/1109 (30.66%), Postives = 557/1109 (50.23%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMD--VLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDEN-GI-CPVIGMIKDMP----NILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKE------DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHE-----------KQLYNLMVDS---HQQTDLLKLILQKMEMDPEAEISDN 3393
            F+++  GN   +E L   N  ++ S DE G   +H+AAA++ + V+   V ++   + N +D +G TP+H AV  N+  + + L+  GADPNIL+    AP+HL +     ++++ LL     + +     GN+   +AC  +N +AL  L K  A +C  N  G + +H       ++ +E++++   + G +    +N+ DK  + PLH AV  G+T+ +++C+  GAK+D +Q D ST LH+ACT+G  + VK+ML+    +++++  I+D    TPLH+A +F+HVELAEYL+ +G++I+  D  G +PLLLA +    +    LL  GA+   +DK  RN +HL    +   K     GL+ + ++ +       +++++D  GCTPLHY+ + G+      ++        ++  K + LHFAA YGR++TC RLL T    + +N  +  G  P+H A+  GHTK++++LL RG +F   Y G + LH+AA  G+ +T   L+  N  LLD  N EG TALH AA       V LLL  GA    +K G +F    ++      A   + N R  E + +  +  G  C V+ +I+ +P    ++L L M   +++E      ++ I YNF  LQ  +  K+       +N  P   +  MV  NR++LL HP+   YL+MKW+ +G  V  L + +Y++ L  L++    +  T  + V+    T A  S     Y        VLVM +  +C  +V L ++        L YF    N       I+S++    +     N    +  A+ I   W N LL    FE+ G++V+MF +I+ T++  + +F  L + F  SF  L         + ++  FN                    +   L +  VM +GE+ + NT +     G    L +P ++Y   ++F++ M +LLMNL+IGLAVGDI  VQ+NA LKRI++Q++  +  E KLP        K    ++P      K C     +I +  ++ E  ++      LNT+            KQ Y L   S    +Q +LLKLI+QKME+  EA+  D 
Sbjct:   24 FEWSCKGNISSLEFLSQKNPELLKSRDECGAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEII-NIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLATTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLV---IFQPK-----GLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQSDYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCM---VESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTMASVSFRTQSYMISVCIVMVLVMNVYAICKELVQLAQQR-------LIYFMDSTNVSDWASAISSLVFVIPLFFSVDNKWHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYAL---------MLHRVEFNS-------------------ISLSLAQTFVMTVGELNYQNTLLEAYEQGQ---LAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPYWYMKRVDKPSITIYP-----NKKCEKVLGMIQQFWNFGEETEVR---VRLNTNARKSCPLEREIMKQKYRLKEISSVLEKQHNLLKLIIQKMEITSEADEHDG 1074          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 454.907 bits (1169), Expect = 2.030e-140
Identity = 340/1109 (30.66%), Postives = 557/1109 (50.23%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMD--VLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDEN-GI-CPVIGMIKDMP----NILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKE------DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHE-----------KQLYNLMVDS---HQQTDLLKLILQKMEMDPEAEISDN 3393
            F+++  GN   +E L   N  ++ S DE G   +H+AAA++ + V+   V ++   + N +D +G TP+H AV  N+  + + L+  GADPNIL+    AP+HL +     ++++ LL     + +     GN+   +AC  +N +AL  L K  A +C  N  G + +H       ++ +E++++   + G +    +N+ DK  + PLH AV  G+T+ +++C+  GAK+D +Q D ST LH+ACT+G  + VK+ML+    +++++  I+D    TPLH+A +F+HVELAEYL+ +G++I+  D  G +PLLLA +    +    LL  GA+   +DK  RN +HL    +   K     GL+ + ++ +       +++++D  GCTPLHY+ + G+      ++        ++  K + LHFAA YGR++TC RLL T    + +N  +  G  P+H A+  GHTK++++LL RG +F   Y G + LH+AA  G+ +T   L+  N  LLD  N EG TALH AA       V LLL  GA    +K G +F    ++      A   + N R  E + +  +  G  C V+ +I+ +P    ++L L M   +++E      ++ I YNF  LQ  +  K+       +N  P   +  MV  NR++LL HP+   YL+MKW+ +G  V  L + +Y++ L  L++    +  T  + V+    T A  S     Y        VLVM +  +C  +V L ++        L YF    N       I+S++    +     N    +  A+ I   W N LL    FE+ G++V+MF +I+ T++  + +F  L + F  SF  L         + ++  FN                    +   L +  VM +GE+ + NT +     G    L +P ++Y   ++F++ M +LLMNL+IGLAVGDI  VQ+NA LKRI++Q++  +  E KLP        K    ++P      K C     +I +  ++ E  ++      LNT+            KQ Y L   S    +Q +LLKLI+QKME+  EA+  D 
Sbjct:   24 FEWSCKGNISSLEFLSQKNPELLKSRDECGAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEII-NIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLATTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLV---IFQPK-----GLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQSDYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCM---VESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTMASVSFRTQSYMISVCIVMVLVMNVYAICKELVQLAQQR-------LIYFMDSTNVSDWASAISSLVFVIPLFFSVDNKWHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYAL---------MLHRVEFNS-------------------ISLSLAQTFVMTVGELNYQNTLLEAYEQGQ---LAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPYWYMKRVDKPSITIYP-----NKKCEKVLGMIQQFWNFGEETEVR---VRLNTNARKSCPLEREIMKQKYRLKEISSVLEKQHNLLKLIIQKMEITSEADEHDG 1074          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Cavefish
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:103042231])

HSP 1 Score: 446.047 bits (1146), Expect = 1.241e-137
Identity = 315/1016 (31.00%), Postives = 519/1016 (51.08%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMD--VLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFIS------IINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDEN-GI-CPVIGMIKDMP----NILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKE------DLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEI 3156
            F+++  GN   +E L   N  ++ S DE G   +H+AAA++ + V+   V ++   + N +D +G TP+H AV  N+  + + L+  GADPNIL+    AP+HL +     ++++ LL     + +     GN+   +AC  +N +AL  L K  A +C  N  G + +H       ++ +E++++   + G +    +N+ DK  + PLH AV  G+T+ +++C+  GAK+D +Q D ST LH+ACT+G  + VK+ML+    +++++  I+D    TPLH+A +F+HVELAEYL+ +G++I+  D  G +PLLLA +    +    LL  GA+   +DK  RN +HL    +   K     GL+ + ++ +       +++++D  GCTPLHY+ + G+      ++        ++  K + LHFAA YGR++TC RLL T    + +N  +  G  P+H A+  GHTK++++LL RG +F   Y G + LH+AA  G+ +T   L+  N  LLD  N EG TALH AA       V LLL  GA    +K G +F    ++      A   + N R  E + +  +  G  C V+ +I+ +P    ++L L M   +++E      ++ I YNF  LQ  +  K+       +N  P   +  MV  NR++LL HP+   YL+MKW+ +G  V  L + +Y++ L  L++    +  T  + V+    T A  S     Y        VLVM +  +C  +V L ++        L YF    N       I+S++    +     N    +  A+ I   W N LL    FE+ G++V+MF +I+ T++  + +F  L + F  SF  L         + ++  FN                    +   L +  VM +GE+ + NT +     G    L +P ++Y   ++F++ M +LLMNL+IGLAVGDI  VQ+NA LKRI++Q++  +  E KLP     W  K +
Sbjct:   24 FEWSCKGNISSLEFLSQKNPELLKSRDECGAGPIHHAAASANLAVIRLIVTVVGPEELNTQDDHGRTPLHWAVEKNQEGSCSLLLELGADPNILSLSLTAPLHLAISLEHNNLVQLLLLCDRTDVDLEGDLGNTPAMVACSNNNCQALQILFKYNAKLCHQNKLGHFAIHTVAFAGAKEAMEVILQKGEEMGITTSGHINYLDKSKSSPLHLAVRGGNTEVIKLCISKGAKVDQQQCDKSTALHFACTQGATEAVKIMLQPYERMEEII-NIRDGANQTPLHRATLFDHVELAEYLVSKGADIDCIDCKGLSPLLLATTCSAWKTVSFLLLKGADFRVKDKAGRNFLHLV---IFQPK-----GLKNLPENLLQSKAVRELMSDEDYEGCTPLHYACKLGIHDSVKNMLSQKICLGRKSKQKKSGLHFAAEYGRLNTCIRLLETISDSRLLNEGEENGLTPLHLASRGGHTKVVELLLRRGALFQSDYKGWSCLHHAAAEGYTQTMVILLAANVKLLDYTNEEGNTALHLAARAGHVAAVKLLLNRGALFMLNKNGASFLHEAVRNGKKEVANAAIENERSSEALSLFKKGPGFRCVVLDLIEFLPESTKHLLDLCM---VESEHDPNNINYHITYNFKWLQAPILLKKYAKTDKSMNFQPLAALNAMVQYNRLELLTHPVCQKYLEMKWKAYGSKVHLLNLAVYLLGLLPLTYLIINLKPTQNTSVNGTTVTMASVSFRTQSYMISVCIVMVLVMNVYAICKELVQLAQQR-------LIYFMDSTNVSDWASAISSLVFVIPLFFSVDNKWHWEAGALAILFAWINFLLYFQRFERFGIYVVMFGEIIKTLISTIVLFVFLLLAFGLSFYAL---------MLHRVEFNS-------------------ISLSLAQTFVMTVGELNYQNTLLEAYEQGQ---LAFPEISYFIFVLFVLLMPILLMNLMIGLAVGDIAEVQRNATLKRIAMQINLHTNLEEKLPY----WYMKRV 985          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005975.1 (pep scaffold:Pmarinus_7.0:GL479470:1543:21127:-1 gene:ENSPMAG00000005392.1 transcript:ENSPMAT00000005975.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 1.604e-64
Identity = 154/504 (30.56%), Postives = 259/504 (51.39%), Query Frame = 1
Query:  325 RADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNH-----VELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI-SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLT 1818
            RA  N  D  G+TP+H A  + + +A+  L++ GA+PN+LN    AP+H+       D ++ L+     + +     G + + +AC  D+  ++  L+  GA +C  +  G +P+H+A+   + K  + ++    +KG     ILN++DK  N  LH AV+ G    +++CL  GA+ID +Q     PL  ACT    +  K    +++E    + +   ++ +      V+        V+L      +G+ ++  D    +P LLA  R       TLL  GAN+  +D   RN +H+ +++      NF  G +  Q+  I +++ +KD  GCTPLHY+++ G +   G ++ L      ++    +PLHFAA YGR+++C +LL T  G K MN  D  G   +H AA NGHT+++Q+LL RG +  R + G T LH+AA  G+ +T + L+E + +LL+     G TALH       +    LLL  GA +  + +G +
Sbjct:   12 RAVLNVTDDEGDTPLHVAAGSGQAEAVRLLLVLGANPNVLNLAQKAPLHVASELDLSDTVEALMSQARTDVDIEGVHGMTPVMVACSFDHPRSIAVLMDHGARMCKKSQLGFFPLHIAVMAGSTKSFQFMLRKAEEKGYMKETILNYADKSQNSTLHIAVHAGHLGIIRICLQSGARIDAKQ----VPL--ACTLAYTNKQKTCSISKYEKTAYIKERMTDDLYDDDDDLVIAARSEKELVDLQHAGCRQGAELDSLDREKRSPCLLATMRGAWRTVTTLLSLGANVSIQDIKGRNFLHV-AVSQGGWLGNF--GKDIFQREDIKALLEDKDTEGCTPLHYASKYGTIEALGGVLPLQASIHLKSKANKSPLHFAAEYGRLNSCAQLLRTARGSKLMNEGDGDGLTALHLAASNGHTRVVQLLLSRGALLLRDHQGRTSLHWAAVGGYTQTIKLLLETHRNLLNKTEEGGHTALHLCGREGHAATARLLLDEGAELMLNAEGFS 506          

HSP 2 Score: 61.6178 bits (148), Expect = 7.767e-10
Identity = 49/168 (29.17%), Postives = 79/168 (47.02%), Query Frame = 1
Query:  745 PMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELD----IVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANI---------YARDKTQRNLIHL 1209
            P  +LN +D EG+ PLH A  +G  +AV++ L  GA  +V       PLH A    ELD    +  LM + R +V      I+  +G TP+  A  F+H      L++ G+ +      G+ PL +A    + + F+ +L+              YA DK+Q + +H+
Sbjct:   11 PRAVLNVTDDEGDTPLHVAAGSGQAEAVRLLLVLGANPNVLNLAQKAPLHVAS---ELDLSDTVEALMSQARTDV-----DIEGVHGMTPVMVACSFDHPRSIAVLMDHGARMCKKSQLGFFPLHIAVMAGSTKSFQFMLRKAEEKGYMKETILNYA-DKSQNSTLHI 169          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 2.252e-46
Identity = 169/593 (28.50%), Postives = 264/593 (44.52%), Query Frame = 1
Query:  256 GMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAP-----------------------------IHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSL---LDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV 1932
            G T +H AA   + +++ VL+ + A+ NA+  NG TP++ A   N ++ + +L+ NGA+ ++  +D   P                             +H+   K   +    LL+H E N + T+  G + +HIA    N      LL  GA V      GI P+HVA K  N   +++L++   K        ++   ++G  PLH A  +G  K ++M L   A I  +  +  +PLH A     L  V+L+L  +  V DV L        TPLH A    H  +A+ L++ G        NG+TPL +A  +  ++V + LLK+GA+I+   ++    IH+ S     + V  L+     Q    S  N  +  G TPLH ++R G L +   L++ G     +  +  TPLH A+R G+    + LL         N+  + G  P++ A+  GH  +  +LL+ G  I      G TPLH A+  G +E    L+E   S    +  QN  G T LH A   D   V  LLL  GAS     K G T   HI   KN     +V+     E    ++ + G+ P+
Sbjct:   77 GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQH-EHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAK--------IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYL-----TPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLL-----QNGASS--NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD---PNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQN--GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPL-HIAAKKNQLEVGKVLLELGAE--TNMLTQQGVAPL 640          

HSP 2 Score: 162.925 bits (411), Expect = 3.121e-41
Identity = 144/522 (27.59%), Postives = 237/522 (45.40%), Query Frame = 1
Query:  115 EMQLHDEVCLMSDNPN--RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            EM L  +  +++   N   P   A  G  +   +L++G    +     + +T +H AA      V  +L+    + NAR  NG TP+H A   N IK +  L+ +GA  +   +  + PIH+  +   L+V++ LL++   + N T   G + +H+A      E +  LL++GA V         P+H+A +    + +++L++    +G  P    N     G+ PL+ A   G      + L  GA I        TPLH A   G L++  L+L  ++   D   K+   NG TPLH A  ++H ++A  L+++G++   T  NG+TPL +AA +  +EV K LL+ GA      +     +HL +     D V  L+G    + + IS+  +    G T +H + +   + +  IL K      T      TPLH A+ YG +     LL        +N+    G  P+H AA+ GHT ++  LL      +    +GNT L  A   G+I     L
Sbjct:  288 EMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQN-GASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQ----RGSDP----NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLE-KYASADP--KVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLG----RHASISLATKG---GLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRN---RALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 3 Score: 140.584 bits (353), Expect = 3.507e-34
Identity = 153/580 (26.38%), Postives = 258/580 (44.48%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELL-RHPEVNR---------NQTTSCGN----------------------SAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHL-FSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRL-PIHAAAENGHTKIIQML----LDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            P   AA    M +  L++     +  +  NG+T +H AA      ++ +L+   A  + +  +G TP+H A  +   K +  L+   A      K+ ++P+H+      L  ++ LL R   V+          +    CG+                      + +HIAC+ +  + ++ LLK GA + +    G+ P+HVA    +   +++L+++    G S     N ++  G  PLH A   G  + V+  L  GA++ V+  ++ TPLH A   G+ +IV+L+L+   +           +G TPL+ A    H ++A  L+E G++I      G+TPL +A+    +EV   LL+  A+   +   Q  L  L  + +  + KV  L+ L+K      +  N     G TPLH + ++  L +  +L++LG            PLH AA+ G       LL    G  A  S  + G L  +H AA+     + ++L     D       CY   TPLH A+  G+I+   +L+  N +L++ +   G T LH AA    +HVV  LL H AS
Sbjct:  208 PLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQN----GASS----NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP-----NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLL-LDKGASPHSTAKN-----GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLL----GRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY---TPLHVASHYGNIKMVNFLLR-NRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 760          

HSP 4 Score: 132.109 bits (331), Expect = 1.538e-31
Identity = 132/486 (27.16%), Postives = 221/486 (45.47%), Query Frame = 1
Query:  349 SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI---SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI 1794
            S+  T    A  N  ++ L   +  G D N  N++ +  +HL   +  +DV+ ELL+  E   +  T  GN+A+HIA      + +  L++ GA + + +  G  P+++A +  + + ++ L+++   +        + + ++G  PL  A+  G  + V + L    K  VR       LH A  K + +   L+L+  H   DV  K    +G TPLH A  + ++ +A  L+  G+ ++ T  NG TPL +AA R N  + K LL  GA I  + +     +H  + +          G EK+ +  +   + I  K   G +PLH +T+   L    +L+           D  TPLH AA  G     + LL   D     N+    G  P+H A +    K++++LL  G   H     G TP+H A+  GH+   Q L++ N +  +  N  G+T LH A+   +  VV  LL  GA +
Sbjct:    9 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKR-EAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQ--------SVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRL----PALHIAARKDDTNAAALLLQHEHNA-DVTSK----SGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARS----------GHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLL---DRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARV 462          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 4.463e-45
Identity = 164/622 (26.37%), Postives = 265/622 (42.60%), Query Frame = 1
Query:  256 GMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPI-----------------------------HLTVYKSKLDVLKELLRH-------PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCN---------------------------------EKCLEMLVE------SKNKKGCSPMQILNFSD----------KEGNV---------PLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI---SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYLIEMNP--SLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLT 1818
            G T +H AA   + +++ VL+ + A+ NA+  NG TP++ A   N ++ + +L+ NGA+ ++  +D   P+                             H+   K   +    LL+H        ++  NQTT  G + +HIA    N      LL  GA V      GI P+HVA K  N                                 EK +EML+E      +K K G SP+ +    +          ++  V         PLH A + G  +  ++ L  G + + R  +  TPLH AC K  + +++L+L+         +     +G TP+H A    H+ + + L++ G++   T+  G TPL +A+    +EV KTLL+ GA +  + +  +  +H+ S           +G  +I Q  +   S  N     G TPL++++R G   +  +L++ G           TPLH A++YGR+     LL  +    + +     G  P+H A    H K+  +LLD+G   H    +G TPLH AA    +E  + L+E+    ++L  Q   G   LH AA    + +V LLL   ASI    K GLT
Sbjct:   76 GNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK-----HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASR----------LGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKY---ASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQ---GVAPLHLAAQEGHADMVALLLGRHASISLATKGGLT 676          

HSP 2 Score: 169.859 bits (429), Expect = 2.737e-43
Identity = 171/626 (27.32%), Postives = 280/626 (44.73%), Query Frame = 1
Query:   94 HMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH-------PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS----LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPV 1932
            H+  + E ++   E+   +   N     AA     +I ++++     I++  +NG T ++ AA  + +E++  L+   A+++    +G TP+  A+     + +  L+    + +   K  +  +H+   K   +    LL+H        ++  NQTT  G + +HIA    N      LL  GA V      GI P+HVA K  N   +++L++   K        ++   ++G  PLH A  +G  K ++M L   A I  +  +  +PLH A     L  V+L+L  +  V DV L        TPLH A    H  +A+ L++ G        NG+TPL +A  +  ++V + LLK+GA+I+   ++    IH+ S    LNVV          + + Q+  S  N  +  G TPLH ++R G L +   L++ G     +  +  TPLH A+R G+    + LL         N+  + G  P++ A+  GH  +  +LL+ G  I      G TPLH A+  G +E    L+E   S  D +   G T LH A   D   V  LLL  GAS     K G T   HI   KN     +V+     E    ++ + G+ P+
Sbjct:   55 HVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL----ESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAK--------IDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYL-----TPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVV----------QLLLQNGAS-SNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSD---PNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYAS-ADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPL-HIAAKKNQLEVGKVLLELGAE--TNMLTQQGVAPL 645          

HSP 3 Score: 145.206 bits (365), Expect = 1.354e-35
Identity = 145/580 (25.00%), Postives = 246/580 (42.41%), Query Frame = 1
Query:  118 MQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEI---------------------------------KALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRT----------------------RHEVKDVVLK------IQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            + L   V   + N   P   AA      + KL++     I +   +G+T +H AA +   +V+++L+   A   A+  NG +P+H A     +                                 +    L+  G +PN    +   P+H+   K+++ V++ LL+H   + + TT  G + IH+A  + +   +  LL+ GA   + NV G  P+H+A +    + ++ L++S  + G           +E   PLH A   G  + VQ+ L  G+  +      STPL++A  +G  D+  L+L                        R EV  ++L+       +  NG TPLH A  ++H ++A  L+++G++   T  NG+TPL +AA +  +EV K LL+ GA      +     +HL +     D V  L+G    + + IS+  +    G T +H + +   + +  IL K      T      TPLH A+ YG +     LL        +N+    G  P+H AA+ GHT ++  LL      +    +GNT L  A   G+I     L
Sbjct:  232 LNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKH-GASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKA--------REDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLG----RHASISLATKG---GLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRN---RALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 4 Score: 140.969 bits (354), Expect = 3.086e-34
Identity = 152/579 (26.25%), Postives = 259/579 (44.73%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELL-RHPEVNR---------NQTTSCGN----------------------SAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRL-PIHAAAENGHTKIIQML----LDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            P   AA    M +  L++     +  +  NG+T +H AA      ++ +L+   A  + +  +G TP+H A  +   K +  L+   A      K+ ++P+H+      L  ++ LL R   V+          +    CG+                      + +HIAC+ +  + ++ LLK GA + +    G+ P+HVA    +   +++L+++    G S     N ++  G  PLH A   G  + V+  L  GA++ V+  ++ TPLH A   G+ +IV+L+L+   +           +G TPL+ A    H ++A  L+E G++I      G+TPL +A+    +EV   LL+  A+   + K     +H+ + +  + KV  L+ L+K      +  N     G TPLH + ++  L +  +L++LG            PLH AA+ G       LL    G  A  S  + G L  +H AA+     + ++L     D       CY   TPLH A+  G+I+   +L+  N +L++ +   G T LH AA    +HVV  LL H AS
Sbjct:  215 PLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQN----GASS----NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDP-----NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVAT-HYDHQKVALLL-LDKGASPHSTAKN-----GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLL----GRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCY---TPLHVASHYGNIKMVNFLLR-NRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 765          

HSP 5 Score: 132.494 bits (332), Expect = 1.397e-31
Identity = 133/490 (27.14%), Postives = 223/490 (45.51%), Query Frame = 1
Query:  349 SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDN----NGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI---SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI 1794
            S+  T    A  N  ++ L   +  G D N  N++ +  +HL   +  +DV+ ELL+  E   +  T  GN+A+HIA      + +  L++ GA + + +  G  P+++A +  + + ++ L+++   +        + + ++G  PL  A+  G  + V + L    K  VR       LH A  K + +   L+L+  H   DV  K+  N    +G TPLH A  + ++ +A  L+  G+ ++ T  NG TPL +AA R N  + K LL  GA I  + +     +H  + +          G EK+ +  +   + I  K   G +PLH +T+   L    +L+           D  TPLH AA  G     + LL   D     N+    G  P+H A +    K++++LL  G   H     G TP+H A+  GH+   Q L++ N +  +  N  G+T LH A+   +  VV  LL  GA +
Sbjct:    8 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKR-EAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQ--------SVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRL----PALHIAARKDDTNAAALLLQHEHNA-DVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARS----------GHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLL---DRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARV 469          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 2.802e-41
Identity = 144/514 (28.02%), Postives = 243/514 (47.28%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            ++G+T +H AA +   +V+++L+   A   A+  NG +P+H A   + ++ +  L+   A  + +  D +  +H+  +       K LL     N N     G + +HIAC+ +    ++ LLK GA + +    G+ P+HV+    N   + +L++     G SP    N ++  G   LH A   G T+ V+  L  GA++D +  +  TPLH A   G+L+IV+L+L  +H           +NG+TPLH A    H ++   L+E G+++ VT   G+TPL +A+    MEV   LL+  A+  A  K     +H+ S +  N KV  L+ L++      +  N     G TPLH + ++  L +   L++ G            PLH  A+ G       LL  +     +N     G  P+H AA+     + ++L+  G   +     G TPL  A   G+I+   +L++     ++++   G T LH AA    +H+V LLL  GA
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDK-GANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG----GASP----NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLL--QHMASP---DAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVAS-HYDNQKVALLL-LDQGASPHATAKN-----GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARY---ADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGAD-VNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGA 492          

HSP 2 Score: 156.762 bits (395), Expect = 7.109e-39
Identity = 136/508 (26.77%), Postives = 224/508 (44.09%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYR---------------------------------ADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYL 1671
            +NG++ +H A     +E + VLM YR                                 A+ N R  NG TP+H A   N I+ +  L+  GA    + +  + P+H++ +   L+++  LL+    + N T   G +A+H+A      E +  LL+ GA V +       P+H+A +    + +++L++         M   + +   G  PLH A   G      + L +GA + V      TPLH A   G++++  L+L+ R    D   K    NG TPLH A  +++ ++A  L+++G++   T  NG+TPL +AA +  +E+  TLL+YGA   A  +     +HL +     D  + L+       +  + +N     G +PLH + +   + +  IL+K G           TPL  A  YG +     LL        +NS    G  P+H AA+ GHT I+ +LL  G   +    +GNT L  A   G+I     L
Sbjct:   37 KNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG-GASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQH--------MASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQ-RFASPDAAGK----NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLL-------ARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHG---ADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 3 Score: 134.42 bits (337), Expect = 6.215e-32
Identity = 95/387 (24.55%), Postives = 176/387 (45.48%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE------SKNKKGCSPMQILNFSD-------------------KEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLM 1251
            P   A   N + + +L++     I +  E+G+T MH +A    + ++ +L+   A  NA +  G T +H A    + + +  L+ NGA  +   ++   P+H+     KL++++ LL+H   + +  TS G + +H+A    +++    LL+ GA +      G  P+HVA KY   +   +L++      +  K G +P+ + +  D                   K G  PLH A      +     L YGA+ +        PLH    +G  D+  L+L    +V          +G +PLH A   + V +AE L++ G+++  T   G+TPL++A    N+++   LL++GA++ ++ K     +H  +       VN L+
Sbjct:  108 PLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQH-MASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHAT-----KSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 4 Score: 127.487 bits (319), Expect = 7.635e-30
Identity = 104/341 (30.50%), Postives = 164/341 (48.09%), Query Frame = 1
Query:  772 KEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            ++G  PLH A  +G  + V++ L  GA I  +  +  +PLH A     ++ V+++++ R  V D+ L        T LH A    H   A+ L+++G+N  V   NG+TPL +A  +  + V + LLKYGA+I A  ++    +H   ++     +N ++ L +   S     N  +  G T LH + R G   +   L++ G     +  ++ TPLH AAR G++   + LL     M + ++  S G  P+H AA  GH  +  +LL+ G         G TPLH A+  G +E    L++   S  D     G T LH A+  D   V  LLL  GAS
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYL-----TALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMH---VSAFMGNLNIVLILLQGGAS----PNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQH---MASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFAS-PDAAGKNGLTPLHVASHYDNQKVALLLLDQGAS 328          

HSP 5 Score: 96.2857 bits (238), Expect = 3.175e-20
Identity = 78/301 (25.91%), Postives = 136/301 (45.18%), Query Frame = 1
Query:  148 SDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYL 1050
            + N   P   AA     ++  +++ +   ++ + + G T +H A+   ++EV  +L+   A  +A   NG TP+H A   +  K    L+  GA P+   K+   P+H+   K +L++   LL +     N  T  G + +H+  +  + +    LL   A V      G+ P+H+A +       E+LV    K G      +N + K G  PL  A + G+ K V   L +GA ++ +  +  TPLH A  +G   IV L+L+      DV +     NG+T L  A    ++ + + L
Sbjct:  234 TSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEY-GAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV----KHGAH----VNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTV-----NGNTALAIARRLGYISVVDTL 520          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 2.207e-39
Identity = 160/591 (27.07%), Postives = 245/591 (41.46%), Query Frame = 1
Query:  154 NPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEK-CLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKG-ELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELA------------------EYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXX-----------------XXXXXCMT-----------QNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGN--TPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLL 1776
            N   P   AAA   ++  + II      + SD  G T +H+AA N   E+++ L+   A+ NA D      IH A      + +  L+ +GAD    +K   +P+H      ++ V+K LL    V+ +   S GN+A+H+AC       ++ L+  GA V   N  G  P+H A    +   CLE+LV +           +N   K+G  PLH     G     Q  +  G +ID    D +TPLH A   G EL I  L+       K  +      +G  PLH A +    +                    E+++  G  I+  D+ G T L  AAS  N+E    LL  GA++  +D+ +R  +H  + N     V  L+       +  + +NE+D   CTPLHY+        T                         +C+            Q+    TP+H+AA YG    C  LL    G    +        P+H AA +GH   +++L+ R  +      GN  TPL  AA  GH +  + LI+   S+L  +  + +TALH+AA N     + LL+
Sbjct:  104 NWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVK-LLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGAD--------VNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGI------HGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLV-------ASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGH-RVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLI-RSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLV 670          

HSP 2 Score: 143.665 bits (361), Expect = 6.506e-35
Identity = 139/524 (26.53%), Postives = 231/524 (44.08%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE------SKNKKG--CSPMQI-------------------LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQN-DNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALH 1731
            DE G T +H AA+   +E +++L+   AD N +D    T +H+A  N  ++ +  L+ +GA  N  ++    P+H   Y +  D     +     N     S  +  +H  C  + Q  L+ LL+  A     +  G  PVH A  Y +  CLE+L+E      S  K G   SP+ +                   L+  +  G  PL  A   G T  V++ + +GA + +++  D  T LH A T G ++ ++L++      + V     D N  TP+  AV   H + A  L+ +G++I   D+ G T L   A+  + E    LL+   ++  R++  R  +H+ +       +  L  L +   +  + I   D  G TPLH++   G      +L++L      Q  +  +PLH A           L++TF G K +N  D+ GR+P+HAAA   H + +Q+LL    + +     G +PL  A  NG     + L+    + L  Q+    TALH
Sbjct:  418 DEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLH---YAAAADGDGSTVSFSVYNTISVQSYID--VHSTCS-EAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAV--DASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAA---ACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVF-QKQEGNAFSPLHCAVLNDNESCAEMLIDTF-GAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALH 928          

HSP 3 Score: 140.198 bits (352), Expect = 8.367e-34
Identity = 150/618 (24.27%), Postives = 255/618 (41.26%), Query Frame = 1
Query:  166 PFQFAAAGN----CMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPE-----------------VNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVES------KNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKA----------VQMCLHYGAKID----VRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGH--TPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKT-QRNLIHLFSLNV----------------------VNDKVNFLMGLEKIQQSFISI-------INEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKA-MNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGN--TPLHYAATNGHIETCQYLIE-MNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            P  FAAA      C+E   L++ N   ++   ++G + +H  A + R      L+    + +  D +GNTP+H A        +  LI NGAD        M P+HL       D  ++LL   +                    +     G + +H A    N E L+ LL  GA +   + +    +H A   CN +C+  LV S      ++++ C+P+     +D +G+    +  NT   ++           Q+CL +  + D    ++     TP+HYA   G    ++L+L      +    +    +GH  +PLH A    H    E LI    +++V + NG+TPL LAA R + +  + L+++GA++  ++   +R  +H  + N                        N++   ++ +        S+       IN KDN GCT LH     G      +L++       +      PLH AA  G +     L+       A +  TD  G  P+H A  NGH   +++LL+   +F +   GN  +PLH A  N +    + LI+     +++  + +G+  LH AA  D    + LLL+H A
Sbjct:  273 PLHFAAASTHGALCLE---LLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLE-----QPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELD-VFQK-QEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNA 880          

HSP 4 Score: 119.013 bits (297), Expect = 2.656e-27
Identity = 137/508 (26.97%), Postives = 224/508 (44.09%), Query Frame = 1
Query:  316 MIYRADK-NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNV---YGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNN--GHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPL-LLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMK-----------------AMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC------IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAIND 1749
            +IY+ ++ NA D    TP+H A    E + +  L+L+GA  N  +   + P+H          ++ LL+H   + N       + +H+A       A+ C      ++ S NV    G   +H A    + + +  LV     KG +    +N  DK+    +H A   G T+ V++ + +GA +  +     +PLH A + G++ +VKL+L       D+ + I D N  G+T LH A       +   LI+ G+N+   ++ G+TPL   AAS       + L+  GA++  + K  ++ +H+ +++       F      IQ      I+ +D  G TPLH + R G   L   LI  G     +      PLH AA  G    CR+LL+   G K                  +++ D FGR  +HAAA  G+ + + +LL  G        F R     T LHYAA N +++ C   +  + + L+ Q+    T LH AA  D
Sbjct:   25 LIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKH-SADVNARDKNWQTPLHVAAA---NRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLV----AKGAN----INAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLL-------DLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVH-----GRFTRSQTLIQNG--GEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSA--GQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFER-----TALHYAAANCNVQ-CVVTLVASGARLNEQDERRCTPLHYAAAAD 498          

HSP 5 Score: 112.079 bits (279), Expect = 3.612e-25
Identity = 113/469 (24.09%), Postives = 192/469 (40.94%), Query Frame = 1
Query:  454 NMAPIHLTVYKSKLDVLKELL-RHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCM-TQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSL-----------------LDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFK 1800
            + AP+   ++    D ++ L+ +  EVN         + +H A  +   E ++ L+ +GA V S +   + P+H A    +E  ++ L++            +N  DK    PLH A      K  +  +   +  +V      T LH+A   G  ++V  ++      K   +   D      +H A    H E+ + L+  G+++   D  G++PL  A+S   + V K LL  G +I   +      +H+   N  +  VN L+          + +N+ +  G TPLH++       L   L+   G  +  Q+ D  +PLH  A +GR    + L+        ++  D  G  P+H AA  GH  +I  L+  G     R  HG  PLH AA +G  + C+ L+                       +D  +  G+T LH AA       + LLL+ GA + K
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEK--RTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSAD--------VNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLV-----AKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCG-------ANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNG---GEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNK 449          

HSP 6 Score: 103.99 bits (258), Expect = 1.088e-22
Identity = 87/347 (25.07%), Postives = 170/347 (48.99%), Query Frame = 1
Query:  784 VPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLT 1818
             PL  A+  GD   V+  ++   +++   ++  TPLH A   GE +I++L++ +   V       +DN   TPLH+A         + L++  +++   D N  TPL +AA+   ++  + ++   ++    D+  R  +H  + N  ++ VNFL+     + + I+  ++KD      +H++   G   +  +L+  G     ++    +PLH A+  G++   + LL+   G+  ++  +SFG   +H A  NG   ++  L+D G   ++    G TPLH+AA + H   C  L+  N + ++ Q+ +GK+ LH  A++ +      L+ +G  I  +D+ G T
Sbjct:    8 APLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNS-----KDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVA----KGANINAFDKKDRRA---IHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDL--GVD-IDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNT 339          

HSP 7 Score: 103.605 bits (257), Expect = 1.404e-22
Identity = 128/553 (23.15%), Postives = 230/553 (41.59%), Query Frame = 1
Query:   70 SEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGN---CMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNK---DNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDC---LLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGD----TKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEE-GSNI-EVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISII--NEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLI 1674
            SE ++   H++  D +  + D+          P  +AAA     C+E+  L    +        + ++ +H AA +     ++VL+    D + R+ NG TP+  A L      +  LI +GA  ++L K   D    +H       ++ L+ L+ + + N     S  N    +   + N    DC   LL  GA + + +  G   +H      +E+C+++L++            ++  ++ G  PLH A   G     +  VQ  +  GA I +   +  TPLH+AC  G    V+L+L         V + Q+ N  +PLH AV+ ++   AE LI+  G+ I    D  G  PL  AA   ++E  + LL + A              L ++  +  K   +M  E  Q + + ++  + K ++                             Q+ +++T LH A           +L+  D +  +N+T++  + P+H AA +G   ++Q+LL++G  I    ++G TP    A N  +  C  LI
Sbjct:  525 SEAQICLEHLLRKDADPGIQDK------QGYTPVHYAAAYGHRVCLEL-LLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGA--SVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHT-DCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVD--------VSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELD------VFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNA--------------LVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDL---------------------------KLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTPALSCAPNKSVAECLSLI 1012          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 64.6994 bits (156), Expect = 6.808e-11
Identity = 47/123 (38.21%), Postives = 67/123 (54.47%), Query Frame = 1
Query:  865 RQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGS--NIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVV 1227
            R +   T L  AC KG+ D+VK M+    E     +  QDN G+T LH+A +  H+E+ E LIE G+  NI+  +  G TPL+ A++  +++V K LLK GA     D T RN   L +   V
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMI----EEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGA-----DPTIRNAKGLTAFESV 439          

HSP 2 Score: 50.447 bits (119), Expect = 1.574e-6
Identity = 32/112 (28.57%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 1414 TPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC---IFHRCYHGNTPLHYAATNGHIETCQYLIE--MNPSLLDNQNHEGKTALHN 1734
            T L  A   G+    ++++   +G   +N  D+ G   +H AA  GH +I+++L++ G    I      G+TPL  A+ NGH++  +YL++   +P++   +N +G TA  +
Sbjct:  332 TRLQIACDKGKYDVVKKMIE--EGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTI---RNAKGLTAFES 438          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 63.929 bits (154), Expect = 1.211e-10
Identity = 67/272 (24.63%), Postives = 117/272 (43.01%), Query Frame = 1
Query:  268 MHYAAANSRIEVMDVLMIYR--ADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNT-GDTKAVQMCLHYGAKI-DVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNI 1071
            +HYAA   ++E +  L+I     D +  DS+  TP+  A+ NN I  +  L+  G         N +PI     K  LD  K ++         +T      +++AC+ +N +A   LL+  +   + N                        +KNK      Q L   +  G   LH      GD + +Q+ + YGA   ++   +  TP+ YA   G  +++  +L  +H  +   L I+D+NGH+PL  A+  +HV++   L++   N+
Sbjct:  428 LHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGG-------ANASPIE----KPILDYSKNVI--------SSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADN------------------------AKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELL--KHNAR---LDIEDDNGHSPLFYALWESHVDVLNALLQRPLNL 651          

HSP 2 Score: 56.6102 bits (135), Expect = 2.576e-8
Identity = 69/286 (24.13%), Postives = 123/286 (43.01%), Query Frame = 1
Query:  337 NARDSNGNTPIHHAVLNNEIKALTYL-------ILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMC-LHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANI 1170
            NA+D +   P+H+A    E+  L ++       +L   DP  ++ D+  P+ L +  + +DV+++LL          T  G +A  I   I         L     V S       P++VA K+ N    ++L+E ++K+     +  N S +    PL    +TG      +C LH  AKI                 G+  +++L++R   +  +    I   N  TP+  AV   H E+   L++  + +++ DDNG +PL  A    +++V   LL+   N+
Sbjct:  418 NAQDIHSRVPLHYAA---ELGKLEFVHSLLITNLLEDVDP--IDSDSKTPLVLAITNNHIDVVRDLL----------TIGGANASPIEKPI---------LDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAK--NKSSQHLCQPLFKKNSTG------LCTLHIVAKIG----------------GDPQLIQLLIRYGADPNE----IDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNL 651          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 55.0694 bits (131), Expect = 1.382e-8
Identity = 49/170 (28.82%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  661 YPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKI---DVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYG 1161
            YP+H A        ++ L+ SK      P  +L   D++G +PLH +V+    +     L     +   D   +   TP H AC+ G L++VK +      +K  + KI  N G T LH AV     E++++LIE G+++ + D     PL  AAS  ++++ + L   G
Sbjct:    4 YPLHQACMENEFFKVQELLHSK------PSLLLQ-KDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYD--RPLKPDLNKIT-NQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLG 163          

HSP 2 Score: 54.299 bits (129), Expect = 2.367e-8
Identity = 52/214 (24.30%), Postives = 87/214 (40.65%), Query Frame = 1
Query:  463 PIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGA---LVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEE-GSNIEVTDDNG 1092
            P+H    +++   ++ELL        Q    G   +H +      E    LL       L   P+  G  P H+A    N + ++ L +   K        LN    +G   LH AV     +  Q  +  GA + ++   N  PLH A + G L +++L+      +    +  QD  G TPL  A+   H + A  L+E+ G+  ++ D+ G
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPD------LNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCG----LGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          

HSP 3 Score: 51.6026 bits (122), Expect = 2.002e-7
Identity = 46/185 (24.86%), Postives = 83/185 (44.86%), Query Frame = 1
Query:  343 RDSNGNTPIHHAVLNNEIKALTYLILNGADPNI---LNKDNMAPIHLTVYKSKLDVLKELLRHP-EVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTG-DTKAVQMCLHYGAKIDVRQNDNS 882
            +D +G  P+H +V     +  ++L+    + N+    +     P H+      L+V+K L   P + + N+ T+ G + +H+A      E    L++ GA V   + +   P+H A    + K +E+L       G     + N+ DK+G  PL  A+  G    AV +   YGA+ D+  N  +
Sbjct:   32 KDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLC------GLGKSAV-NWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGA 209          

HSP 4 Score: 49.6766 bits (117), Expect = 8.118e-7
Identity = 41/154 (26.62%), Postives = 67/154 (43.51%), Query Frame = 1
Query: 1390 MTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC---IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI--FKDKQGLTFFTHIL 1836
            + ++ D   PLH++  +        LL+  + +   +  D  G  P H A   G+ ++++ L DR     +      G T LH A      E  Q+LIE N + +  ++   +  LH AA      ++ LL   G S   ++DKQG T   H L
Sbjct:   30 LQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIE-NGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHAL 182          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 53.9138 bits (128), Expect = 1.512e-7
Identity = 41/159 (25.79%), Postives = 76/159 (47.80%), Query Frame = 1
Query:  259 MTMMHYAAANSRIEVMDVLMIYRADKNARDSNGN-TPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSK----LDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE 720
            +T +H+A+ N+R+ V+D L+   AD NAR    + TP+H A     +  + +L+ +GADP + +      +HL+V  S     L VL  ++    ++ +     G +++  A    +   +  LLK GA +   +  G  P+H          L+ L++
Sbjct:  110 ITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQ 268          

HSP 2 Score: 51.6026 bits (122), Expect = 6.261e-7
Identity = 53/216 (24.54%), Postives = 89/216 (41.20%), Query Frame = 1
Query:  469 HLTVYKSKLDVLKELL--RHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALV-CSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAK-----IDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNG 1092
            H    +  L  +KE++  +  EVN +  ++   + +H A   +    +D L+  GA V          P+H A +Y     ++ L+    K G  P      +D +G   LH +VN+ +   V   L          ID R     T L +A  +G+   V  +L+    +K     I D  G TPLH   +     + +YLI++G++     D G
Sbjct:   78 HTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLL----KHGADP----TMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIK-----IADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTG 280          

HSP 3 Score: 50.8322 bits (120), Expect = 1.323e-6
Identity = 50/189 (26.46%), Postives = 85/189 (44.97%), Query Frame = 1
Query:  793 HTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTP----LHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNME-----VFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYS 1332
            HTA   GD   V+  +H G  ++V  + +ST     LH+A     L +V  ++    +V      +      TPLH A  + +V + ++L++ G++  +TDD G+  L L+ +  N+      +F  + K   +I  RD   R      SL     + + L   E ++  F + I   D  G TPLH+ 
Sbjct:   78 HTACQRGDLATVKEMIH-GKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALH----ATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRT-----SLLWAAYQGDSLTVAELLK--FGASIKIADTEGFTPLHWG 254          

HSP 4 Score: 48.521 bits (114), Expect = 6.064e-6
Identity = 43/194 (22.16%), Postives = 76/194 (39.18%), Query Frame = 1
Query:  361 TPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLR 942
            T +H A +NN +  + +L+  GAD N         +H T                              +H A        +D LLK GA     +  G   +H+++   N   +  ++ +   KG   +  ++  D +G   L  A   GD+  V   L +GA I +   +  TPLH+   KG+  ++K +++
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNA----RAGALHAT-----------------------------PLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKG---LLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQ 268          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Nematostella
Match: EDO33180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST04])

HSP 1 Score: 124.79 bits (312), Expect = 2.745e-29
Identity = 142/566 (25.09%), Postives = 259/566 (45.76%), Query Frame = 1
Query: 1609 HGNTPLHYAATNGHIETCQYLIEMNPSLL-DNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFK----DKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIML-LYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDI--NHT-----TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFK---------------------APTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEV----FPYRCPTYK 3192
             G T LH+AA  G + + Q +   NP+ + D  N +  T+LH AA N  S VV  LL+           ++ GL      ++    N    +  + RW E+   V+E G+  +  ++  MP+     +D+ ++  G+   +D+ + ++F  LQ     ++D        + TMV   R++ L H +  A + +KW   G W  Y++ L  Y+IFL  L+    ++T    + ++ N+        IDI       K  ++VM       S+ +L+KE   I+ +   Y     N+M   L+++S++   Y+I+ ++  NH      T  +AA  IF+ W   +L L  F   G+++IM   I+ T++ ++ +F    I F   F +L K                     AP S+   +  P   Q  Q  +  +      ++ ELP  L    ++++GE+++ +T            +  P ++YI  ++F + M +++ NLLIGL+VGD+  + + A +++ ++QV  L E E   P ++     ++IW      FP R  T+K
Sbjct:   17 EGRTALHFAAAKGSLRSVQLICMANPNCINDEDNADQDTSLHLAAKNGHSEVVDFLLSDPNQKITYNGYNQNGLDV---AIEAGRENVVMVIANHTRWREMCHRVEE-GLTQLQHLVIKMPSAAEKFLDRCVEECGAGKDEDYSVTFDFMFLQGMPDIRKDDPKKFLDCLHTMVKYKRVNCLSHQVCGAIMNIKWRSVG-WKAYVMNLTFYLIFLLLLT----SMTIMLDARIEDNLV-------IDI------PKYTIIVM-------SLFHLLKELFQIWDEKFKYLLKADNWMEWFLYMSSLV---YMIQYEVFDNHVSVTGETRPLAATAIFIAWVIFVLYLRRFSTFGIYIIMMTNIIKTLIKIIILFIPFVIAFGIPFFLLLKKDYYEDSDTTTSSTNTNNNITAPNSTNSTAAAP---QTAQRKTDTQF-----LFDELPYSLFTTFMLILGEMKYPHTVY------KYQPIPNPWISYIIYIIFCVCMPIIIKNLLIGLSVGDVNRILQTAKMEQHAMQVELLLELERATPRRV----LRKIWVAYFVDFPNRNKTWK 532          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Nematostella
Match: EDO27354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9H1])

HSP 1 Score: 107.071 bits (266), Expect = 6.598e-24
Identity = 124/546 (22.71%), Postives = 243/546 (44.51%), Query Frame = 1
Query: 1393 TQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAE-NGHTKIIQMLLD--RGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSI-KTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAIT---FTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTT----MQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEF--------LNTYVTPLYDGNVYTLHYPTLTYI 2967
            T+  + +TP   A +Y +      LL     +KA N    F    +H A   +   + +++LLD   G + + R     TPLH AA  G  E+   L+  N ++ D ++   +   +   +N    +V L L  GA +  ++K   T     +  K    AK ++ ++RW EV+   +  G  P++G+I+ +P++  LA+D+ I +       +D+ + ++  +L      +   + D     + MV+ +  +LL HP++   L+ KW  FG+   Y+ +++++IF+  + F+ + IT    + L H     +++ E   +      E    +   + ++ + ++ +  +KE + IF   L YF    N + LVL+  +II  S  +  +  +T          VT+FL + N+LL +      GL+V M+ ++  + L V+ +F ++ +G    + +L K          +  F+  + A+                   ++  VMM+GEI++        +N  V P        L  P +TY+
Sbjct:   32 TRGFENNTPFLLAVKYDKTQAAAELLKRGADIKAKNL---FFLSSLHLAVSLHKDCETLKLLLDWDDGSLLNARDLDLQTPLHVAAARGSPESINLLLGKNCTI-DAKDANDQYPFYIVEVN----IVKLCLAEGADVTXRNKDDKTCLDVAIDWKRTEVAKVLIQHDRWWEVICTRNSAGELPMVGLIEALPDVAKLALDQCIVRCPLPTSHQDYCLTFHTVLLDPGPCKEGQTSRD---ASEVMVENDCEELLSHPVTQGLLRYKWFAFGKVPYYIYLMVFLIFV--ILFSYFIITERDSSTLYHPTHPNASALEKQYL------EKRPSSTNSITIVLILFATIEFLKEFYQIFMIRLDYFKDITNLVELVLYTCAIIFISPYLAEEPLYTAAYGHWNAGVVTLFLAYLNVLLYIKGIGSSGLYVTMYFEVWYSFLKVITVFLVVLLGSTLVYYLLLK---------EEDDFSGVHYAF-------------------VRTFVMMVGEIDYTGVLSSNVINKEVNPATGAPYVPL--PPVTYV 528          

HSP 2 Score: 50.8322 bits (120), Expect = 2.951e-6
Identity = 45/174 (25.86%), Postives = 84/174 (48.28%), Query Frame = 1
Query:  559 NSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNE-KCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEV 1077
            N+   +A + D  +A   LLK GA + + N++ +  +H+A+    + + L++L++  +        +LN  D +   PLH A   G  +++ + L     ID +  ++  P +      E++IVKL L    E  DV  + +D+   T L  A+ +   E+A+ LI+     EV
Sbjct:   38 NTPFLLAVKYDKTQAAAELLKRGADIKAKNLFFLSSLHLAVSLHKDCETLKLLLDWDDG------SLLNARDLDLQTPLHVAAARGSPESINLLLGKNCTIDAKDANDQYPFYIV----EVNIVKLCLA---EGADVTXRNKDDK--TCLDVAIDWKRTEVAKVLIQHDRWWEV 196          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 79.337 bits (194), Expect = 7.017e-16
Identity = 71/227 (31.28%), Postives = 114/227 (50.22%), Query Frame = 1
Query:  796 TAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI--SIINE-KDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRL 1467
            +AV++GD   V+  L  GA I+ +  D  T LH AC     D+VK+++      K   + ++DN G T LH A     VE+A+YLIE G+++   ++ G  PL LA    +ME   T           D+ +   I +     V +K+     +    QS++  + INE KD    + LH ++ +G L++ G+L++LG     ++ D  TPLH AA +G+   C  L
Sbjct:   55 SAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVD-----KGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE-DMEDLLT-----------DEIENQGIDVDDARAVEEKI-----MLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELL 259          

HSP 2 Score: 65.855 bits (159), Expect = 1.940e-11
Identity = 60/236 (25.42%), Postives = 112/236 (47.46%), Query Frame = 1
Query:  898 ACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKD--TPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH 1599
            A + G++D VK +L      K   +  Q+ +G T LH+A +  + +L + L+++G++++V D+ GWT L  AAS  ++E+ K L++ GA++ A                VN++    + L + +     + +E +N G            + L      L   C+ ++ DK   + LH A+  G +     LL    G++ +N+ D+    P+HAAA  G     ++L + G  F+
Sbjct:   56 AVSSGDVDEVKKLL-----AKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAA----------------VNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQL--GVE-INAKDADNWTPLHAAAHWGQKDACELLSENGADFN 267          

HSP 3 Score: 61.2326 bits (147), Expect = 5.945e-10
Identity = 53/228 (23.25%), Postives = 96/228 (42.11%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLM 936
            +G+T +H A  +   +++ VL+   A  + RD+ G T +H A     ++   YLI NGAD   +N +   P+ L   +   D+L + + +  +                 ++D+  A++  +                ++ A  + N+ C+    ESK+K   S               LH A + G  K + + L  G +I+ +  DN TPLH A   G+ D  +L+
Sbjct:   81 DGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGI-----------------DVDDARAVEEKIM---------------LNDAQSWLNKNCIN---ESKDKTEASA--------------LHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELL 259          

HSP 4 Score: 52.373 bits (124), Expect = 4.431e-7
Identity = 53/212 (25.00%), Postives = 89/212 (41.98%), Query Frame = 1
Query:  613 LLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIV-------------------KLMLRTRHEV--KDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDK 1185
            LL  GA +   NV G+  +H A    N   +++LV+    KG S    ++  D EG   LH A + G  +  +  +  GA +    N+   PL  A  +   D++                   K+ML        K+ + + +D    + LH A    ++++   L++ G  I   D + WTPL  AA     +  + L + GA+  AR+K
Sbjct:   68 LLAKGADINYQNVDGLTALHQACIDENFDLVKVLVD----KGAS----MDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Nematostella
Match: EDO39289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAJ4])

HSP 1 Score: 81.2629 bits (199), Expect = 1.174e-15
Identity = 107/510 (20.98%), Postives = 208/510 (40.78%), Query Frame = 1
Query: 1414 TPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC--YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIY--------NFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRW---VQYLIMLLYIIFLSALS----FNTYAITFTALSH-----VDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHP---------------IFTKTLAYFTSFQNYMTLVLH--ITSIILSSYIIRMDINHTTMQ-----VAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAF----SFVILFKAPTSSEILSNQPMFNQCYQAY 2799
            T LH  AR       + +L   +G K +N +DS+GR P+H AA   + ++++ L   G    +       TP HYAA N   ++ + LI++  ++ D++++ G+T L  AA  D+S     L+  G +                                     + D +G C +  MI  MP +   A+D+   T+ +  ++ + + Y          G   RT              ++ +V   +MDL+MHP+    + +KW +FGR    +Q ++ L Y++  +AL+    F   +  +   S      V + I  S     I   +    + K+          + +   ++  HP               I    ++YF    NY   + +  +T+++L+  +  + +N+   Q     V+AV I   W  L+  +  F  +G F++M   I++  L     F++L+  F F    +F I+F    ++ I+  +   +  ++++
Sbjct:   44 TILHEVARIWHPDVAKFILE--NGGK-VNVSDSYGRTPLHVAAAVDYPEMVEFLFQNGGKHRKLDQIQQQTPTHYAAKNDATKSLKVLIKLGGNM-DDRDYNGRTPLQVAAELDRSETAKFLIDQGTA-----------------------------------AGVQDTSGNCSLSIMISKMPPVAKEALDQFHTTDRANRKQYYYLNYLEPDLPENGHGCYARTP-------------LQCVVLFKQMDLIMHPVFQRLIAIKWSKFGRQGVILQLIVQLFYVLVWTALAVTLHFGEESKYYFPPSKYWWRIVMETIVVSMTFYFIVQEFWELRSSKSAHYKWKRWRIHKLEKDLQYCHPRWPEERKYLEMELREIADSGISYFNDAWNYFDWITYGWVTAMVLTRGLA-VGMNNAASQSLHPKVSAVGIIFIWLRLMKSVRAFATLGPFIVMIGHIIDDTLK----FAVLYFAFYFPYICAFWIIFGGAKNAAIMKAKGQSSDGWESF 496          

HSP 2 Score: 59.6918 bits (143), Expect = 5.867e-9
Identity = 43/164 (26.22%), Postives = 73/164 (44.51%), Query Frame = 1
Query:  604 LDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAK-IDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNG 1092
            L+ L++ GA V   + +G   +H   +  +    + ++E+  K        +N SD  G  PLH A      + V+     G K   + Q    TP HYA        +K++++    + D     +D NG TPL  A   +  E A++LI++G+   V D +G
Sbjct:   25 LEELIQDGADVNFSDRHGQTILHEVARIWHPDVAKFILENGGK--------VNVSDSYGRTPLHVAAAVDYPEMVEFLFQNGGKHRKLDQIQQQTPTHYAAKNDATKSLKVLIKLGGNMDD-----RDYNGRTPLQVAAELDRSETAKFLIDQGTAAGVQDTSG 175          

HSP 3 Score: 56.225 bits (134), Expect = 6.426e-8
Identity = 39/144 (27.08%), Postives = 63/144 (43.75%), Query Frame = 1
Query:  757 LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKT 1188
            +NFSD+ G   LH           +  L  G K++V  +   TPLH A      ++V+ + +   + +    K+      TP H A   +  +  + LI+ G N++  D NG TPL +AA     E  K L+  G     +D +
Sbjct:   35 VNFSDRHGQTILHEVARIWHPDVAKFILENGGKVNVSDSYGRTPLHVAAAVDYPEMVEFLFQNGGKHR----KLDQIQQQTPTHYAAKNDATKSLKVLIKLGGNMDDRDYNGRTPLQVAAELDRSETAKFLIDQGTAAGVQDTS 174          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 78.9518 bits (193), Expect = 4.345e-15
Identity = 73/289 (25.26%), Postives = 123/289 (42.56%), Query Frame = 1
Query:  322 YRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSC----------GNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKY 1158
            +RA    RD + +TP+  A   N +  +  L+ +GAD    + ++   +     +  ++ L+  L H    +   T C          G++ + +   I +Q  LD     GA + S N   I P+H A K+   + +  L++           I+N  D   N PLH A   G    V+  L+ G  ID R     TPL  A  +G +++  ++L      +D  +   D    TPLH A    HVE+ + L+   +NI +TD  G   L +A    + EV   ++ +
Sbjct:  169 FRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEH---QKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLD----NGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDP-------AIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLD-----EDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 2 Score: 75.8702 bits (185), Expect = 3.593e-14
Identity = 120/553 (21.70%), Postives = 208/553 (37.61%), Query Frame = 1
Query:  361 TPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCG---------NSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMC--LHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFI----SIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDR-GCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENG---ICPVIGMIKDMPN 1959
            TP+H A  +  I     L+  GAD   L+++ M P+H    +  L V K L    E+    +T             +A+H+A E  + +     L+ GA V +         H  I    E C+ ++++       S ++ L+F   E  +     +   D   + +C  + + A I+ R  D  TPL  A  K                                      NHV+    L++ G++I   D N    +  AA+   ME  +  L++   ++        +     LN +    N L+ + +I    +    + I+ K++   TP+HY+                                 A++GRV T   LL     +  +N  D     P+H AA +GH  +++ LL R G I  R     TPL  AA  G +E    L++ +   +D  +    T LH A+      +V LLL+  A+I   D  G       ++  +   A  ++ +  W++ +R   + G     P+  +IK +P 
Sbjct:    6 TPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARE-CIFVMIKV------SKLKYLSFCKSE-KIKREILLYFFDV-VIIICYIIRFRACIECRDKDKDTPLMIAAEK--------------------------------------NHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVW-------TICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYA---------------------------------AKFGRVRTVCALLKRDPAI--INDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAP-VDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDHVDWKQAMRNRCKLGNAITSPMRKLIKKLPG 468          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Medaka
Match: trpa1b (transient receptor potential cation channel subfamily A member 1 [Source:NCBI gene;Acc:101174541])

HSP 1 Score: 476.863 bits (1226), Expect = 2.227e-148
Identity = 351/1103 (31.82%), Postives = 561/1103 (50.86%), Query Frame = 1
Query:  172 QFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADK--NARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKI------QQSFISIINEKDNMGCTPLHYSXXXXX--XXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIV--DENGICPVIGMIKDMPNILSLAMDKSIK-TEGSRGQKDFKIIYNFGILQRTVA----SKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSN-IDIFYGHETAKKAV-LVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTT---MQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYR-CP----TYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNII 3399
            + A  G+   +E L+  +  ++S  DE G + +H+AAA   + ++  ++     K  N  D  GN P+H AV  N+ ++   L+  GADPN+LN   ++P+HL V   + D++K LL +   + N     GN+ + +AC I+N EAL  LLK GA +C  N  G +P+H A     +K +E+++++  + G      +N+ DK  + PLH AV  G+ +A+++C+  GAKID +QND STPLH ACT+G  ++VKLML T  +V+D +  + D    TPLH+A +F+H ELAEYLI  G+++   D  G TPLLLA S    +    LL  GAN+  +DK   N +HL         ++   GL+ I      + S  ++++ +DN GCTPLHY+ R G+       + +        ++ DK + LHFAA+YGR++TC+RLL T    + +N  D  G  P+H A++ GHTK++Q+LL +G +FH  Y G + LH+AA+ G+ +T   L+  N  LLD  + +G TALH AA       V L+L  GA +  +K   +F    ++    +    VV ++R EE +++     +  CP++ MI+ +P      +D  ++ ++      D+ I YNF  LQ  ++    S E L   P   V  MV  NR++LL HP+   YL MKW  +G     L M     FL  L          +L        T     N + + +  +T  K+  +VM +I   YSI    KE   +  +   YF    N+      + S++   +II + IN       Q  A+ +   W   LL L  FE +G+FV+MF +I+ T++ ++ +F  L + F+ +F  L              M NQ                ++ +P  +++  VMM+GE+ + N  +          L +  LTY   + F++ M +LL+NL+IGLAVGDI  VQ+NA+LKRI++Q+   +  E KLP        K    ++P R C     T+     E +         +S++   +   L   + ++  +     +Q  LLKLI++KME+  EA+  D  +
Sbjct:   32 ELAEKGDLAHLENLVRKSPEVLSEKDECGASPLHHAAAGGHVTLIQFIITVLDPKELNCSDDQGNVPLHWAVERNKPESCRALLDLGADPNVLNTALLSPLHLAVSLRQNDLMKLLLSYNATDCNLQGDLGNTPLMMACSINNCEALTILLKHGAKLCQQNKLGHFPMHAAAFAGAKKAMEVILKAGEEHGHPAAVHINYLDKSNSSPLHLAVRGGNIEAIRLCIATGAKIDQQQNDRSTPLHLACTQGATEVVKLMLSTVDQVEDFI-NLTDGACQTPLHRATIFDHSELAEYLISLGADLNSCDCKGNTPLLLATSCGAWKCVALLLSKGANVNLKDKCGCNFLHL--------AIHQPKGLKNIPEEVLQRNSVKALLSCEDNEGCTPLHYACRLGIHDSVKNMLGLSGQLGLACKSKDKKSALHFAAQYGRINTCQRLLETITDSRLLNEGDERGLTPLHLASKEGHTKVVQLLLRKGALFHSDYKGWSCLHHAASEGYTQTMAILLSANLKLLDKTDEDGNTALHIAARAGHVAAVRLMLVKGAELVLNKNHTSFLHEAVQNGRKDVVNAVVDSDRCEEALQLFTPGTSQRCPILDMIEFLPETYKHLLDCCVRESDDDHNSPDYHIEYNFQWLQAPISPQKLSDESLKIQPLVAVNAMVKYNRIELLNHPVCKKYLAMKWVAYGSKAHALNM-----FLYLLGLLPLTHLIVSLRPSMNTTDTGDHVINMVPVSFTEQTVFKSFSMVMVLIMNIYSIG---KEIVQLSQQRWNYFRDHSNHNDWASAVYSLL---FIIPLMINAEGSLHWQAGALAVLHYWIGFLLYLQRFENVGIFVVMFGEIMRTLVRIVMLFFFLMLAFSLAFHAL--------------MLNQSQ--------------FETVPLSVIQTFVMMVGELNYQNNILDAFLKNE---LPFGILTYFIFVQFVMLMPILLVNLMIGLAVGDIAEVQRNASLKRIAMQIDLHTSLEDKLPYWFMKRVDKPSIIIYPNRKCSRHFLTHLFSGEEEKNEVWSRLQSKSQNCPVIENELKKQKIRMKEMSSILEKQHGLLKLIIKKMEITSEADEYDGPV 1083          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 174.866 bits (442), Expect = 5.146e-44
Identity = 158/586 (26.96%), Postives = 257/586 (43.86%), Query Frame = 1
Query:  154 NPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEK-CLEMLVES------KNKKGCSPMQI-------------------LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTH--GASIF--KDKQGLT 1818
            N   P   AAA N +   ++II     ++ SD  G T +H+AA N   E++++L+   A+ NA D      +H A     +  ++ L+ +GA+ +  +K    P+H      ++ V+K LL    V  ++  + GN+A+H+AC       +  L+  GA V  PN  G  P+H A    +   CLE LV +      +++ G SP+ +                   +N  DK+GN PLH A   G    +   +  GA    R      PLH A      D  + +L +  ++        D+ G T LH A    +V+  + L++ G     TD  G TPL  AA+  +    +TL+  G +I A D+  R+ +H  + + ++ +    + LE   +  +    EK+   C                 L++ G     ++    +P+H+AA +G  H    LL+T DG +      +  + P+H AA +GH + +Q+LL  G  +  R   G TPL  AA  GH +    L+    S L      G+T +H A +N  +  V LLL    GA +    D QG T
Sbjct:   56 NWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSL-SVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQI-----DTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRR--VALEPDSEG-VQAEKEKEAAQCLEF--------------LLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGN-AQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRT 617          

HSP 2 Score: 158.688 bits (400), Expect = 6.223e-39
Identity = 143/529 (27.03%), Postives = 219/529 (41.40%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNV--PLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEV---TDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKD-TPLHFAARYGRVHTCRRLLNTF--DGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLD-RGCIFHRCYHGN--TPLHYAATNGHIETCQYLI--EMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI 1794
            D  G T +H AAA   ++ + +L+    + N  D  G TP+H+A  +     L  L++ G D N  ++   + +H     S LD  + +   P+    Q             E +  + L+ LL++GA     +  G  PVH A  + +  CLE+L+++ + +              GN   PLH A   G  +A+Q+ L  G ++D R     TPL  A  +G  D V  +L          L      G TP+H AVM  H      L++E    EV    D  G TPL+LA    +++    LL+  AN+   DK     +HL  L   ++ V  L+              E+D                            C+ Q + +  TP+H AA  G       LL     +        D  G  P+H A   G    +++LL+ RGC   RC  GN  TPLH A  NGH E+C  L+   M   +   ++ +G+T LH AA   ++  + LLL+H A +
Sbjct:  352 DSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAA-ASDLDRRRRVALEPDSEGVQAEK----------EKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGR--------QEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASP----LSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLL--------------EQD---------------------------ACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGC---RCIDGNPFTPLHCAVVNGH-ESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPV 812          

HSP 3 Score: 121.709 bits (304), Expect = 1.610e-27
Identity = 132/567 (23.28%), Postives = 223/567 (39.33%), Query Frame = 1
Query:  169 FQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNN-----------------------EIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGN--SAIHIACEIDNQEALDCLLKAGALV------------------------------CSP----NVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVR-------------------------------QNDNS--TPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLL-KYGANIYA-RDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG 1587
               AAAG  ++  +L++ + G  + +D+ G T +HYAAA+     ++ L++   D NA D  G + +H+A  ++                         + L +L+ +GA   + +K   +P+H          L ELL      R +   CGN  S +H+A    + +AL  LL+ G  V                               SP     +YG  PVH+A+   +  C+ +L++  +       ++L+ +D +G  PL  AV  G   AV + L   A ++                                 Q D+   TP+H A  +G    +  +L         V  ++D +G+TPLH A  +      E L+E+       D N +TPL  A    +      LL   G++I   RD   R  +H  +     + +  L+       S  + ++  D+ G TPL  +  +G +     L+  G      + D +TPLH A   G       +L        +N+T++  + P+H AA+ G  K +Q LL RG
Sbjct:  359 LHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCL-ELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGA-----EVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQ-RGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLL-------SHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRG 911          

HSP 4 Score: 110.538 bits (275), Expect = 4.777e-24
Identity = 114/471 (24.20%), Postives = 195/471 (41.40%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNM---APIHLTVYKSKLDVLKELLRHPEVNR--NQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQ-----MCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTR--------------------HEVKDVVL---------KIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDG-MKAMNSTDSFGRLPIHAAAE 1545
            N  + +H AA +   + + VL+    + + RD  G TP+  A L      +  L+  GA P  L+ D +    P+HL V       ++ LL  P+     +     G + + +A    + +A+  LL+  A V + +  G+  +H+A+    ++C++ L+E   +  C     L   D +G  P+H A   G    +       C    +   ++     TPLH+AC  G+   V+++L  R                    HE    +L           +D  G TPLH A      E  + L+   + ++  DD+G TPL+ AA++  +   + LL  GA +   D+     +H+   N   D V  LM L+++  S  ++IN  +    TPLH + +RGL +    L+  G    T + D  TP    A   +V  C     + D  +  +       RLP  A  +
Sbjct:  511 NAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASP--LSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLE---QDAC-----LLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGV--LMILQRL--SDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTPALACAPSRQVADCLAHSGSHDAFLLPLQLRGPLPRLPAEAPPQ 967          

HSP 5 Score: 63.5438 bits (153), Expect = 1.269e-9
Identity = 73/272 (26.84%), Postives = 119/272 (43.75%), Query Frame = 1
Query:  109 DEEMQ--LHDEVCLM-SDNPNR-PFQFAAA-GNCMEIEKLXXXXXXXXXX----XDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNIL---NKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTP 888
            DE +Q  L  + CL+  D+  R P   AAA G+   + +L+       SS     D +G T +H+A    +   ++VL+  R  +   D N  TP+H AV+N   ++   L+L+    +I    +     P+H   +  + + ++ LL H +   +     G + +  A       AL+ LL AGA +   +  G  P+HVA     E  + M+++       S   ++N ++     PLH A   G  KAVQ  L  GA       D  TP
Sbjct:  661 DECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCR-CIDGNPFTPLHCAVVNGH-ESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSH-DAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQR-----LSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTP 924          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Medaka
Match: ankrd44 (ankyrin repeat domain 44 [Source:NCBI gene;Acc:101173198])

HSP 1 Score: 174.096 bits (440), Expect = 1.026e-43
Identity = 158/586 (26.96%), Postives = 257/586 (43.86%), Query Frame = 1
Query:  154 NPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEK-CLEMLVES------KNKKGCSPMQI-------------------LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTH--GASIF--KDKQGLT 1818
            N   P   AAA N +   ++II     ++ SD  G T +H+AA N   E++++L+   A+ NA D      +H A     +  ++ L+ +GA+ +  +K    P+H      ++ V+K LL    V  ++  + GN+A+H+AC       +  L+  GA V  PN  G  P+H A    +   CLE LV +      +++ G SP+ +                   +N  DK+GN PLH A   G    +   +  GA    R      PLH A      D  + +L +  ++        D+ G T LH A    +V+  + L++ G     TD  G TPL  AA+  +    +TL+  G +I A D+  R+ +H  + + ++ +    + LE   +  +    EK+   C                 L++ G     ++    +P+H+AA +G  H    LL+T DG +      +  + P+H AA +GH + +Q+LL  G  +  R   G TPL  AA  GH +    L+    S L      G+T +H A +N  +  V LLL    GA +    D QG T
Sbjct:  106 NWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSL-SVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQI-----DTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRR--VALEPDSEG-VQAEKEKEAAQCLEF--------------LLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGRQEEADCGN-AQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRT 667          

HSP 2 Score: 158.303 bits (399), Expect = 8.033e-39
Identity = 143/529 (27.03%), Postives = 219/529 (41.40%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNV--PLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEV---TDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKD-TPLHFAARYGRVHTCRRLLN--TFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLD-RGCIFHRCYHGN--TPLHYAATNGHIETCQYLI--EMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI 1794
            D  G T +H AAA   ++ + +L+    + N  D  G TP+H+A  +     L  L++ G D N  ++   + +H     S LD  + +   P+    Q             E +  + L+ LL++GA     +  G  PVH A  + +  CLE+L+++ + +              GN   PLH A   G  +A+Q+ L  G ++D R     TPL  A  +G  D V  +L          L      G TP+H AVM  H      L++E    EV    D  G TPL+LA    +++    LL+  AN+   DK     +HL  L   ++ V  L+              E+D                            C+ Q + +  TP+H AA  G       LL     +        D  G  P+H A   G    +++LL+ RGC   RC  GN  TPLH A  NGH E+C  L+   M   +   ++ +G+T LH AA   ++  + LLL+H A +
Sbjct:  402 DSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAA-ASDLDRRRRVALEPDSEGVQAEK----------EKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCLELLLDTHDGR--------QEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASP----LSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLL--------------EQD---------------------------ACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGC---RCIDGNPFTPLHCAVVNGH-ESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPV 862          

HSP 3 Score: 136.346 bits (342), Expect = 6.203e-32
Identity = 142/487 (29.16%), Postives = 226/487 (46.41%), Query Frame = 1
Query:  313 LMIYRA-DKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNM--APIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVY---GIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPL-LLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYH-GNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAIND 1749
            ++IY++ D N  D+   TP+H A    + +    LIL+GA  N   KDNM   P+H  V     D ++ L+RH   + N       + +H+A       AL C      L+ S NV    G   +H A    + + + +L+     KG +    +N  DK+    LH A   G    V + + +GA++  +     TPLH A + G++ +VK +L    E+ +      +  G+T LH A       +   LI+ G+N+   ++ G+TPL   AAS       + L+  GA+I  + +  ++ +H+ +++       F      IQ      IN  D  G TPLH + R G   L   LI  G  C  +      PLH AA       CR+LL++  G + +++ DS GR  +HAAA  G+   +Q+LL  G   +R    G TPLHYAA + H    + L+      ++  +  G++ALH AA +D
Sbjct:   26 MLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARVNA--KDNMWFTPLHRAVASRSQDAVQVLIRH-SADVNARDKNWQTPLHVAAA---NNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLL----AKGAN----INAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDE-----PNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVH-----GRFTRSQTLIQNG--GEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSS--GFQ-IDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTD-INATDQWGRSALHYAAASD 482          

HSP 4 Score: 122.094 bits (305), Expect = 1.463e-27
Identity = 111/411 (27.01%), Postives = 170/411 (41.36%), Query Frame = 1
Query:  757 LNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEV----------------------KDVVLK------IQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLI-------------HLFSLNVVNDKVNFLM----------GLEKIQQSFISI---INEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMT-QNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFK-DKQGLT 1818
            +N  D E   PLH A   GD +  ++ +  GA+++ + N   TPLH A      D V++++R   +V                       +V++       + D  G T LH A +  H E+   L+ +G+NI   D      L  AA   +++V   L+ +GA +  +DK     +             HL SL+V  D+ N             G + +    I     +++ +N G TPLH++       L    +   G  +  Q+ D  +PLH  A +GR    + L+        +NS D  G  P+H AA  GH  +I  L+  G     R  HG  PLH AA N H + C+ L+      +D  +  G+T LH AA       V LLL  G    + DK G T
Sbjct:   34 INVLDAEKRTPLHAAAFLGDAEITELLILSGARVNAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLAKGANINAFDKKDGRALHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSLSVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNG---GEINSVDKDGNTPLHVAARYGHELLINTLITSGADCARRGVHGMFPLHLAALNAHSDCCRKLLSSGFQ-IDTPDSLGRTCLHAAAAGGNVDCVQLLLKSGGEHNRTDKCGRT 440          

HSP 5 Score: 120.939 bits (302), Expect = 2.777e-27
Identity = 132/564 (23.40%), Postives = 223/564 (39.54%), Query Frame = 1
Query:  178 AAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNN-----------------------EIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGN--SAIHIACEIDNQEALDCLLKAGALV------------------------------CSP----NVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVR-------------------------------QNDNS--TPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLL-KYGANIYA-RDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG 1587
            AAAG  ++  +L++ + G  + +D+ G T +HYAAA+     ++ L++   D NA D  G + +H+A  ++                         + L +L+ +GA   + +K   +P+H          L ELL      R +   CGN  S +H+A    + +AL  LL+ G  V                               SP     +YG  PVH+A+   +  C+ +L++  +       ++L+ +D +G  PL  AV  G   AV + L   A ++                                 Q D+   TP+H A  +G    +  +L         V  ++D +G+TPLH A  +      E L+E+       D N +TPL  A    +      LL   G++I   RD   R  +H  +     + +  L+       S  + ++  D+ G TPL  +  +G +     L+  G      + D +TPLH A   G       +L        +N+T++  + P+H AA+ G  K +Q LL RG
Sbjct:  412 AAAGGNVDCVQLLLKSGGEHNRTDKCGRTPLHYAAASRHYHCLETLVVCGTDINATDQWGRSALHYAAASDLDRRRRVALEPDSEGVQAEKEKEAAQCLEFLLQSGAAAALKDKQGYSPVHYAAAFGHRHCL-ELLLDTHDGRQEEADCGNAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASPLSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGA-----EVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQ-RGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLL-------SHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQRLSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRG 961          

HSP 6 Score: 110.153 bits (274), Expect = 6.250e-24
Identity = 109/441 (24.72%), Postives = 186/441 (42.18%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNM---APIHLTVYKSKLDVLKELLRHPEVNR--NQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQ-----MCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTR--------------------HEVKDVVL---------KIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTC 1458
            N  + +H AA +   + + VL+    + + RD  G TP+  A L      +  L+  GA P  L+ D +    P+HL V       ++ LL  P+     +     G + + +A    + +A+  LL+  A V + +  G+  +H+A+    ++C++ L+E   +  C     L   D +G  P+H A   G    +       C    +   ++     TPLH+AC  G+   V+++L  R                    HE    +L           +D  G TPLH A      E  + L+   + ++  DD+G TPL+ AA++  +   + LL  GA +   D+     +H+   N   D V  LM L+++  S  ++IN  +    TPLH + +RGL +    L+  G    T + D  TP    A   +V  C
Sbjct:  561 NAQSPLHLAAYHGHAQALQVLLRGGREVDERDQAGRTPLALAALRGHADCVHTLLSQGASP--LSTDQLYGRTPVHLAVMNGHTTCVRLLLDEPDGAEVLDVADPQGRTPLMLAVVGGHVDAVSLLLEREANVNTADKKGLMALHLALLCAQDECVQCLLE---QDAC-----LLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCRCIDGNPFTPLHCAVVNGHESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSHDAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGV--LMILQRL--SDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTPALACAPSRQVADC 987          

HSP 7 Score: 108.227 bits (269), Expect = 2.757e-23
Identity = 94/359 (26.18%), Postives = 171/359 (47.63%), Query Frame = 1
Query:  748 MQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFK-DKQGLT 1818
            M +L  +D+     L  A+ +GD + ++M ++    I+V   +  TPLH A   G+ +I +L++ +   V       +DN   TPLH+AV     +  + LI   +++   D N  TPL +AA+   +   + ++    ++   D+  R  +H  +LN   + VN L+     + + I+  ++KD      LH++   G L +  +L+  G     ++    TPLH AA  G++   + LL+       ++  ++FG   +H A  NG   ++  L+D G  +      G TPLH+AA + H   C   +  N + ++ Q+ +GK+ LH  A++ +      L+ +G  I   DK G T
Sbjct:    1 MAVLKLADQPA---LIQAIFSGDPEEIRMLIYKSEDINVLDAEKRTPLHAAAFLGDAEITELLILSGARV-----NAKDNMWFTPLHRAVASRSQDAVQVLIRHSADVNARDKNWQTPLHVAAANNALRCAEVIIPLLTSVNVSDRGGRTALHHAALNGHTEMVNLLLA----KGANINAFDKKDGRA---LHWAAFMGHLDVVSVLVSHGAEVSCKDKRGYTPLHAAASSGQIAVVKHLLSL---SVEIDEPNAFGNTALHLACFNGQDAVVSELIDYGANVSQPNNKGFTPLHFAAASTHGALCLEFLVNNGADINIQSRDGKSPLHMTAVHGRFTRSQTLIQNGGEINSVDKDGNT 341          

HSP 8 Score: 63.5438 bits (153), Expect = 1.480e-9
Identity = 73/272 (26.84%), Postives = 119/272 (43.75%), Query Frame = 1
Query:  109 DEEMQ--LHDEVCLM-SDNPNR-PFQFAAA-GNCMEIEKLXXXXXXXXXX----XDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNIL---NKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTP 888
            DE +Q  L  + CL+  D+  R P   AAA G+   + +L+       SS     D +G T +H+A    +   ++VL+  R  +   D N  TP+H AV+N   ++   L+L+    +I    +     P+H   +  + + ++ LL H +   +     G + +  A       AL+ LL AGA +   +  G  P+HVA     E  + M+++       S   ++N ++     PLH A   G  KAVQ  L  GA       D  TP
Sbjct:  711 DECVQCLLEQDACLLQGDSQGRTPIHLAAAQGHASWLSELLTIACSESSSVPPLKDGSGYTPLHWACFYGQDGCVEVLLEQRGCR-CIDGNPFTPLHCAVVNGH-ESCAALLLDAMGSDITGCRDAKGRTPLHAAAFAGQTECIQLLLSH-DAPVDPADDHGRTPLMTAAAKGRVGALEALLDAGAGLSLIDRDGNTPLHVACSNGTEDGVLMILQR-----LSDATLINATNAAMQTPLHMAAQRGLKKAVQELLSRGASTQTVDEDGLTP 974          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 167.162 bits (422), Expect = 2.941e-41
Identity = 152/612 (24.84%), Postives = 279/612 (45.59%), Query Frame = 1
Query:   79 KVPNVHMIELDEEMQLHDEVCLMSDNPN---------RPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH----PEVNRNQTTS------CGN----------------------SAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            ++P +H+   +++ +      L+ ++PN          P   AA    M + +L++     ++ + +NG+T +H A+    + ++ +L+   A  +A+  +  TP+H A  N  ++ +  L+ +GA      K+ ++PIH+      +D +++LL++     ++  +  T       CG+                      + +HIAC+ ++  ++D LLK  A + +    G+ P+HVA    +   ++ L++    +G SP    N S+ +   PLH A   G  +  Q  L   A++D R  D+ TPLH A   G  ++VKL+L  +              GHTPLH A    H+     L++ G+        G+TPL +A+    ++V + LL+ GAN  A  K     +H+   +   D V  L+       S     +     G TPLH + ++  + +  +L++ G     ++    TPLH A++ GR      L++       +N  +  G  P+H  A+ GH  I   L+ +G  ++     G TPLH A   G+I+  ++L++   + ++ +   G T LH AA    + +V LLL HGA
Sbjct:  171 RLPALHIAARNDDTR--TAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQ----RGASP----NASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSAT-----TAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV-------SKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISK---QANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ-AHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGA 756          

HSP 2 Score: 151.754 bits (382), Expect = 1.601e-36
Identity = 133/503 (26.44%), Postives = 232/503 (46.12%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            P   AA G+ M+  + ++  +  I     + +T +H AA      +  VL+   A  NAR  NG TP+H A   N ++++  L+ + A    + +  + P+H+  +   L+++K LL+    + N +     + +H+A    + E    LL+  A V +       P+H A +  +++ +++L++ K           + +   G+ PLH A   G    +++ L  GA+         TPLH A   G++D+ +L+L      +         NG TPLH AV  N++++ + L+ +G +   T  NG+TPL +AA +  +EV   LL+ GA+           +HL S     D V  L+     +Q+ +++ N+    G TPLH   + G + +   L+K G      +    TPLH A  YG +   + LL        +N+    G  P+H AA+ GHT I+ +LL  G + +    +G +PL  A   G+I     L
Sbjct:  306 PIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQR-GASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANP--------DSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLE-----RGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLIS----KQANVNLGNKN---GLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQ---QAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 3 Score: 150.599 bits (379), Expect = 3.593e-36
Identity = 153/576 (26.56%), Postives = 259/576 (44.97%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNS-----------------------------AIHIACEIDNQEALDCLLKAGALVCSPNVY---GIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLD-RGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVV 1872
            ++NG+  +H A+    ++++  L+    +  A    GNT +H A L  + K +  L+  GA+ N  +    +P+++   ++ L+V+K LL +   N++  T  G +                             A+HIA   D+      LL+      +P+V    G  P+H+A  Y N    ++L+     +G +    +NF+ K G  PLH A   G+   V++ L  GA+ID +  D  TPLH A   G + I++++L          ++ +  NG +P+H A   +H++    L++  + I+    +  TPL +AA   +  + K LL  GA   AR       +H+        K N +  ++ + +   S+    ++ G TPLH +   G L +   L++ G      N   +TPLH A+R G     + LL     + A    D   + P+H AA  GH +++++LLD +         G+TPLH AA  GHI T + L++     +     +G T LH A+   K  V  LLL  GA+     K GLT     +   NL+  K +V
Sbjct:   40 NQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLEN-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDP---NPDVLSKTGFTPLHIAAHYENMSVAQLLL----NRGAN----VNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLE-----HGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIAC------KKNHMRSMDLLLKHSASLEAVTES-GLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDD---QTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQV-KMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLV 587          

HSP 4 Score: 134.42 bits (337), Expect = 3.857e-31
Identity = 134/491 (27.29%), Postives = 225/491 (45.82%), Query Frame = 1
Query:  397 KALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLM-------GLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            KAL + I NG + NI N++ +  +HL   +  + ++ ELL H  +    TT  GN+A+HIA     ++ +  L+  GA V + +  G  P+++A +  + + ++ L+E+   +        +   ++G  PL  A+  G    V + ++YG K  VR       LH A    +     ++L+      D    +    G TPLH A  + ++ +A+ L+  G+N+  T  NG TPL +A+ R N+ + + LL  GA I A+ K +   +H  + N     +  L+          K   S I +  + D+M C                   TPLH +   G  R+  +L+  G     +  +  TPLH A +   + +   LL     ++A+  +   G  P+H AA  GH  I++ LL RG   +       TPLH A+  GH E  Q+L++ N + +D +  + +T LH AA      +V LLL H A
Sbjct:   25 KALDH-IKNGININIANQNGLNGLHLASKEGHVKMVLELL-HSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQ--------SLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRL----PALHIAARNDDTRTAAVLLQN-----DPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTES---GLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQ-NAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKA 492          

HSP 5 Score: 60.8474 bits (146), Expect = 9.149e-9
Identity = 74/290 (25.52%), Postives = 121/290 (41.72%), Query Frame = 1
Query: 1051 IEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISI---INEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTP-----------------------------LHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLT 1818
            I+ G NI + + NG   L LA+   ++++   LL  G  + A  K     +H+ +          L G EK+    ++    +N + + G +PL+ + +   L +   L++ G        D  TP                             LH AAR     T   LL        ++ T   G  P+H AA   +  + Q+LL+RG  +     +G TPLH A+  G++   + L++   + +D Q  +  T LH AA N    ++ +LL HGA I  K K GL+
Sbjct:   30 IKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAA----------LAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKT---GFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRG-AQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLS 305          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 165.622 bits (418), Expect = 8.327e-41
Identity = 144/506 (28.46%), Postives = 233/506 (46.05%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH---PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHR-CYHGNTPLHYAATNGHIETCQYL 1671
            P   AA G+ +E  K ++ +   +     + +T +H AA      V  +L+  RA+ NAR  NG TP+H A   N +K +  L+  GA    + +  + PIH+  +   L+++  LL++   P+V+  +    G +++H+A      E + CLL+ GA+V +       P+H+A +    + +++L++         M   + +   G  PLH +   G  +   + L  GA   +      TPLH     G LD+ KL+L+ R    D   K    NG TPLH A  +++ ++A  L+++G++   T  NG+TPL +AA +  M++   LL+YGA   A  K     +HL S     D    LM       S  + IN     G T LH + +   + +  IL++ G     Q     TPL  A  YG       LL       ++N+    G  P+H AA+ G+T II +LL  G   +    +GNT L  A   G+I     L
Sbjct:  343 PLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIR----GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQH--------MAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQ-RQAPPDSAGK----NGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLM-------SKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNG---ASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 2 Score: 155.221 bits (391), Expect = 1.482e-37
Identity = 136/513 (26.51%), Postives = 244/513 (47.56%), Query Frame = 1
Query:  253 NGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            +G+T +H AA +     ++VL+   A   AR  NG +P+H A   + ++ + +L+ + A  + +  D +  +H+  +     V K LL     N N     G + +HIAC+ +  + ++ L+K GA + +    G+ P+HVA    +   + +L+++    G SP    + S+  G   LH A   G  + V+  L  GA +D R  ++ TPLH A   G+ +IV+L+L+               NG+TPLH +     +E A  L+E G++  +    G+TPL + +   +++V K LL+  A   +  K     +H+ + +  N KV  L+ L+K      +  N     G TPLH + ++  + +  +L++ G           TPLH A++ G       L++       +N     G   +H AA+     + ++L+  G  + H+   G TPL  A   G+ +   +L++ N + ++ +   G T LH AA    +H++ +LL HGA
Sbjct:  306 DGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTK-LLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQN----GASP----DVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAAT-----TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHV-AAHYDNQKVALLL-LDKGASPHTTAKN-----GYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKG---AQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQ-NGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGA 793          

HSP 3 Score: 152.14 bits (383), Expect = 1.365e-36
Identity = 157/604 (25.99%), Postives = 264/604 (43.71%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNS-------------------------------AIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNI-EVTDD--------------------------------NGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFS----LNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKD-KQGLTFFTHILKLKN 1848
            ++NG+  +H AA    ++++  L+   A  ++    GNT +H + L  + + +  L+  GAD N  +++   P+++   ++ LDV++ LL   E   NQ+T+  +                                A+HIA   D+ ++   LL+        +  G  P+H+A  Y N     +L+     +G +    ++F+ + G  PLH A   G+T  V++ L  G++ID +  D  TPLH A   G    V+++L      K   L  +  NG +PLH A   +HVE  ++L++  + + +VT D                                NG+TPL +A  +  ++V + L+KYGA+I A  ++    IH+ +    LN+V      L+ L+      +S I      G T LH + R G   +   L++ G +   +  +  TPLH A+R G+    + LL     M   ++  + G  P+H +A  G  +   +LL+ G         G TPLH  +  G ++  + L++   +  D+    G T LH AA  D   V  LLL  GAS     K G T   HI   KN
Sbjct:   77 NQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLL---ENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLL----NRGAA----VDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLE-----KGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIV------LLLLQNGASPDVSNIR-----GETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQH---MAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQ-APPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPL-HIAAKKN 648          

HSP 4 Score: 143.28 bits (360), Expect = 6.641e-34
Identity = 145/604 (24.01%), Postives = 260/604 (43.05%), Query Frame = 1
Query:  250 ENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTP-----------------------------IHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQ----TTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE------SKNKKGCSPMQILNFSDK--------EGNVP-----------LHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASI-FKDKQGLTFFTHILKLKNLNTAKEVVFNN 1881
            +NG T ++ AA  + ++V+  L+    +++    +G TP                             +H A   ++ K+   L+ N  + ++ +K    P+H+  +   ++V   LL     NR      T   G + +H+A +  N   +  LL  G+ + +    G+ P+H A +  +E  +E+L+E      ++ K G SP+ +    D         +   P           LH A + G  +  ++ L   A  + R  +  TPLH AC K  + +++L+++    ++ V       +G TP+H A    H+ +   L++ G++ +V++  G T L +AA     EV + LL+ GA + AR +  +  +H+ S     + V  L  L+ +     +  N     G TPLH S R G L    +L++ G           TPLH  ++YG +   + LL         +S    G  P+H AA   + K+  +LLD+G   H    +G TPLH AA    ++    L++   +  +    +G T LH A+    + +  LL++ GA I    K GLT   H+   ++     E++  N
Sbjct:  144 QNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLL-----NRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVT-----ESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLL--LQHMAHPDAATTN-----GYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQR---QAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYG-AETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTAL-HLAAQEDRVAVAEILVRN 725          

HSP 5 Score: 128.642 bits (322), Expect = 1.835e-29
Identity = 134/508 (26.38%), Postives = 226/508 (44.49%), Query Frame = 1
Query:  349 SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELL-RHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHL-------FSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGC-------------------TPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGA 1788
            S+ NT    A     I  +   +  G D +  N++ +  +HL   +  +D+++ELL R   V+   +T  GN+A+HI+      E +  L+K GA + + +  G  P+++A +  +   +  L+E+   +        + + ++G  PL  A+  G  + V + L    K  VR       LH A  K +     L+L+  H        +Q  +G TPLH A  + +V +A  L+  G+ ++ T  NG TPL +A+ R N  + + LL  G+ I A+ +     +H         S+ V+ +K   L+   K   S + +  + D++ C                   T LH +   G  R+T +L+        +  +  TPLH A +  RV     L+     ++A+  +   G  PIH AA  GH  I+ +LL  G         G T LH AA  G  E  + L+  N +++D +  E +T LH A+   K+ +V LLL H A
Sbjct:   45 SDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVD--SSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQ--------STATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRL----PALHIAARKDDTKSAALLLQNDHNAD-----VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTES---GLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLR-NGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMA 529          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Planmine SMEST
Match: SMESG000035379.1 (SMESG000035379.1)

HSP 1 Score: 2267.27 bits (5874), Expect = 0.000e+0
Identity = 1150/1161 (99.05%), Postives = 1152/1161 (99.22%), Query Frame = 1
Query:   16 KNLFREFSCFCFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF 3498
            K  F  F    FVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMD+LMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIE+NPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHET KKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF
Sbjct:    9 KTSFGNFLASVFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMDILMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETVKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF 1169          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Planmine SMEST
Match: SMESG000035379.1 (SMESG000035379.1)

HSP 1 Score: 2230.68 bits (5779), Expect = 0.000e+0
Identity = 1131/1134 (99.74%), Postives = 1133/1134 (99.91%), Query Frame = 1
Query:   97 MIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF 3498
            MIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMD+LMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIE+NPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHET KKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF
Sbjct:    1 MIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSSDENGMTMMHYAAANSRIEVMDILMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRCYHGNTPLHYAATNGHIETCQYLIEINPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETVKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNIIPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF 1134          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Planmine SMEST
Match: SMESG000026132.1 (SMESG000026132.1)

HSP 1 Score: 243.817 bits (621), Expect = 1.168e-65
Identity = 303/1180 (25.68%), Postives = 523/1180 (44.32%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEK-LXXXXXXXXXXXDENGMTMMHYAA-----------ANSRIEVMDVLMIYRADKNARD---SNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE-SKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--------KDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVR--------IVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSR--GQKDFKIIYNFGILQRTVAS----------KEDLNSD------------------------------------------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAIT-------FTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLH----ITSIILSSYIIRMDINHT-TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPL--YDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYR-CPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEK-----------QLYNLMVDSHQQTDLLKLILQKMEM 3366
            P  +AA  N +E  K L+   S  ++  +E  +T +H+AA           + +++ + DV  +  A +  +        TP      NN +  + YL+  GA+PNI +     P+H    +      ++L++ PE++     +   + +H+AC  ++ E    LL +   +      G  P H+A    N K ++ML++ S+++   S M  L   +++   PLH AV  G   A ++CL  GA ++       + LH A  +G +++VKL++       +    + +    TPLH A   NHV++ +YLIE+G++IE  D + +TPLL+AAS  + E  K L+K   +I   +K  ++ ++L   +  +D    ++  E  ++    +++  D  G  PLH + R G  ++  ILI  G +   +N ++ TP+H AA++GR +   ++L        +   D     P+H AA++G+ K+IQ+LL+ G   + R  +  + L +AAT G+++  Q L++ N + +D+ +    T L+ A  N    +V LLL H A I             G       +   +   A  ++ +++WE  +R         VD     P+  +I+ MP++      K  K   S+     D+ I YNF  L+ + AS          K++ + D                                          P  V   MV   R DLL H + +  L+MKW  FG  V Y  + +Y+ +L  LS  TY I        F     V  N S  A+   I +    E  K +  +   I +  ++V L+KE+  +      YF S +N M LV++    +T I +S+    + +      Q  AV+ F+   NL+L +      G+FV+MF  +L T +  L           F   I   A     +L+NQ  FN                    L + +++  VM +GE+EF + + T    Y  +   + Y  +TY    +F++ MS++ MNLL+GLAV DI+AVQ+ A L+R+ +QV+   E EG +P  IR         V+P R    YK      + + ++   ++  D     E L  H+K           +L NL   +H  T +L  I++ +++
Sbjct:   96 PLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRRKARKINESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTK----NNAV--ILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM--LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSF-----EANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKK----LLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIV-KILGERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVD----TPMRKLIRKMPDVAEEVF-KKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMV---MVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIYLCYL--LSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILV---KERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATFIRFLP---------LFFLFIFAFAFAFYILLANQVTFNS-------------------LLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLD---DMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLKI 1211          

HSP 2 Score: 108.612 bits (270), Expect = 1.508e-23
Identity = 97/387 (25.06%), Postives = 175/387 (45.22%), Query Frame = 1
Query:   19 NLFREFSCFCFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNR----PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLR-HPEVNRNQTTSCGN-SAIHIACEIDNQEALDCLLK---AGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVES------KNKKGCSPMQ---------------------ILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNI 1071
            NLF +    C    +   E  +  V M+    E Q  DE+  M    NR    P  +A      +  K+ +     +++    G + +H AA    IE++ +L+ + A+ N  +    TP+H A   N +K + YLI  GAD    + D+  P+ +       + +K L++ H ++N    T  GN SA+++A E    +A   ++       L+  P+  G +P+H+A +  NEK +++L+++      KN++  +PM                      ++   D++ N PLH A  +G  K +Q+ L+YGA  + R  +  + L +A TKG L   +++L+   +V  +     D    TPL+ A    H  L   L++  ++I
Sbjct:  260 NLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQ--DELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDIN---VTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILGERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSM-----DKAKITPLYLACKNGHDRLVTLLLKHNADI 636          

HSP 3 Score: 85.1149 bits (209), Expect = 2.337e-16
Identity = 86/328 (26.22%), Postives = 147/328 (44.82%), Query Frame = 1
Query:  889 LHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGS-NIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVN-FLMGLEKIQQSFISII----------NEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMT-QNNDKDTPLHFAARYGRVHTCRRLL----NTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG----------CIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            +H    +G+++ +  +++         + + D +  +PLH A  FNH+E  + L+EE S N+ V ++   TP+  AA            +  A       T+ NL  + +LN   +++   L+  EK      ++I          N +D  GCTP+HY+  RG       L+KL  + +  ++N+  TPLH A  +      + LL    N FD        +  G +P H A   G+ K++ ML+ +              +R Y   TPLHYA  NGH +  +  +E   S ++   + G++ALH AA      +V LL++  A+
Sbjct:   59 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAAR----------YRRKARKINESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFD-------QEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN 366          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Planmine SMEST
Match: SMESG000026132.1 (SMESG000026132.1)

HSP 1 Score: 242.662 bits (618), Expect = 3.076e-65
Identity = 305/1187 (25.70%), Postives = 522/1187 (43.98%), Query Frame = 1
Query:  166 PFQFAAAGNCMEIEK-LXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHA---VLNNEIKALT------------------YLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVE-SKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFH-RCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIF--------KDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVR--------IVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSR--GQKDFKIIYNFGILQRTVAS----------KEDLNSD------------------------------------------PFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAIT-------FTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLH----ITSIILSSYIIRMDINHT-TMQVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPL--YDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMKIRNWAFKEIWEVFPYR-CPTYKICSSEAQVIYKKNDYEESRDLGNLFETLNTHEK-----------QLYNLMVDSHQQTDLLKLILQKMEM 3366
            P  +AA  N +E  K L+   S  ++  +E  +T +H+AA   R        I    KN+R +   T ++ A    LN+  + +                   YL+  GA+PNI +     P+H    +      ++L++ PE++     +   + +H+AC  ++ E    LL +   +      G  P H+A    N K ++ML++ S+++   S M  L   +++   PLH AV  G   A ++CL  GA ++       + LH A  +G +++VKL++       +    + +    TPLH A   NHV++ +YLIE+G++IE  D + +TPLL+AAS  + E  K L+K   +I   +K  ++ ++L   +  +D    ++  E  ++    +++  D  G  PLH + R G  ++  ILI  G +   +N ++ TP+H AA++GR +   ++L        +   D     P+H AA++G+ K+IQ+LL+ G   + R  +  + L +AAT G+++  Q L++ N + +D+ +    T L+ A  N    +V LLL H A I             G       +   +   A  ++ +++WE  +R         VD     P+  +I+ MP++      K  K   S+     D+ I YNF  L+ + AS          K++ + D                                          P  V   MV   R DLL H + +  L+MKW  FG  V Y  + +Y+ +L  LS  TY I        F     V  N S  A+   I +    E  K +  +   I +  ++V L+KE+  +      YF S +N M LV++    +T I +S+    + +      Q  AV+ F+   NL+L +      G+FV+MF  +L T +  L           F   I   A     +L+NQ  FN                    L + +++  VM +GE+EF + + T    Y  +   + Y  +TY    +F++ MS++ MNLL+GLAV DI+AVQ+ A L+R+ +QV+   E EG +P  IR         V+P R    YK      + + ++   ++  D     E L  H+K           +L NL   +H  T +L  I++ +++
Sbjct:   96 PLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAARYRR----KARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKM--LQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSF-----EANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDINVTEKGNKSALYLAVEHSYSDATKTIISDENGKK----LLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIV-KILGERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQ-NGAQVDSMDKAKITPLYLACKNGHDRLVTLLLKHNADISMRVAGDANDPLTGCNPLDAAIDNGHRQCALAILKSDKWEIALRNQTKSLKGYVD----TPMRKLIRKMPDVAEEVF-KKCKVSNSKHPDHIDYAITYNFEFLEDSYASWGMNHFVENVKKEFDVDDESESASVILDTVSLETYDENEKLCPTARLYTEDKKMILKNHPLMV---MVRKRREDLLDHHIVSNLLRMKWNNFGLVVYYCNLAIYLCYL--LSLLTYMIEAEPPYLYFIRNKTVGLNGSICAQVKQILV---KERLKHSAEICKYIIVVMTVVGLVKEAAQLCLNRANYF-SLENIMELVMYVLAFVTVIDVSTCQTEIGVREPWQWQTGAVSAFMSIMNLVLFIRKVPFFGIFVVMFTDVLATFIRFLP---------LFFLFIFAFAFAFYILLANQVTFNS-------------------LLNSIIQTTVMTIGELEFDSIFNTQWEEYPPDNRLIFYDVVTYTIFGIFLLMMSIITMNLLVGLAVDDIKAVQEKATLERMGMQVTLALEVEGLVPEFIRRRYIIRKLTVYPNRESSIYKTLFGIGREVRRQMCKDDQLD---DMERLKLHQKATTEQLTEMKFKLRNLHSQNHLMTKMLTKIVKNLKI 1220          

HSP 2 Score: 108.612 bits (270), Expect = 1.677e-23
Identity = 98/387 (25.32%), Postives = 175/387 (45.22%), Query Frame = 1
Query:   19 NLFREFSCFCFVGSVDNSEKKVPNVHMIELDEEMQLHDEVCLMSDNPNR----PFQFAAAGNCMEIEKLXXXXXXXXXXXDENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLR-HPEVNRNQTTSCGN-SAIHIACEIDNQEALDCLLK---AGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVES------KNKKGCSPMQI-LNFS--------------------DKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNI 1071
            NLF +    C    +   E  +  V M+    E Q  DE+  M    NR    P  +A      +  K+ +     +++    G + +H AA    IE++ +L+ + A+ N  +    TP+H A   N +K + YLI  GAD    + D+  P+ +       + +K L++ H ++N    T  GN SA+++A E    +A   ++       L+  P+  G +P+H+A +  NEK +++L+++      KN++  +PM +   F                     D++ N PLH A  +G  K +Q+ L+YGA  + R  +  + L +A TKG L   +++L+   +V  +     D    TPL+ A    H  L   L++  ++I
Sbjct:  269 NLFDQEETGCIPFHIACGEGNIKMVDMLIKKSEDQ--DELSKMLQAVNRDYKTPLHYAVKNGHCDAAKVCLEKGASVNAVTYTGRSALHLAAHQGSIEMVKLLVSFEANFNVTNKLMQTPLHAAAEKNHVKVVQYLIEKGADIESRDIDSYTPLLIAASYGHCETIKLLMKNHCDIN---VTEKGNKSALYLAVEHSYSDATKTIISDENGKKLLHIPDFKGNFPLHIACRDGNEKIVQILIDAGAIDDVKNEEERTPMHLAAKFGRTYIVKILGERSKQSLIIDEDEDSNTPLHLAAKSGYPKVIQLLLNYGADKNARNCNKLSALDFAATKGNLKAAQVLLQNGAQVDSM-----DKAKITPLYLACKNGHDRLVTLLLKHNADI 645          

HSP 3 Score: 87.8113 bits (216), Expect = 4.051e-17
Identity = 87/328 (26.52%), Postives = 150/328 (45.73%), Query Frame = 1
Query:  889 LHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGS-NIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVN-FLMGLEKIQQSFISII----------NEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMT-QNNDKDTPLHFAARYGRVHTCRRLL----NTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRG----------CIFHRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGAS 1791
            +H    +G+++ +  +++         + + D +  +PLH A  FNH+E  + L+EE S N+ V ++   TP+  AA R   +  K    +  +      T+ NL  + +LN   +++   L+  EK      ++I          N +D  GCTP+HY+  RG       L+KL  + +  ++N+  TPLH A  +      + LL    N FD        +  G +P H A   G+ K++ ML+ +              +R Y   TPLHYA  NGH +  +  +E   S ++   + G++ALH AA      +V LL++  A+
Sbjct:   59 MHKFAREGDVEQLSFLIKQNPRKAKKCVNLLDIDKMSPLHYAARFNHLECVKILVEEASANVNVPNEERVTPIHFAA-RYRRKARKIDFNHKNSRQNESGTKLNLADVGTLNSATEEMQKRLIEEEKTPTKNNAVILYLVSKGANPNIQDTYGCTPMHYAAMRGNEVAAEQLMKLPEIDIKLKDNESMTPLHLACAHNHFEIAKMLLISSNNLFD-------QEETGCIPFHIACGEGNIKMVDMLIKKSEDQDELSKMLQAVNRDY--KTPLHYAVKNGHCDAAKVCLEKGAS-VNAVTYTGRSALHLAAHQGSIEMVKLLVSFEAN 375          
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Planmine SMEST
Match: SMESG000078033.1 (SMESG000078033.1)

HSP 1 Score: 228.409 bits (581), Expect = 5.771e-61
Identity = 263/987 (26.65%), Postives = 462/987 (46.81%), Query Frame = 1
Query:  247 DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEIKALTYLI------LNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRH-PEVNRNQTTSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNEKCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHYGAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAA-----SRLNMEVFKTLLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQS-----FISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGC-IFHRCYHGNTPLHYAATNGHIETCQYLI--EMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEVVRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSR-GQKDFKIIYNFGILQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRWVQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGHETAKKAVLVMAMITMCYSIV--NLIKESHPIFTKTLAYFTSFQNYMTLVLHITSIILSSYIIRMDINHTTM---QVAAVTIXXXXXXXXXXXXXXEKIGLFVIMFVQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQAYSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLHYPTLTYIFLLVFIIFMSXXXXXXXXXXAVGDIEAVQKNANLKRISLQVSWLSEFEGKLPMK 3129
            ++N  +++HYA   +  +++  L+I++ D N   +N   PIH A     ++ +  L       ++ AD          P+H    +  L+V+K LL++   V + +  S   S +H     ++ + +  L+  G+ +   N  G  P+ VA    + +  ++L+    K+G + + ILN  D +G   L  AV   +++ +++C+     +D +QND  T  H A   G  ++  L+     E     L I DN  +TP+H A+M N++++ + L+++G+NI V + +  TP++LA      SR   E+ KTL +  AN+  +D   + + H        +K N  M LE   Q+      + +IN +D+   +PLH + + G   +  IL+K G      + +    LH A   G +     LL      +     D+     I+ AAENG  +I + L+D G     +   G   L +AA +G +   + L+  E+N +L D       TALH AA      +V LL   GA + +D  G T     +  +  +  +  + N  W++V+    +NG   +  +IK    I    +DK I    S     +++I + FGIL      K  + S  +  +K+M D  ++DLL HPLS   L+ KW +FG     +  ++Y++FL  +  N Y   +T ++  D   S S  C   +     +     V V+ M ++ Y+I+   L+     +F++ + +F    NY    + IT+ IL  + I+  +    +   Q A   IF+ WF LL  +  F  IG+ V+MF ++L +++   AIF  LF+GF F F I+                N     + +  L            G++K++ MM+GE+E ++ +VT          +Y  ++Y  ++ F+I M +   NL+IGLAVGDI  V   A L+ I L+V+++ E E +LP++
Sbjct:   78 EKNNFSLLHYACLENHKDIVSFLLIFKPDVNVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVK-----GQTPLHTACRRGHLNVVKILLKYQASVQKLELDSI--SVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSELFDLI-----ETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQSRNTAEIIKTLNQANANLKIKDFEMKTIFHYLI-----EKENIEM-LEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIKGHLDCVIILLEA--SKETSYYRDANENSAINLAAENGRYEIFKHLVDIGKDKMSKDDFGRNTLMFAAKSGCLPIVEDLLNDEVNINLYDQMK---STALHQAAERGHLDIVKLLWKQGAKLSEDMFGSTQLDVAILNQQWHVVRFFLNNENWKKVMNFRHQNGHGHIKVLIKYNEEITLELLDKCIIENMSNVMDPNYEIKFWFGILDSGPDDKASI-SKRYLALKSMADCGQLDLLKHPLSEKLLQCKWNKFGLAFYLIDFIVYLLFL--ICINVYMSIYTPMTDTDSYTSYSG-CKQTNSSVSSDKLDAPVGVVLMNSLIYAIITGQLLLLLLKLFSQRIRFFMEVWNY----IFITNDILVFFFIKNPLQLPCLYEWQFAPGLIFVVWFLLLYYMRFFPYIGIQVMMFQKVLVSIIKAFAIFFGLFVGFGFGFYII----------------NSSQDPFKTQGL------------GIIKSIAMMIGELEIVSYFVTG-------KKNYANVSYAMIVCFMIIMPITFFNLMIGLAVGDISNVNAEAELEMIKLRVNFVWEMESQLPVR 998          

HSP 2 Score: 76.6406 bits (187), Expect = 9.978e-14
Identity = 100/411 (24.33%), Postives = 163/411 (39.66%), Query Frame = 1
Query:  862 VRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGHTPLHKAVMFNHVELAEYLIE-EGSNIEVTDDNGWTPLLLAASRLNMEVFKTLLKYGANIYARDKTQRNLIH-------------LFS----LNVVNDKVN-----------------FLMGLEKIQQSFISIINEKDNMGCTPLHYSXXXXXXXXXXXXXXXXXXCMTQNNDKDTPLHFAARYGRVHTCRRLLNTFDGMKA----MNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIFHRC-YHGNTPL--------------------------------------HYAATNGHIETCQYLI-----EMNPSLLDNQNHEGKTALHNAAINDKSHVVGLLLTHGASIFKDKQGLTFFTHILKLK 1845
            + + +N + LHYAC +   DIV  +L  + +V      +   N   P+H A    H+E+ E L + + ++I+  D  G TPL  A  R ++ V K LLKY A++   +    +++H             L +    LNV N+                     L  ++K  ++ ISI+NEKDN G + L ++ +     +  I I        + ND  T  H AA  G           FD ++     +N TD+    PIH A  N + K++++LLD+G   + C  H  TP+                                      HY     +IE  +Y       E+   L+++Q+    + LH AA    + +  +LL  GA  F   Q      H+  +K
Sbjct:   76 IDEKNNFSLLHYACLENHKDIVSFLLIFKPDV-----NVIGANKIRPIHLAAQQGHMEIVELLCKYKSTHIDAADVKGQTPLHTACRRGHLNVVKILLKYQASVQKLELDSISVMHHPVRRNDTDMVKVLVAYGSPLNVRNNNGQTPLMVAAIEGHFELFDLLLNEMKKQGENIISILNEKDNDGFSCLSHAVQNENSEIIKICIGNAVDLDAKQNDGKTIFHSAAIIGYSE-------LFDLIETNSYHLNITDNELNTPIHHAIMNNNLKMVKLLLDKGANINVCNRHFQTPIMLACIEITQSRNTAEIIKTLNQANANLKIKDFEMKTIFHYLIEKENIEMLEYFTQTLNSEILLELINSQDDSHNSPLHCAAKIGNAEICQILLKAGADPFLFSQNDFLALHVATIK 474          
The following BLAST results are available for this feature:
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPA11.523e-14731.17transient receptor potential cation channel subfam... [more]
TRPA14.636e-12631.89transient receptor potential cation channel subfam... [more]
ANK32.986e-4526.82ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK23.791e-4429.49ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK23.821e-4429.49ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa-13.465e-6424.43Transient receptor potential cation channel subfam... [more]
trpa-13.903e-6424.43Transient receptor potential cation channel subfam... [more]
unc-444.361e-3928.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.361e-3928.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.278e-3728.02AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TrpA17.163e-17433.80gene:FBgn0035934 transcript:FBtr0331824[more]
TrpA11.253e-17233.60gene:FBgn0035934 transcript:FBtr0331823[more]
TrpA11.512e-16933.54gene:FBgn0035934 transcript:FBtr0331826[more]
TrpA11.948e-16833.33gene:FBgn0035934 transcript:FBtr0331825[more]
TrpA12.433e-16733.30gene:FBgn0035934 transcript:FBtr0331827[more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1a3.598e-15732.22transient receptor potential cation channel, subfa... [more]
trpa1b5.486e-15330.53transient receptor potential cation channel, subfa... [more]
trpa1b5.486e-15330.53transient receptor potential cation channel, subfa... [more]
trpa1b2.319e-14930.10transient receptor potential cation channel, subfa... [more]
ank3a3.635e-4527.67ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa15.200e-16033.21transient receptor potential cation channel, subfa... [more]
trpa16.161e-15633.27transient receptor potential cation channel, subfa... [more]
trpa12.461e-15432.88transient receptor potential cation channel, subfa... [more]
trpa16.652e-14933.09transient receptor potential cation channel, subfa... [more]
trpa19.638e-14732.91transient receptor potential cation channel, subfa... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpa11.885e-15731.81transient receptor potential cation channel, subfa... [more]
Trpa16.877e-15231.23transient receptor potential cation channel, subfa... [more]
Ank21.695e-4428.95ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank12.554e-4229.10ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank12.838e-4229.10ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z020|TRPA1_DROME1.953e-16733.33Transient receptor potential cation channel subfam... [more]
sp|Q8BLA8|TRPA1_MOUSE1.319e-15631.81Transient receptor potential cation channel subfam... [more]
sp|Q6RI86|TRPA1_RAT3.551e-15631.74Transient receptor potential cation channel subfam... [more]
sp|O75762|TRPA1_HUMAN7.312e-14731.17Transient receptor potential cation channel subfam... [more]
sp|Q18297|TRPA1_CAEEL4.965e-6324.43Transient receptor potential cation channel subfam... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A291IA190.000e+099.31Transient receptor potential cation channel subfam... [more]
I1ZIL00.000e+098.01Transient receptor potential cation channel subfam... [more]
A0A1S3HWE10.000e+034.49transient receptor potential cation channel subfam... [more]
A0A1S3HWH00.000e+034.70transient receptor potential cation channel subfam... [more]
A0A267H4H80.000e+035.31ANK_REP_REGION domain-containing protein OS=Macros... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1a6.587e-14931.85transient receptor potential cation channel subfam... [more]
trpa1a7.293e-14531.29transient receptor potential cation channel subfam... [more]
trpa1b2.030e-14030.66transient receptor potential cation channel subfam... [more]
trpa1b2.030e-14030.66transient receptor potential cation channel subfam... [more]
trpa1b1.241e-13731.00transient receptor potential cation channel subfam... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005975.11.604e-6430.56pep scaffold:Pmarinus_7.0:GL479470:1543:21127:-1 g... [more]
ENSPMAT00000000095.12.252e-4628.50pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.14.463e-4526.37pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.12.802e-4128.02pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000003991.12.207e-3927.07pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HOS46.808e-1138.21Subunit of the Set3 complex; complex is a meiotic-... [more]
PHO811.211e-1024.63Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
NAS61.382e-828.82Evolutionarily conserved 19S regulatory particle a... [more]
AKR11.512e-725.79Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO331802.745e-2925.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273546.598e-2422.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436907.017e-1631.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392891.174e-1520.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387024.345e-1525.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpa1b2.227e-14831.82transient receptor potential cation channel subfam... [more]
ankrd445.146e-4426.96ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ankrd441.026e-4326.96ankyrin repeat domain 44 [Source:NCBI gene;Acc:101... [more]
ank1b2.941e-4124.84ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000031565.18.327e-4128.46ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
back to top
BLAST of transient receptor potential cation channel subfamily A member-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035379.10.000e+099.05SMESG000035379.1[more]
SMESG000035379.10.000e+099.74SMESG000035379.1[more]
SMESG000026132.11.168e-6525.68SMESG000026132.1[more]
SMESG000026132.13.076e-6525.70SMESG000026132.1[more]
SMESG000078033.15.771e-6126.65SMESG000078033.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035258
GenBankAFJ24864.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035258 ID=SMED30035258|Name=transient receptor potential cation channel subfamily A member-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3622bp
AATTTCTAAAAACCGAAAAACCTCTTTCGGGAATTTTCTTGCTTCTGTTT
TGTTGGCTCAGTTGATAATTCGGAGAAAAAAGTCCCTAATGTGCATATGA
TAGAACTTGATGAAGAAATGCAGTTACATGATGAGGTTTGCCTAATGTCG
GACAATCCTAATAGACCTTTTCAATTTGCAGCTGCTGGGAATTGTATGGA
AATTGAGAAATTAATCATAGGAAATAGTGGAATAATTTCATCAAGTGACG
AAAACGGAATGACAATGATGCATTACGCAGCGGCAAACTCGCGTATCGAA
GTTATGGACGTTCTAATGATTTACCGGGCAGATAAAAATGCTAGAGACAG
TAACGGAAATACCCCAATACACCATGCAGTTTTGAACAATGAAATTAAAG
CTTTAACTTATTTAATCCTAAATGGAGCCGATCCAAATATACTGAACAAA
GATAATATGGCACCAATTCATTTAACAGTTTATAAAAGCAAATTGGACGT
ATTGAAAGAGCTGTTGAGGCATCCTGAAGTGAATCGAAATCAAACGACCT
CGTGTGGAAATAGTGCGATTCATATTGCATGTGAGATTGATAATCAGGAA
GCGCTAGACTGTCTATTGAAAGCTGGCGCGTTAGTCTGTAGTCCCAATGT
ATACGGTATATATCCTGTTCATGTGGCCATAAAATACTGCAACGAGAAGT
GTTTGGAAATGTTGGTGGAATCTAAAAATAAAAAAGGTTGTTCTCCAATG
CAAATTTTAAATTTTAGTGATAAAGAAGGAAATGTGCCCTTACATACGGC
AGTAAACACTGGAGACACAAAAGCTGTCCAAATGTGTCTCCACTATGGAG
CAAAAATTGACGTACGTCAAAATGACAACTCGACACCTTTGCACTATGCA
TGCACCAAGGGAGAATTAGATATAGTAAAGCTTATGCTTCGAACGCGACA
TGAAGTAAAGGATGTTGTATTAAAAATCCAAGACAACAATGGCCATACTC
CTCTTCACAAAGCTGTGATGTTCAATCATGTAGAACTGGCTGAGTATTTA
ATCGAAGAGGGCTCAAATATTGAAGTTACAGATGATAACGGTTGGACCCC
ACTTCTTTTGGCAGCTTCACGATTAAATATGGAAGTTTTTAAGACGTTAC
TTAAATATGGCGCTAATATATACGCTCGGGATAAAACTCAAAGAAATCTA
ATTCACCTTTTTTCACTGAATGTAGTGAATGACAAAGTTAATTTTTTGAT
GGGGTTGGAAAAGATTCAACAGTCATTTATTAGTATAATAAATGAAAAAG
ATAACATGGGGTGTACCCCATTGCATTATAGTACAAGACGAGGACTGTTG
AGACTCACAGGAATTCTTATCAAATTAGGAGGTCTTTGTATGACTCAAAA
TAATGATAAAGATACGCCTTTGCATTTTGCTGCTCGATATGGTCGAGTGC
ACACTTGCCGAAGACTTTTGAATACTTTCGATGGAATGAAAGCAATGAAT
TCTACAGACTCATTTGGGAGGTTGCCAATTCATGCTGCAGCGGAAAATGG
TCACACGAAAATTATTCAAATGCTGCTTGATCGTGGATGTATATTTCACA
GGTGCTATCACGGAAATACGCCATTACATTATGCTGCTACCAACGGCCAT
ATTGAGACCTGTCAATATTTAATAGAAATGAATCCATCGCTTTTAGATAA
TCAAAATCACGAAGGGAAAACAGCTCTACATAATGCCGCAATAAATGATA
AATCCCATGTAGTTGGACTCTTACTAACTCACGGAGCTTCGATTTTCAAA
GACAAACAAGGACTAACGTTTTTCACTCATATTCTCAAGTTGAAGAATCT
TAATACGGCCAAAGAAGTCGTGTTTAACAATAGGTGGGAAGAAGTCGTGC
GTATAGTTGATGAAAATGGTATTTGTCCAGTAATCGGAATGATCAAAGAT
ATGCCAAATATTCTTTCGTTGGCTATGGACAAGAGTATTAAAACTGAAGG
TAGCAGAGGTCAAAAGGATTTTAAAATTATCTACAACTTTGGGATTCTTC
AAAGAACAGTTGCTTCAAAAGAAGATTTGAATAGTGATCCTTTTTATGTG
GTGAAGACAATGGTTGACCTAAATCGTATGGACCTGCTTATGCATCCATT
GAGTACAGCATATTTGAAAATGAAATGGGAAAGATTTGGAAGATGGGTTC
AATATTTGATTATGCTATTATATATTATATTTTTGTCCGCTTTATCCTTT
AACACTTACGCCATTACGTTTACAGCTTTGAGTCATGTCGACAAAAACAT
TAGCACCTCCGCCGAATGTAGCAATATTGATATTTTTTATGGACATGAAA
CAGCGAAAAAGGCTGTTTTGGTTATGGCAATGATAACTATGTGCTATAGT
ATTGTGAATTTGATAAAGGAAAGTCATCCAATATTTACAAAAACTTTGGC
TTATTTTACCAGCTTCCAAAACTACATGACTTTAGTTTTGCATATCACGA
GCATTATTCTGTCCAGCTATATCATACGGATGGATATCAATCATACGACA
ATGCAAGTTGCAGCAGTCACTATTTTCCTCGGATGGTTCAATTTGTTGCT
TCTGCTGTTCCACTTTGAAAAAATCGGTTTATTTGTAATAATGTTTGTAC
AGATCTTGAATACGGTCCTAATGGTGTTGGCAATTTTCAGCATTTTATTC
ATTGGATTTGCGTTCTCTTTTGTCATTCTATTCAAAGCTCCAACGAGCAG
TGAGATTCTATCAAATCAACCTATGTTCAATCAGTGCTATCAGGCATATT
CATCAAATAAATTAGAACCGGCAATCAGAGTATGGCAAGAACTTCCCTCT
GGTCTCATGAAGGCTGTGGTTATGATGATGGGAGAGATTGAATTTCTTAA
CACTTATGTCACTCCGTTATATGATGGGAATGTATACACGCTGCACTACC
CAACCCTAACTTATATATTCTTATTAGTTTTCATTATATTTATGTCACTA
CTATTAATGAATTTGCTGATTGGTCTAGCAGTCGGTGACATAGAAGCAGT
ACAAAAAAATGCTAATTTAAAGAGAATATCTTTACAAGTTTCTTGGTTAT
CTGAATTTGAAGGTAAACTGCCCATGAAAATTAGAAACTGGGCCTTTAAA
GAAATATGGGAAGTATTTCCATATCGATGTCCTACTTATAAAATTTGCTC
ATCAGAAGCTCAAGTTATTTATAAGAAAAATGATTATGAGGAATCAAGGG
ATTTGGGAAATCTGTTCGAAACTCTAAACACTCACGAAAAACAATTATAC
AACCTTATGGTGGACTCTCATCAACAGACAGACTTGTTGAAATTGATATT
ACAAAAAATGGAAATGGATCCAGAGGCTGAAATAAGTGACAACATAATTC
CTGAAATGGCCGGATTTTCAAAAAATTGGAAAACCGTTATTGCATCAAAA
AGCATTATTTGCAAAATGCAGAAATCTGTCAAACCAGATAACAATTTTTA
AACTTTAATCAAAACTCACTTATCAAATATTATTTATTGCACCATTTCAA
TCTCATTCGTAACATTTTTGTTGTAAAATTACTTTTGATTATATTATTAT
TATATATTGTCGAGTTTTAAAA
back to top

protein sequence of SMED30035258-orf-1

>SMED30035258-orf-1 ID=SMED30035258-orf-1|Name=SMED30035258-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1135bp
MIELDEEMQLHDEVCLMSDNPNRPFQFAAAGNCMEIEKLIIGNSGIISSS
DENGMTMMHYAAANSRIEVMDVLMIYRADKNARDSNGNTPIHHAVLNNEI
KALTYLILNGADPNILNKDNMAPIHLTVYKSKLDVLKELLRHPEVNRNQT
TSCGNSAIHIACEIDNQEALDCLLKAGALVCSPNVYGIYPVHVAIKYCNE
KCLEMLVESKNKKGCSPMQILNFSDKEGNVPLHTAVNTGDTKAVQMCLHY
GAKIDVRQNDNSTPLHYACTKGELDIVKLMLRTRHEVKDVVLKIQDNNGH
TPLHKAVMFNHVELAEYLIEEGSNIEVTDDNGWTPLLLAASRLNMEVFKT
LLKYGANIYARDKTQRNLIHLFSLNVVNDKVNFLMGLEKIQQSFISIINE
KDNMGCTPLHYSTRRGLLRLTGILIKLGGLCMTQNNDKDTPLHFAARYGR
VHTCRRLLNTFDGMKAMNSTDSFGRLPIHAAAENGHTKIIQMLLDRGCIF
HRCYHGNTPLHYAATNGHIETCQYLIEMNPSLLDNQNHEGKTALHNAAIN
DKSHVVGLLLTHGASIFKDKQGLTFFTHILKLKNLNTAKEVVFNNRWEEV
VRIVDENGICPVIGMIKDMPNILSLAMDKSIKTEGSRGQKDFKIIYNFGI
LQRTVASKEDLNSDPFYVVKTMVDLNRMDLLMHPLSTAYLKMKWERFGRW
VQYLIMLLYIIFLSALSFNTYAITFTALSHVDKNISTSAECSNIDIFYGH
ETAKKAVLVMAMITMCYSIVNLIKESHPIFTKTLAYFTSFQNYMTLVLHI
TSIILSSYIIRMDINHTTMQVAAVTIFLGWFNLLLLLFHFEKIGLFVIMF
VQILNTVLMVLAIFSILFIGFAFSFVILFKAPTSSEILSNQPMFNQCYQA
YSSNKLEPAIRVWQELPSGLMKAVVMMMGEIEFLNTYVTPLYDGNVYTLH
YPTLTYIFLLVFIIFMSLLLMNLLIGLAVGDIEAVQKNANLKRISLQVSW
LSEFEGKLPMKIRNWAFKEIWEVFPYRCPTYKICSSEAQVIYKKNDYEES
RDLGNLFETLNTHEKQLYNLMVDSHQQTDLLKLILQKMEMDPEAEISDNI
IPEMAGFSKNWKTVIASKSIICKMQKSVKPDNNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000080peripheral nervous system
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000141dorsal region of the whole animal
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane