Sodium dependent neurotransmitter transporter

Overview
NameSodium dependent neurotransmitter transporter
Smed IDSMED30035254
Length (bp)1840
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium dependent neurotransmitter transporter (SMED30035254) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium dependent neurotransmitter transporter (SMED30035254) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium dependent neurotransmitter transporter (SMED30035254) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium dependent neurotransmitter transporter (SMED30035254) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035254

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30035254h1SMcG0005912 Contig1620GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30035254h1SMcG0005912 Contig1620GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035254h1SMcG0005912 Contig1620GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035254h1SMcG0005912 Contig153GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30035254h1SMcG0005912 Contig153GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30035254h1SMcG0005912 dd_Smed_v4_7447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Human
Match: SLC6A1 (solute carrier family 6 member 1 [Source:HGNC Symbol;Acc:HGNC:11042])

HSP 1 Score: 90.5077 bits (223), Expect = 2.074e-18
Identity = 88/376 (23.40%), Postives = 166/376 (44.15%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN------------------------------WSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNL--ELQTITLMGF 1148
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    +PL ++E ++G+Y+ +  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y     +LP ++ +    + + F ++   N                              W   +   + +I +   +  G+    KV          +L+ +FF   TLP ++ G  F  T ++  L++  ++LDA +Q  F      G + A   Y +  N++ R S+ +  +N+  S+ A   IF ++ G M      +T+  I  +      +G GL F+  P  +  + +   +   +FF  L   GI S +++L   L+  T+ GF
Sbjct:   54 LMSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAV--LSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIF-SIVGFMA----HVTKRSIADV----AASGPGLAFLAYPEAVTQLPI-SPLWAILFFSMLLMLGIDSQVADLCSHLKFCTVEGF 413          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Human
Match: SLC6A1 (solute carrier family 6 member 1 [Source:HGNC Symbol;Acc:HGNC:11042])

HSP 1 Score: 86.6557 bits (213), Expect = 3.951e-17
Identity = 84/365 (23.01%), Postives = 158/365 (43.29%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN------------------------------WSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    +PL ++E ++G+Y+ +  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y     +LP ++ +    + + F ++   N                              W   +   + +I +   +  G+    KV          +L+ +FF   TLP ++ G  F  T ++  L++  ++LDA +Q  F      G + A   Y +  N++ R S+ +  +N+  S+ A   IF ++ G M      +T+  I  +      +G GL F+  P  +  + +   +   +FF  L   GI S    +E
Sbjct:   54 LMSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAV--LSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIF-SIVGFMA----HVTKRSIADV----AASGPGLAFLAYPEAVTQLPI-SPLWAILFFSMLLMLGIDSQFCTVE 402          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Human
Match: SLC6A1 (solute carrier family 6 member 1 [Source:HGNC Symbol;Acc:HGNC:11042])

HSP 1 Score: 86.6557 bits (213), Expect = 3.951e-17
Identity = 84/365 (23.01%), Postives = 158/365 (43.29%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN------------------------------WSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    +PL ++E ++G+Y+ +  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y     +LP ++ +    + + F ++   N                              W   +   + +I +   +  G+    KV          +L+ +FF   TLP ++ G  F  T ++  L++  ++LDA +Q  F      G + A   Y +  N++ R S+ +  +N+  S+ A   IF ++ G M      +T+  I  +      +G GL F+  P  +  + +   +   +FF  L   GI S    +E
Sbjct:   54 LMSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAV--LSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIF-SIVGFMA----HVTKRSIADV----AASGPGLAFLAYPEAVTQLPI-SPLWAILFFSMLLMLGIDSQFCTVE 402          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Human
Match: SLC6A1 (solute carrier family 6 member 1 [Source:HGNC Symbol;Acc:HGNC:11042])

HSP 1 Score: 86.6557 bits (213), Expect = 3.951e-17
Identity = 84/365 (23.01%), Postives = 158/365 (43.29%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN------------------------------WSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    +PL ++E ++G+Y+ +  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y     +LP ++ +    + + F ++   N                              W   +   + +I +   +  G+    KV          +L+ +FF   TLP ++ G  F  T ++  L++  ++LDA +Q  F      G + A   Y +  N++ R S+ +  +N+  S+ A   IF ++ G M      +T+  I  +      +G GL F+  P  +  + +   +   +FF  L   GI S    +E
Sbjct:   54 LMSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAV--LSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIF-SIVGFMA----HVTKRSIADV----AASGPGLAFLAYPEAVTQLPI-SPLWAILFFSMLLMLGIDSQFCTVE 402          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Human
Match: SLC6A1 (solute carrier family 6 member 1 [Source:HGNC Symbol;Acc:HGNC:11042])

HSP 1 Score: 86.6557 bits (213), Expect = 3.951e-17
Identity = 84/365 (23.01%), Postives = 158/365 (43.29%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN------------------------------WSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    +PL ++E ++G+Y+ +  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y     +LP ++ +    + + F ++   N                              W   +   + +I +   +  G+    KV          +L+ +FF   TLP ++ G  F  T ++  L++  ++LDA +Q  F      G + A   Y +  N++ R S+ +  +N+  S+ A   IF ++ G M      +T+  I  +      +G GL F+  P  +  + +   +   +FF  L   GI S    +E
Sbjct:   54 LMSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAV--LSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWILVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIF-SIVGFMA----HVTKRSIADV----AASGPGLAFLAYPEAVTQLPI-SPLWAILFFSMLLMLGIDSQFCTVE 402          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Celegans
Match: dat-1 (Sodium-dependent dopamine transporter [Source:UniProtKB/Swiss-Prot;Acc:Q03614])

HSP 1 Score: 76.2554 bits (186), Expect = 2.924e-14
Identity = 100/423 (23.64%), Postives = 159/423 (37.59%), Query Frame = 3
Query:   72 VNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIR-----CIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-----------------------------SEEVESQKI---------------------------FDDFVKSNWS-----FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICL-------SFAGISSLISNLE 1121
            VN E  K+   + +      + S +G  +  GNIWRFP +  +N    G   F I ++I +    +PL  +E  +G+Y R   I      C  +    KGI  G  +    F++  +Y VIL W L+Y+Y     +LP                             ++ V ++KI                             D     W      FV + +C+     S+  GI    KV          +L  +F    TLP  + G ++    ++  L  PS++ DA +Q  F      G++ AY+ Y    N++   +LF   +N   S L+   IF +V G M  K+           I+     G GL F+  P  L TM  +      +FF+ L       SF G  ++I+ L 
Sbjct:   31 VNTE-PKDPAREQWSGKLDFLLSVVGFAVDLGNIWRFPYLCFKN----GGGVFLIPYSIMVLLTGVPLFYMELCLGQYYRKGAITTWGRICPLF----KGI--GYCVILTAFYVDFFYNVILAWGLHYLYTSFSFNLPWASCNNSYNSPACYEPHWSEDGTAMCRSANQSVSAEKISAAEEYFYKGFLGLHEANAPNSHVIRSVTDLGNVRWDIALSLFVVYLICYF----SMWKGIHTSGKVVWFTALFPYVVLGILFIRGVTLPGWQNGIEYYLRPNFEMLKRPSVWQDAATQVFFSLGPGFGVLMAYSSYNDFHNNVYVDALFTSFINCATSFLSGFVIF-SVLGYMSCKSG--------KPIEAVAQEGPGLVFVVYPEALSTM-PYAPFWSVLFFLMLMTLGLDSSFGGSEAIITGLS 428          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Celegans
Match: snf-2 (Transporter [Source:UniProtKB/TrEMBL;Acc:P90890])

HSP 1 Score: 70.8626 bits (172), Expect = 1.692e-12
Identity = 43/126 (34.13%), Postives = 69/126 (54.76%), Query Frame = 3
Query:   72 VNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRY-SRVPPIRCIFYFFGKKGIILGGWIT-FVNFFIGAYYMVILGWCLYYI 443
            + VE T  +  +  +S    + S LG  IG GNIWRFP +  +N    G   F I++ IC F +++P + +E+A+G+Y ++ PP          +G+   GW+T  V   IG YYM+++ W + YI
Sbjct:  102 IQVENTDRQAFRGIES----LLSSLGQAIGLGNIWRFPTVAYQN----GGTSFLIVYIICAFVFAVPAIHMEFALGQYAAKSPPAVFRRIMPALEGV---GWMTCIVGAVIGVYYMILISWIVLYI 216          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Celegans
Match: snf-7 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EE39])

HSP 1 Score: 62.7734 bits (151), Expect = 5.717e-10
Identity = 37/107 (34.58%), Postives = 59/107 (55.14%), Query Frame = 3
Query:  135 FSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRY-SRVPPIRCIFYFFGKKGIILG-GWIT-FVNFFIGAYYMVILGWCLYYIY 446
             S LG  +G GNIWRFP    +N    G   F I + +C   +++P + +E+A+G+Y ++ PP      F     I+ G GW+T  V   IG YYM+++ W + Y++
Sbjct:   76 LSSLGQAVGLGNIWRFPTTAYKN----GGLSFLIAYVVCGILFAVPAIHMEFALGQYAAKSPPAA----FRRMMPILEGVGWMTCLVGAIIGVYYMIVISWIVLYLF 174          

HSP 2 Score: 54.6842 bits (130), Expect = 1.774e-7
Identity = 83/367 (22.62%), Postives = 161/367 (43.87%), Query Frame = 3
Query:  453 IKMSLPSEE------VESQKIFDDFVKSNWSFVPF----TLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTG--------DWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQ-TGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMG---FGIKRRW-SVLIIVASMFLFGSASVAELKFL---VNQDFVWGFSLIV-SGLIYISLVIRYGPFNFRTKIVN---EQKFKHDFNL---PYIWVIVISVLAPIQAVALLIWWIYSE 1454
            +K+++ +E+      V+    F DF   N   VP      +C++   +S++ G+K I K++   V +   I++ +     TL  +  G  FLF G        D+  L +P +++ A+ Q  F  +   G +     Y  K  +  R +  + + + L+SLL    +F T+  L   +  +I+   G   +++     G  L FI     +  M  +  +  ++FF+ L   GIS+ I  +E     L     +  + RW +V+ +  + FL G    ++  F    +  ++  G S  + + ++ +++   YG  NFR  I     E + + D  L    Y+W IV   + PI  + ++  WI+ +
Sbjct:  243 MKLAVGTEQFFTNFVVKPSTGFTDFNSIN---VPMLAAVAVCWVIAIISLIRGMKAIGKLSYYTVLLPYAIIIALMIRGLTLEGASTGLHFLFWGKPNEYGHYDFAGLYDPDVWIAALMQMCFSLSIGQGGLMNIGSYNKKTYNWYRDAYLVVLCDTLMSLLGGTAVFSTLGFLAEQRNISISNPKGFNEVVQ----EGHALAFIVYTEAIAQM-PYPFLWYALFFVMLFLLGISTEIVIIETVCSCLADRFHYLRQHRWITVVTVSTTFFLLGLVMTSDAGFYWFDLYDEYSAGVSATIGTAIMCLTVCWCYGLDNFRADIREMWEEPESRLDKYLGPGAYVWTIVWRFVTPICCLVIMFAWIWDK 601          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Celegans
Match: snf-11 (Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43])

HSP 1 Score: 55.4546 bits (132), Expect = 1.041e-7
Identity = 42/134 (31.34%), Postives = 59/134 (44.03%), Query Frame = 3
Query:   78 VEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVP-----PIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMS 464
            VE T     + + S A  I SC+G  IG GN+WRFP +  +N    G   F I + I L     PL ++E + G+   V       I  IF   G    ++  W+         YY+V+L W   Y+Y    MS
Sbjct:    2 VEATSVAEREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQN----GGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLGMFKICPIFKGVGIAAAVMAFWLNI-------YYIVVLSWAATYLYNSFTMS 124          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Celegans
Match: snf-9 (Transporter [Source:UniProtKB/TrEMBL;Acc:Q9XUG5])

HSP 1 Score: 55.0694 bits (131), Expect = 1.263e-7
Identity = 36/107 (33.64%), Postives = 56/107 (52.34%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSR-VPPIRCIFYFFGKKGIILG-GWITF-VNFFIGAYYMVILGWCLYYI 443
            + S LG  +G GNIWRFP     N    G + F + +  C   + +P + +E+ +G+Y R   PI  IF  F    I+ G GW+   V+  +  YY++I+GW   Y+
Sbjct:   61 LLSTLGMAVGLGNIWRFPTRAYNN----GGSAFLVPYVACALLFGLPAVYLEFLLGQYHRTTAPI--IFRRFAP--ILQGVGWMAVAVSSLVAIYYIIIIGWSTVYM 159          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0072362)

HSP 1 Score: 103.219 bits (256), Expect = 9.835e-23
Identity = 129/522 (24.71%), Postives = 220/522 (42.15%), Query Frame = 3
Query:   93 EKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIR-----CIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP----------------------------SEEVESQKIFDDFVKSNWSFV-----PFTLC----FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCS-IFFICLSFAGISSLISNLELQTITLMG-----FGIKRRWSVLIIVASMFLFGSASVAELK-FLVNQDFVWGFSLIVSGLIYISLVIR---YGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWI--YSEIIENPKSWYIPQWN 1496
            E+  +++   A  + + +G  +  GN+WRFP I  +N    G   F + + + L    +PL  +E A+G++ R   +      C       KG+  G  I  ++ ++G YY  I+GW +YY++      LP                            ++E   +K+ + +  +   F+        LC    F+ +  S+  G++   KV  V       +L+ +     +LP ++ G K+  T +W  L N  +++DA SQ  F      G + A + Y    N+  R +L    +N L S LA   IF +V G M      + +T I  +    GL G GL FI  P  + TM   G V  S IFF+ L   G+ S    LE     L        G +R   VL+++A +FL    ++      LVN   V+G  L +  ++++        YG   F + +  EQ       L   W I  + ++P+  + + I+ I  Y E++   + +Y P W+
Sbjct:   71 ERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQN----GGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICP----ALKGV--GYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFTELATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIF-SVLGYMAY----VQKTSIDKV----GLEGPGLVFIVYPEAIATMS--GSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDV--EQMLGSKPGL--FWRICWTYISPVFLLTIFIFSIMGYKEMLG--EEYYYPDWS 565          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Fly
Match: SerT (gene:FBgn0010414 transcript:FBtr0343316)

HSP 1 Score: 103.219 bits (256), Expect = 9.835e-23
Identity = 129/522 (24.71%), Postives = 220/522 (42.15%), Query Frame = 3
Query:   93 EKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIR-----CIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP----------------------------SEEVESQKIFDDFVKSNWSFV-----PFTLC----FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCS-IFFICLSFAGISSLISNLELQTITLMG-----FGIKRRWSVLIIVASMFLFGSASVAELK-FLVNQDFVWGFSLIVSGLIYISLVIR---YGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWI--YSEIIENPKSWYIPQWN 1496
            E+  +++   A  + + +G  +  GN+WRFP I  +N    G   F + + + L    +PL  +E A+G++ R   +      C       KG+  G  I  ++ ++G YY  I+GW +YY++      LP                            ++E   +K+ + +  +   F+        LC    F+ +  S+  G++   KV  V       +L+ +     +LP ++ G K+  T +W  L N  +++DA SQ  F      G + A + Y    N+  R +L    +N L S LA   IF +V G M      + +T I  +    GL G GL FI  P  + TM   G V  S IFF+ L   G+ S    LE     L        G +R   VL+++A +FL    ++      LVN   V+G  L +  ++++        YG   F + +  EQ       L   W I  + ++P+  + + I+ I  Y E++   + +Y P W+
Sbjct:   71 ERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQN----GGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICP----ALKGV--GYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFTELATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIF-SVLGYMAY----VQKTSIDKV----GLEGPGLVFIVYPEAIATMS--GSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDV--EQMLGSKPGL--FWRICWTYISPVFLLTIFIFSIMGYKEMLG--EEYYYPDWS 565          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0077447)

HSP 1 Score: 93.9745 bits (232), Expect = 1.023e-19
Identity = 91/398 (22.86%), Postives = 173/398 (43.47%), Query Frame = 3
Query:   66 MDVNVEITKEKP-PKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGK-----KGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP---------------------------SEEVESQKIFDDFVKS-----------NWSFVPFTLC-FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLEL 1124
            +D++ E  + KP  + + +    + +C+G  +G GN+WRFP +  ++    G   F + + I LF  SIPLL +E ++G+Y+   PI  +    G+     KG  L   +  V+F +  YY VI+G+ +YY +   K  +P                           +    S++ F++ V              W      +C ++ +  +    IK   KV          +++ +   + TL  +  G +F F   W+ L N +++++A SQN        G + ++A Y    N+I+R ++ +  VN + SLL  +  F T+  L + +      T +  +I      G G+ F+  P  +  M  + ++   +FF  L   G++S  + +E+
Sbjct:   39 LDMSDETAQLKPRQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKS----GGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGAL----GQLCPLFKGAGLASVV--VSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQN-----TNVRDVIGD----GPGMIFVVYPQAMAKM-PYAQLWAVMFFFMLLCLGLNSQFAIVEV 416          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0077448)

HSP 1 Score: 91.6633 bits (226), Expect = 7.937e-19
Identity = 90/394 (22.84%), Postives = 170/394 (43.15%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSF-QSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGK-KGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP---------------------------SEEVESQKIFDDFVKS-----------NWSFVPFTLC-FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLEL 1124
            +D++ E  + KP +    +    + +C+G  +G GN+WRFP +  ++    G   F + + I LF  SIPLL +E ++G+Y+   PI  +       KG  L   +  V+F +  YY VI+G+ +YY +   K  +P                           +    S++ F++ V              W      +C ++ +  +    IK   KV          +++ +   + TL  +  G +F F   W+ L N +++++A SQN        G + ++A Y    N+I+R ++ +  VN + SLL  +  F T+  L + +      T +  +I      G G+ F+  P  +  M  + ++   +FF  L   G++S  + +E+
Sbjct:  324 LDMSDETAQLKPRQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKS----GGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVV--VSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQN-----TNVRDVIGD----GPGMIFVVYPQAMAKM-PYAQLWAVMFFFMLLCLGLNSQFAIVEV 701          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Fly
Match: ine (gene:FBgn0011603 transcript:FBtr0301408)

HSP 1 Score: 91.6633 bits (226), Expect = 7.937e-19
Identity = 90/394 (22.84%), Postives = 170/394 (43.15%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSF-QSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGK-KGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP---------------------------SEEVESQKIFDDFVKS-----------NWSFVPFTLC-FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLEL 1124
            +D++ E  + KP +    +    + +C+G  +G GN+WRFP +  ++    G   F + + I LF  SIPLL +E ++G+Y+   PI  +       KG  L   +  V+F +  YY VI+G+ +YY +   K  +P                           +    S++ F++ V              W      +C ++ +  +    IK   KV          +++ +   + TL  +  G +F F   W+ L N +++++A SQN        G + ++A Y    N+I+R ++ +  VN + SLL  +  F T+  L + +      T +  +I      G G+ F+  P  +  M  + ++   +FF  L   G++S  + +E+
Sbjct:  324 LDMSDETAQLKPRQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKS----GGGVFLVPYCIILFICSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVV--VSFLMSTYYSVIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRTPSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSAKVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWINAASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIFAFSTLGNLALEQN-----TNVRDVIGD----GPGMIFVVYPQAMAKM-PYAQLWAVMFFFMLLCLGLNSQFAIVEV 701          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Zebrafish
Match: slc6a18 (solute carrier family 6 member 18 [Source:ZFIN;Acc:ZDB-GENE-080219-9])

HSP 1 Score: 102.834 bits (255), Expect = 1.729e-22
Identity = 86/311 (27.65%), Postives = 133/311 (42.77%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVP-------------------------FTLCFI----FISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD   E +  +    + +    + +C+G  +G GNIWRFP +        G   F I + I L    +PLL +E AIG+  R   I     I    G  G+        V+F +G +Y  IL W L+Y +   +  LP  +       + +V+   S  P                           LC       + +  + GI+ I K   V       +L      + TLP +  G ++LFT DW+ L NP ++LDA +Q  F  + A G + A++ Y  K+N   R +LF+ I+N+  SL AS+ IF
Sbjct:    1 MDTASETSSVQERPKWDNKVQYLLTCVGFAVGLGNIWRFPYLCQI----YGGGAFLIPYLIALVFEGLPLLYLELAIGQSLRKGSIGVWHSISPLLGGVGVA----SMVVSFLVGLFYNTILAWVLWYFFHSFEDPLPWSQCPINDNLEGYVEECVSSTPVNYYWYRQTLNISPDIEQSGSLQWTLVLCLATAWSIVYICFIRGIETIGKAVYVTATFPYLVLTIFLVRALTLPGATDGLQYLFTPDWSLLTNPQVWLDAATQIFFSLSLAFGGLIAFSSYNPKKNDCERDALFVGIINSATSLYASIPIF 303          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Zebrafish
Match: slc6a19a.1 (solute carrier family 6 member 19a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-070620-2])

HSP 1 Score: 92.4337 bits (228), Expect = 4.115e-19
Identity = 103/440 (23.41%), Postives = 176/440 (40.00%), Query Frame = 3
Query:   75 NVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP----------------------------SEEVESQKIFDDFVKSNWSFVPFTLC-FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTV----------------------FGL----------------MMLKTPTITQ-----TGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFG-IKRRW 1166
             +E+ +      + + A  + +C+G  +G GN+WRFP +   +    G   F I + I L    +PLL +E+AIG+  R   +   R I  +    GI         +F +G YY  I+ W ++Y++  ++  LP                             E + +    +D     W  V   LC + F+ +  + GI+   K   +   +   +L      + TL  S  G KFLFT D   L NPS +LDA +Q  F  + A G + +++ Y +  N+  + ++ I I+N L S+ ++  I+  +                      F L                + +  P I Q     T  +  +   G+ GTGL FI     +  M V   +   +FFI L   G+S++  N+E   + L     + +RW
Sbjct:   22 KLELQEAGERPKWDNKAQYMLTCVGFCVGLGNVWRFPYLCQSH----GGGAFMIPFLILLVLEGVPLLHLEFAIGQRLRSGSVGVWRSISPYLTGVGIA----SMLASFIVGMYYNTIMAWVMWYLFNSLQEPLPWSQCPVNLNRTGLVSECERSSPVDYFWYRETLNTSTAIEDSGALQWWLVLCLLCAWTFLYICCIRGIETTGKAVYITSTLPYVVLTIFLIRALTLKGSVNGIKFLFTPDVNELMNPSTWLDAGAQVLFSFSLAFGGLISFSSYNSVHNNCEQDAVTISIINGLTSVYSATVIYSIIGFRATENYDICLDSNILSLLNAFDLPEGSITENNYTVALQQLNISRPDIIQELQLKTCDMQTLLSEGVEGTGLAFIVFTEAITKMPV-SPLWSVLFFIMLFCLGLSTMFGNIEGVVVPLQDLNLLPKRW 452          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Zebrafish
Match: slc6a7 (solute carrier family 6 member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-1492])

HSP 1 Score: 89.3521 bits (220), Expect = 3.629e-18
Identity = 106/368 (28.80%), Postives = 154/368 (41.85%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSL----------------------PSEEVESQKI--------FDDFVKSNWSFVPFTLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSI-FFICLSFAGISSLISNLE 1121
            + SC+G  +G GN+WRFP +  RN    G   F I + I LF   +PL ++E ++G+Y    PI   +C       KGI +G  +  V+  +  YY VI+ W  YY+    +  L                      PSE   ++K+          D     W   P  LC     I I + +L GI    KV  V       +LL +     TL  S  G  F  T  W  LA+  ++ DA SQ  +      G + + A Y   +N++IR ++ I I N   S  A   IF ++ G M  K         V + K    +G GL F+  P  L  +   G V  SI FF+ L   G+ +L  N+E
Sbjct:   81 LLSCIGYCVGLGNVWRFPYLCYRN----GGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLL---KGIGIG--MLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWSCDALQNIALCANKTNSTQSPSEVFWNEKVLGVVHSTGLSDPGPVRW---PLALCLLAAWIIIFLCMLKGIHSSGKVVYVTATFPYFVLLVLIIRGATLEGSLDGVAFYLTPKWDQLADAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITIGNCSTSFFAGFAIF-SILGHMAFKKG-------VPVDKVAD-SGPGLAFVAYPEALALLP--GSVFWSILFFLMLFMLGVDTLFGNME 425          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Zebrafish
Match: slc6a22.1 (solute carrier family 6 member 22, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-629])

HSP 1 Score: 88.9669 bits (219), Expect = 4.787e-18
Identity = 109/415 (26.27%), Postives = 177/415 (42.65%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC---IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEV------ESQKIFDDFVKS-NWSFV---------------------PFTLCFIFISV----SVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE--LQTITLMG-----FGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDF 1250
            I +  G +IG GN+WRFP +  +N    G   FFI + + LF   IPL ++E A+G+Y+    + C   I   F  +G+  G  +  V  +  AYY++IL W  +Y++      LP          E+   FD    + N SF+                        LC +   V     V  G+K   KV          +L+ +     TLP +  G  F    +   LA+P +++DA +Q  +  A   G +TA   Y    N+  +  +++ ++N+  S +A   IF +V G M L+     Q   ++++     +G GL FI  P  +  M +  ++    FF+ +   G+ S    LE  +  IT M       G +R+  +L+I  + FL G   V E    V Q F
Sbjct:   40 ILAVAGQIIGLGNVWRFPYLCYKN----GGGVFFIPYVVFLFACGIPLFLMETALGQYTSQGSVTCWRKICPLF--EGLGYGSQV--VVLYSSAYYIIILAWAFFYLFSSFSGELPWASCRNWWNSENCVEFDRMQGAKNLSFMANASSPVKEFWDVNELGSVRWELALCLLLAWVICYFCVWKGVKSTGKVVYFTATFPYVMLMVLLIRGLTLPGAIDGITFYLYPNPARLADPQVWMDAGTQIFYSYALCIGCLTALGSYNKYNNNCYKDCVYLCLLNSGTSFVAGFAIF-SVLGFMALE-----QGVDISVVAE---SGPGLAFIAYPRAVAMMPM-AQLWSICFFLMIILLGLDSEFVGLESLMTAITDMNPNFFLQGHRRKLFLLVICIACFLIGLLMVTEGGLYVFQLF 436          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Zebrafish
Match: slc6a22.1 (solute carrier family 6 member 22, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-629])

HSP 1 Score: 88.9669 bits (219), Expect = 4.787e-18
Identity = 109/415 (26.27%), Postives = 177/415 (42.65%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC---IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEV------ESQKIFDDFVKS-NWSFV---------------------PFTLCFIFISV----SVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE--LQTITLMG-----FGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDF 1250
            I +  G +IG GN+WRFP +  +N    G   FFI + + LF   IPL ++E A+G+Y+    + C   I   F  +G+  G  +  V  +  AYY++IL W  +Y++      LP          E+   FD    + N SF+                        LC +   V     V  G+K   KV          +L+ +     TLP +  G  F    +   LA+P +++DA +Q  +  A   G +TA   Y    N+  +  +++ ++N+  S +A   IF +V G M L+     Q   ++++     +G GL FI  P  +  M +  ++    FF+ +   G+ S    LE  +  IT M       G +R+  +L+I  + FL G   V E    V Q F
Sbjct:   40 ILAVAGQIIGLGNVWRFPYLCYKN----GGGVFFIPYVVFLFACGIPLFLMETALGQYTSQGSVTCWRKICPLF--EGLGYGSQV--VVLYSSAYYIIILAWAFFYLFSSFSGELPWASCRNWWNSENCVEFDRMQGAKNLSFMANASSPVKEFWDVNELGSVRWELALCLLLAWVICYFCVWKGVKSTGKVVYFTATFPYVMLMVLLIRGLTLPGAIDGITFYLYPNPARLADPQVWMDAGTQIFYSYALCIGCLTALGSYNKYNNNCYKDCVYLCLLNSGTSFVAGFAIF-SVLGFMALE-----QGVDISVVAE---SGPGLAFIAYPRAVAMMPM-AQLWSICFFLMIILLGLDSEFVGLESLMTAITDMNPNFFLQGHRRKLFLLVICIACFLIGLLMVTEGGLYVFQLF 436          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 92.0485 bits (227), Expect = 7.302e-19
Identity = 118/456 (25.88%), Postives = 180/456 (39.47%), Query Frame = 3
Query:   93 EKPPKSFQSVAG---VIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP------------------------SEEVESQKI--------FDDFVKSNWSFVPFTLCFI----FISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFA-GISSLISNLE-LQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVS-----GLIYISLVIRYG 1313
              PP    +  G    + SC+G  +G GN+WRFP +  RN    G   F I ++I LF   +PL ++E ++G+Y    PI   +C       KGI +G  +  V+  +  YY VI+ W  YY+    +  LP                        +E   ++K+          D     W      LC +     I + +L GI    K+          +++ +     TL  S  G +F  T DW  L +  ++ DA SQ  +      G + + A Y    N++IR +L I I N   S  A   IF  +  +   K   + Q            +G GL F+  P  L  +   G V  SI F  + F  G+ +L  N+E + T  L      R W    I      F    +  L  L+ Q  ++ F+LI S     GLI I+L +  G
Sbjct:    4 RTPPDQSLTWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRN----GGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPIL---KGIGIG--MLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQNGTSNGSQFSATEAFWNEKVLGVTHSSGLGDPGPVGWELA---LCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVAD---------SGPGLAFVAYPEALALLP--GSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLL--LITQGGIYWFTLIDSYSTSFGLIIIALFMCLG 434          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Xenopus
Match: rmnd5a (required for meiotic nuclear division 5 homolog A [Source:Xenbase;Acc:XB-GENE-5741891])

HSP 1 Score: 91.6633 bits (226), Expect = 9.069e-19
Identity = 115/440 (26.14%), Postives = 176/440 (40.00%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP------------------------SEEVESQKI--------FDDFVKSNWSFVPFTLCFI----FISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFA-GISSLISNLE-LQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVS-----GLIYISLVIRYG 1313
            + SC+G  +G GN+WRFP +  RN    G   F I ++I LF   +PL ++E ++G+Y    PI   +C       KGI +G  +  V+  +  YY VI+ W  YY+    +  LP                        +E   ++K+          D     W      LC +     I + +L GI    K+          +++ +     TL  S  G +F  T DW  L +  ++ DA SQ  +      G + + A Y    N++IR +L I I N   S  A   IF  +  +   K   + Q            +G GL F+  P  L  +   G V  SI F  + F  G+ +L  N+E + T  L      R W    I      F    +  L  L+ Q  ++ F+LI S     GLI I+L +  G
Sbjct:   80 LLSCIGYCVGLGNVWRFPYLCYRN----GGGAFLIPYSIMLFFTGLPLFLMELSLGQYGAAGPITVWKCCPIL---KGIGIG--MLLVSALVSLYYNVIIAWTFYYLGQSFQSPLPWSCDSALYSQLCQNGTSNGSQFSATEAFWNEKVLGVTHSSGLGDPGPVGWELA---LCLLAAWFIIFLCMLKGIHSSGKIVYFTATFPYFVMVVLIIRGATLEGSIDGVRFYLTADWKRLQSAQVWNDAASQIFYSLGIGFGGLLSMASYNKFNNNVIRDTLVIAIGNCSTSFFAGFAIFSVLGHMAWKKGVPVGQVAD---------SGPGLAFVAYPEALALLP--GSVFWSILFFLMLFTLGVDTLFGNMEGITTAILDEIPSLRDWKRKTIFLGCLCFAFYLLGLL--LITQGGIYWFTLIDSYSTSFGLIIIALFMCLG 494          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:NCBI gene;Acc:780375])

HSP 1 Score: 90.8929 bits (224), Expect = 1.749e-18
Identity = 90/370 (24.32%), Postives = 160/370 (43.24%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVP-----PIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSNWS-------------------------------FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    IPL  +E A+G+++ +       +  +F   G   ++L       +F++  YY+VI+ W LYY++     +LP +  +    +++ F ++  ++ S                                    L +I +  S+  G++   KV          +L+ +FF   TLP +  G +F  T D++ LAN  +++DA +Q  F      G + A   Y   +N+I R S+ +  +N+  S+ A   IF ++ G M      IT+  I  +      +G GL F+  P  +  + +   V   +FF  L   G+ S    +E
Sbjct:   51 LLSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLVFAGIPLFFLETALGQFTSIGGLGVWKLAPMFKGVGMAAVVL-------SFWLNIYYIVIIAWALYYLFNSFSSTLPWQSCDNSWNTERCFSNYSLNDTSNLTSAVTEFWERNMHQMTGGLGEPGNIRWPLACTLALAWIMVYFSIWKGVEWTGKVVYFSATYPYFMLVILFFRGITLPGAMDGIRFYITPDFSKLANSEVWMDAATQIFFSYGLGLGSLIALGSYNAFDNNIYRDSIIVCGINSTTSMFAGFVIF-SIVGFM----SHITKKPIQELAA----SGPGLAFLAYPQAVTQLPM-SPVWSILFFSMLVMLGLDSQFCTVE 399          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:NCBI gene;Acc:780375])

HSP 1 Score: 90.5077 bits (223), Expect = 2.309e-18
Identity = 90/370 (24.32%), Postives = 160/370 (43.24%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVP-----PIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSNWS-------------------------------FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    IPL  +E A+G+++ +       +  +F   G   ++L       +F++  YY+VI+ W LYY++     +LP +  +    +++ F ++  ++ S                                    L +I +  S+  G++   KV          +L+ +FF   TLP +  G +F  T D++ LAN  +++DA +Q  F      G + A   Y   +N+I R S+ +  +N+  S+ A   IF ++ G M      IT+  I  +      +G GL F+  P  +  + +   V   +FF  L   G+ S    +E
Sbjct:   53 LLSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLVFAGIPLFFLETALGQFTSIGGLGVWKLAPMFKGVGMAAVVL-------SFWLNIYYIVIIAWALYYLFNSFSSTLPWQSCDNSWNTERCFSNYSLNDTSNLTSAVTEFWERNMHQMTGGLGEPGNIRWPLACTLALAWIMVYFSIWKGVEWTGKVVYFSATYPYFMLVILFFRGITLPGAMDGIRFYITPDFSKLANSEVWMDAATQIFFSYGLGLGSLIALGSYNAFDNNIYRDSIIVCGINSTTSMFAGFVIF-SIVGFM----SHITKKPIQELAA----SGPGLAFLAYPQAVTQLPM-SPVWSILFFSMLVMLGLDSQFCTVE 401          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Xenopus
Match: slc6a13 (solute carrier family 6 (neurotransmitter transporter), member 13 [Source:NCBI gene;Acc:780375])

HSP 1 Score: 90.1225 bits (222), Expect = 2.316e-18
Identity = 90/370 (24.32%), Postives = 160/370 (43.24%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVP-----PIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSNWS-------------------------------FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    IPL  +E A+G+++ +       +  +F   G   ++L       +F++  YY+VI+ W LYY++     +LP +  +    +++ F ++  ++ S                                    L +I +  S+  G++   KV          +L+ +FF   TLP +  G +F  T D++ LAN  +++DA +Q  F      G + A   Y   +N+I R S+ +  +N+  S+ A   IF ++ G M      IT+  I  +      +G GL F+  P  +  + +   V   +FF  L   G+ S    +E
Sbjct:   25 LLSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLVFAGIPLFFLETALGQFTSIGGLGVWKLAPMFKGVGMAAVVL-------SFWLNIYYIVIIAWALYYLFNSFSSTLPWQSCDNSWNTERCFSNYSLNDTSNLTSAVTEFWERNMHQMTGGLGEPGNIRWPLACTLALAWIMVYFSIWKGVEWTGKVVYFSATYPYFMLVILFFRGITLPGAMDGIRFYITPDFSKLANSEVWMDAATQIFFSYGLGLGSLIALGSYNAFDNNIYRDSIIVCGINSTTSMFAGFVIF-SIVGFM----SHITKKPIQELAA----SGPGLAFLAYPQAVTQLPM-SPVWSILFFSMLVMLGLDSQFCTVE 373          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Mouse
Match: Slc6a18 (solute carrier family 6 (neurotransmitter transporter), member 18 [Source:MGI Symbol;Acc:MGI:1336892])

HSP 1 Score: 91.6633 bits (226), Expect = 3.274e-19
Identity = 90/311 (28.94%), Postives = 137/311 (44.05%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQ------------KIFDDFVKS---NWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD  V+I  E+P   + +    + SC+G  +G GNIWRFP +   +    G   F I + I L    IPL  IE AIG+  R   I   + I  + G  G+ LG +   V+F +  YY  +L W L++     +  LP              +E +S              I  D   +    W  F+    C+  + + V+ GI+   KV          +L        TLP +  G  +LFT +  TL NP ++LDA +Q  F  + A G   A+A Y    N+  + ++ I +VN++ SL AS+ IF
Sbjct:    7 MDPLVDIEDERP--KWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTH----GGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLG--GVGLGCFS--VSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIF 307          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Mouse
Match: Slc6a18 (solute carrier family 6 (neurotransmitter transporter), member 18 [Source:MGI Symbol;Acc:MGI:1336892])

HSP 1 Score: 92.4337 bits (228), Expect = 3.640e-19
Identity = 90/311 (28.94%), Postives = 137/311 (44.05%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQ------------KIFDDFVKS---NWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD  V+I  E+P   + +    + SC+G  +G GNIWRFP +   +    G   F I + I L    IPL  IE AIG+  R   I   + I  + G  G+ LG +   V+F +  YY  +L W L++     +  LP              +E +S              I  D   +    W  F+    C+  + + V+ GI+   KV          +L        TLP +  G  +LFT +  TL NP ++LDA +Q  F  + A G   A+A Y    N+  + ++ I +VN++ SL AS+ IF
Sbjct:    7 MDPLVDIEDERP--KWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTH----GGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLG--GVGLGCFS--VSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIF 307          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Mouse
Match: Slc6a18 (solute carrier family 6 (neurotransmitter transporter), member 18 [Source:MGI Symbol;Acc:MGI:1336892])

HSP 1 Score: 92.4337 bits (228), Expect = 3.647e-19
Identity = 90/311 (28.94%), Postives = 137/311 (44.05%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQ------------KIFDDFVKS---NWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD  V+I  E+P   + +    + SC+G  +G GNIWRFP +   +    G   F I + I L    IPL  IE AIG+  R   I   + I  + G  G+ LG +   V+F +  YY  +L W L++     +  LP              +E +S              I  D   +    W  F+    C+  + + V+ GI+   KV          +L        TLP +  G  +LFT +  TL NP ++LDA +Q  F  + A G   A+A Y    N+  + ++ I +VN++ SL AS+ IF
Sbjct:    7 MDPLVDIEDERP--KWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTH----GGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLG--GVGLGCFS--VSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIF 307          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Mouse
Match: Slc6a18 (solute carrier family 6 (neurotransmitter transporter), member 18 [Source:MGI Symbol;Acc:MGI:1336892])

HSP 1 Score: 92.0485 bits (227), Expect = 4.066e-19
Identity = 90/311 (28.94%), Postives = 137/311 (44.05%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQ------------KIFDDFVKS---NWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD  V+I  E+P   + +    + SC+G  +G GNIWRFP +   +    G   F I + I L    IPL  IE AIG+  R   I   + I  + G  G+ LG +   V+F +  YY  +L W L++     +  LP              +E +S              I  D   +    W  F+    C+  + + V+ GI+   KV          +L        TLP +  G  +LFT +  TL NP ++LDA +Q  F  + A G   A+A Y    N+  + ++ I +VN++ SL AS+ IF
Sbjct:    7 MDPLVDIEDERP--KWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTH----GGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLG--GVGLGCFS--VSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIF 307          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Mouse
Match: Slc6a18 (solute carrier family 6 (neurotransmitter transporter), member 18 [Source:MGI Symbol;Acc:MGI:1336892])

HSP 1 Score: 92.4337 bits (228), Expect = 4.214e-19
Identity = 90/311 (28.94%), Postives = 137/311 (44.05%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQ------------KIFDDFVKS---NWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD  V+I  E+P   + +    + SC+G  +G GNIWRFP +   +    G   F I + I L    IPL  IE AIG+  R   I   + I  + G  G+ LG +   V+F +  YY  +L W L++     +  LP              +E +S              I  D   +    W  F+    C+  + + V+ GI+   KV          +L        TLP +  G  +LFT +  TL NP ++LDA +Q  F  + A G   A+A Y    N+  + ++ I +VN++ SL AS+ IF
Sbjct:    7 MDPLVDIEDERP--KWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTH----GGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLG--GVGLGCFS--VSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIF 307          
BLAST of Sodium dependent neurotransmitter transporter vs. UniProt/SwissProt
Match: sp|P44849|Y736_HAEIN (Uncharacterized sodium-dependent transporter HI_0736 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0736 PE=3 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.609e-30
Identity = 108/357 (30.25%), Postives = 171/357 (47.90%), Query Frame = 3
Query:   90 KEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIG-RYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE---SQKIFDDFVKSNWSF-------VPF-TLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLEL 1124
            K +  ++F      I + +G  +G GNIWRFP     N    G   F I + I L T  IPLL ++YAIG R+    P+   +  F     + G W   VN  IG YY V+LGW   Y Y     +   + ++    + +    +K+  SF        P   +  + + V  +G  K I KV+ VL+PVL+ + + +  YS  LP +  G   LFT DW+ L+NPS+++ A  Q  F  +   G++  YA YL KE+ +    L +   N+   +LA + +F  +  +   +   +++     + KG    G GL F   P ++     FG VL  +FF  L+FA ++S IS +E+
Sbjct:    7 KAQKRETFSGRRAFILAAIGSAVGLGNIWRFPYTTYEN----GGGAFIIPYLIALLTAGIPLLFLDYAIGHRHRGGAPLS--YRRFSPHFEVFGWWQMMVNVIIGLYYAVVLGWAASYTYFSFTGAWGDKPIDFFIGKFLKMGDIKNGISFEFVGMVTAPLIAMWIVALGVLSMGVQKGIAKVSSVLMPVLVVMFMVLVIYSLFLPGAAKGLDALFTPDWSKLSNPSVWIAAYGQIFFSLSIGFGIMVTYASYLKKESDLTGSGLVVGFANSSFEVLAGIGVFAALGFIATAQGQEVSE-----VAKG----GIGLAFFAFPTIINK-APFGEVLGMLFFGSLTFAALTSFISVIEV 347          
BLAST of Sodium dependent neurotransmitter transporter vs. UniProt/SwissProt
Match: sp|Q58715|Y1319_METJA (Uncharacterized sodium-dependent transporter MJ1319 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1319 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.841e-27
Identity = 110/373 (29.49%), Postives = 186/373 (49.87%), Query Frame = 3
Query:  105 KSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVN-FFIGAYYMVILGWCLYYIYLPIKMSLPSEE--------VESQKIFDDFVKSNWSFVPFTLCFIFISVSVL-GGIK-VIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMG-FGIKRRWSVLIIVA 1187
            +S+ S  G I + +G  IG GNIWRF  +V  N    G   F I + + L    IPL+++E+AIG Y++      +      KG    GW   ++ F I +YY+VI+ WCLYY+ + +    PS+         ++     +D    ++  +  TL    I   +L  GIK  +EK N +++P LL +++ +   + TLP +  G ++  T D++ L N +++L A SQ  F  +   G++ AYA YL K++ +   ++ + ++N   S LA   +F T+    M  T  I     V+        G GL F+  P  L  +    R+   +FF+ L FAGISS +S +E     ++  F + R+ ++L ++A
Sbjct:    7 ESWSSNLGFILASVGSAIGLGNIWRFGYMVYTN----GGGAFLIPYIVALLCVGIPLMILEFAIGHYTKKSAPLALEKL--HKGSEWTGWFAVISGFIITSYYVVIIAWCLYYLIILVIYGYPSDPNAYFFHNILQISSGVEDIGGVSYGILVSTLAVWGIVALILSAGIKNGLEKANKIMIPFLLFLIILLVLNALTLPGALTGIEWYLTPDFSALFNYNVWLSAFSQIFFSLSLGFGILIAYASYLPKKSDLTINAVTVSLLNCGFSFLAGFAVFGTLG--YMSYTSGIPLDKAVS-------EGIGLAFVTFPKALSLLPFASRLFGIVFFLALVFAGISSAVSIVEASVSAIIDKFSLSRKKALLAVLA 364          
BLAST of Sodium dependent neurotransmitter transporter vs. UniProt/SwissProt
Match: sp|P51905|SC6A4_DROME (Sodium-dependent serotonin transporter OS=Drosophila melanogaster OX=7227 GN=SerT PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 9.858e-22
Identity = 129/522 (24.71%), Postives = 220/522 (42.15%), Query Frame = 3
Query:   93 EKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIR-----CIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP----------------------------SEEVESQKIFDDFVKSNWSFV-----PFTLC----FIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCS-IFFICLSFAGISSLISNLELQTITLMG-----FGIKRRWSVLIIVASMFLFGSASVAELK-FLVNQDFVWGFSLIVSGLIYISLVIR---YGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWI--YSEIIENPKSWYIPQWN 1496
            E+  +++   A  + + +G  +  GN+WRFP I  +N    G   F + + + L    +PL  +E A+G++ R   +      C       KG+  G  I  ++ ++G YY  I+GW +YY++      LP                            ++E   +K+ + +  +   F+        LC    F+ +  S+  G++   KV  V       +L+ +     +LP ++ G K+  T +W  L N  +++DA SQ  F      G + A + Y    N+  R +L    +N L S LA   IF +V G M      + +T I  +    GL G GL FI  P  + TM   G V  S IFF+ L   G+ S    LE     L        G +R   VL+++A +FL    ++      LVN   V+G  L +  ++++        YG   F + +  EQ       L   W I  + ++P+  + + I+ I  Y E++   + +Y P W+
Sbjct:   71 ERTRETWGQKAEFLLAVIGFAVDLGNVWRFPYICYQN----GGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLSIWKRICP----ALKGV--GYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNPWNTENCMQVTSENFTELATSPAKEFFERKVLESYKGNGLDFMGPVKPTLALCVFGVFVLVYFSLWKGVRSAGKVVWVTALAPYVVLIILLVRGVSLPGADEGIKYYLTPEWHKLKNSKVWIDAASQIFFSLGPGFGTLLALSSYNKFNNNCYRDALITSSINCLTSFLAGFVIF-SVLGYMAY----VQKTSIDKV----GLEGPGLVFIVYPEAIATMS--GSVFWSIIFFLMLITLGLDSTFGGLEAMITALCDEYPRVIGRRRELFVLLLLAFIFLCALPTMTYGGVVLVNFLNVYGPGLAILFVVFVEAAGVFWFYGVDRFSSDV--EQMLGSKPGL--FWRICWTYISPVFLLTIFIFSIMGYKEMLG--EEYYYPDWS 565          
BLAST of Sodium dependent neurotransmitter transporter vs. UniProt/SwissProt
Match: sp|O07577|YHDH_BACSU (Uncharacterized sodium-dependent transporter YhdH OS=Bacillus subtilis (strain 168) OX=224308 GN=yhdH PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.858e-18
Identity = 100/364 (27.47%), Postives = 162/364 (44.51%), Query Frame = 3
Query:   90 KEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVN-FFIGAYYMVILGWCLYYIYLPIKMSLPS-EEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVL--GGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTV--FGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRR 1163
             E+ P  + S  G + +  G  IG G IW+FP +    +G  G   FF+++ +       PLLV E+  GR ++   I        +    L GWI     F + ++Y VI GW L YI      SL    + +   +F   +++    +   L F+ ++V V+  G  K IE+V+ V++P+L  + + +   S TL  +  G KFL    +  L  P   L A+ Q  F       ++  Y+ YL K  +I R +  I ++N +V+LLA + IFP V  FG    + PT                   L F  +P + E +  FG +    F +   FA ++S  S +E+   T+     K+R
Sbjct:    2 SEQKPVQWASKIGFVMAAAGSAIGLGAIWKFPYV----AGTNGGGAFFLIFVLFTILLGYPLLVGEFIFGRRNQTNAIDAYKKEAPRSAWFLTGWIGVAACFLVLSFYSVIGGWILLYIVKTASGSLSGLSQAQYGALFASIIQNPVQTLAAQLVFMALTVLVVARGVQKGIERVSAVMMPILFLLFILLVLRSLTLNGAMEGVKFLLVPHFGDL-TPESILFALGQAFFTLTLGVSVMVTYSSYLPKTQNIPRSAASIVLMNIIVTLLAGLAIFPAVFSFGFQPNEGPT-------------------LLFTVLPAVFEQL-PFGTLFFIGFLVAFLFAALTSAFSMVEIIVATIGKGDEKKR 340          
BLAST of Sodium dependent neurotransmitter transporter vs. UniProt/SwissProt
Match: sp|O88576|S6A18_MOUSE (Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Mus musculus OX=10090 GN=Slc6a18 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.546e-18
Identity = 90/311 (28.94%), Postives = 137/311 (44.05%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQ------------KIFDDFVKS---NWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            MD  V+I  E+P   + +    + SC+G  +G GNIWRFP +   +    G   F I + I L    IPL  IE AIG+  R   I   + I  + G  G+ LG +   V+F +  YY  +L W L++     +  LP              +E +S              I  D   +    W  F+    C+  + + V+ GI+   KV          +L        TLP +  G  +LFT +  TL NP ++LDA +Q  F  + A G   A+A Y    N+  + ++ I +VN++ SL AS+ IF
Sbjct:    7 MDPLVDIEDERP--KWDNKLQYLLSCIGFAVGLGNIWRFPYLCQTH----GGGAFLIPYFIALVFEGIPLFYIELAIGQRLRRGSIGVWKTISPYLG--GVGLGCFS--VSFLVSLYYNTVLLWVLWFFLNSFQHPLPWSTCPLDLNRTGFVQECQSSGTVSYFWYRQTLNITSDISNTGTIQWKLFLCLVACWSTVYLCVIRGIESTGKVIYFTALFPYLVLTIFLIRGLTLPGATEGLIYLFTPNMKTLQNPRVWLDAATQIFFSLSLAFGGHIAFASYNPPRNNCEKDAVIIALVNSMTSLYASIAIF 307          
BLAST of Sodium dependent neurotransmitter transporter vs. TrEMBL
Match: A0A0H3YJ00 (Slc6a-24 OS=Schmidtea mediterranea OX=79327 GN=slc6a-24 PE=2 SV=1)

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 386/560 (68.93%), Postives = 463/560 (82.68%), Query Frame = 3
Query:   66 MDVN-VEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVDRVYMYDDTN 1742
            M+ N +EI   KPPKSFQ+ AGVIFSCLGCVIGTGNIWRFPRI+ARNSG +GAACFFI+W + LFTWSIPLL++EYAIGR+ RV PIRC  +F GK GI LGGW+TF+NFFIG+YYMVILGWCLYYIY+PIKM LPSEE ESQ+IFD FV+SNW+F+P+T+CFIFIS+SV GGIKVIEKVN++LVP+LL ILLGIFFYSTTL F E+GF FLF+ DW TLANPS+YLDAISQNAFDT AA G ITAY+MYLT+ +SI+RYSLFIPI+NNLVS +ASMTIFPTVFG++++K PT +QT I+ IIKGGGLAGTGLTFIW+PIL+ET+  +GR LCSIFFICLSFAGISSLIS LELQTI+LM FGIKR+W+V+II + M+LFG  SV +L+FLVNQD VWGFSLIVSG IYISLVI YGPFNFR KIVNE K K+DF LPY W+  IS+LAP QA+AL+ WWIYSEI ENPKSWYIP WNS+ITTWIEW IF ++L++ +L I +L+I W+K  ++ S S+ M      A  N ++        ++I+    D      +++
Sbjct:    1 MNSNPIEIKINKPPKSFQNTAGVIFSCLGCVIGTGNIWRFPRIIARNSGSDGAACFFILWVVSLFTWSIPLLIVEYAIGRFLRVSPIRCFTHFMGKVGIGLGGWVTFINFFIGSYYMVILGWCLYYIYVPIKMKLPSEEFESQQIFDSFVQSNWAFIPYTMCFIFISISVSGGIKVIEKVNVILVPILLAILLGIFFYSTTLQFGEYGFDFLFSFDWKTLANPSMYLDAISQNAFDTGAALGQITAYSMYLTRSHSIMRYSLFIPIINNLVSFMASMTIFPTVFGVLLVKNPTYSQTAIIRIIKGGGLAGTGLTFIWLPILMETLDGYGRALCSIFFICLSFAGISSLISVLELQTISLMEFGIKRKWAVMIIASGMYLFGIGSVVDLRFLVNQDSVWGFSLIVSGTIYISLVIWYGPFNFRIKIVNENKSKYDFTLPYAWIFFISILAPFQALALITWWIYSEIKENPKSWYIPSWNSLITTWIEWIIFLILLVITTLFILKLNIIWVKKISLPSVSIQMTPS---AYKNNQIGIQHSQYISYIESEYEDHASQIQESS 557          
BLAST of Sodium dependent neurotransmitter transporter vs. TrEMBL
Match: W6UDQ9 (Sodium-dependent transporter OS=Echinococcus granulosus OX=6210 GN=EGR_05625 PE=4 SV=1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.787e-144
Identity = 233/565 (41.24%), Postives = 347/565 (61.42%), Query Frame = 3
Query:  102 PKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIK-MSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKS------NTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVDRVYMYDDTNQRL-STFQYEN 1772
            P +F    G++ SCLGCV+GTGNIWRFPR+VA  S   G+  F + W   LFTWSIPL+V EY +GR++R  P+   + F G K I +G W+T + F I AY+ V++GWC YY Y+      LPS E ES+ IFD+F+++ W     TLC +   V+V  G+K IE  N VLVP+ L I++ +F++S +  ++E G KF++T DW T  +P LY++A  QNAFDTAA  GL +AYA Y +++   +RYS+ +P++NNLVSL   +TIF TVF  ++  +PT+T   I+ I+K  G   TGLTF WIP+L+  +G+ GRVLC +FF+CLSFAGISS+I+ +EL   T+  FG+KR W+ +  + + FL G  S   +  L NQDFVW F+L++SGL Y  LVI Y P  +   IVN+    +D+ LP++W IVI+ + P++A+ L+ WW Y  I      WYI    S+  T++EW I A ++  V+L++    +  +K+      +  +  ++ +  Q    ++   L  G E   N +    ++ +    DT Q L + ++Y N
Sbjct:   61 PTNFTYSVGLVLSCLGCVLGTGNIWRFPRMVAVASCDSGSLTFILAWVFFLFTWSIPLIVTEYTLGRFTRGSPVVAFYKFLGDKFIWVGSWVTSIAFMISAYFSVVVGWCFYYFYVSCAWPDLPSTEPESRAIFDNFIQTYWPLFNHTLCLLMCGVAVFKGVKGIEIANGVLVPLQLLIVILVFYWSLSREYAEIGIKFMYTPDWGTFLDPKLYVEAACQNAFDTAAGMGLFSAYAAYFSRDTGAVRYSVILPVINNLVSLTCGLTIFATVFSTLIQTSPTLTMPQIIAIMKESGPGSTGLTFTWIPLLMSKLGIMGRVLCGLFFLCLSFAGISSMIAYIELTARTIQDFGVKRIWATVGSLVATFLVGVPSAISVNILSNQDFVWSFALMISGLCYCGLVIYYNPVRYLRVIVNDFAI-NDWRLPFVWTIVIAGVVPVEAIGLIAWWAYQNIAFT--EWYIIHAESLAITFLEWAILAFLVGTVNLMVTIFKVPVLKASASVGYDPYHPETIPLPTQ---CHTPHDLPEG-ERRHNTVHSSGLEAMPRRGDTTQSLVNIYKYSN 618          
BLAST of Sodium dependent neurotransmitter transporter vs. TrEMBL
Match: A0A5K3ELC9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 5.512e-143
Identity = 225/549 (40.98%), Postives = 341/549 (62.11%), Query Frame = 3
Query:   69 DVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIK-MSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKS------NTVYSNSLTMQDQS-----NIANSNKKLNHGFE 1679
            D+ +  +K    K+F    G++ SCLGCV+GTGNIWRFPRIVA  S   G+ CF ++W   LF WS+PL++ EY +GR++R  PI  I  F G K + +GGWIT V F I AY+ V++GWC YY Y+      LPS E ES+K+F++F+ + W     TL  +   +++  G+K IE  N  +VP+ + I+L  F++S +  +++ G KF+FT DW+TLA+P +Y++A  QNAFDTAA  GL +AYA Y T++   +R+ + +PI+NNLVSL+  +T+F T F  ++   PT+T   IV I+K  G   TGL+F WIP+L+  +G+ GR+LC +FF+CLSFAG++S+I  +EL   T+  FG+KR ++    +   FL G  S   +  L NQDFVWGF+L++SGL Y S+VI Y P  +R  IVN+    +D+ LP IW+ +I+ L PI+A+ L+ WW Y  I +N   WYI +  S+ TT +EW +  ++L  ++ + +    D +K       +  +  ++   D+S      I  S+ K + G +
Sbjct:   35 DIELVASKNGRNKNFTYSFGLVLSCLGCVLGTGNIWRFPRIVATASSDRGSLCFMMVWIFFLFAWSVPLIITEYTLGRFTRSSPIIAIEKFLGPKCLWVGGWITAVAFLISAYFSVVVGWCFYYFYVACAWPELPSAEPESRKVFEEFIGTYWPLGLHTLELLICGIAIFKGVKGIEIANSCMVPIQMIIVLITFYWSLSREYADVGIKFMFTPDWSTLADPHIYVEAACQNAFDTAAGMGLFSAYAAYFTRKTGAVRFGVILPIINNLVSLICGLTLFATAFSTLIQTQPTLTVPHIVAIMKESGPGSTGLSFTWIPVLMSRLGIAGRILCGLFFLCLSFAGVTSMIGYIELTARTIQDFGVKRVYATTAALVITFLAGVPSALSIDVLQNQDFVWGFALMISGLFYCSIVIYYNPIKYRKVIVNDFGL-NDWKLPLIWIALIAGLVPIEAIGLICWWAYQNISQN-GDWYIVKAQSLATTVLEWAVVFILLGGLNFITYFCKRDLLKDSGGVGYDPYHPETIPPYDESLVWSTQITKSSDKEDRGRD 581          
BLAST of Sodium dependent neurotransmitter transporter vs. TrEMBL
Match: A0A0R3X255 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7331 PE=4 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 6.673e-143
Identity = 229/508 (45.08%), Postives = 326/508 (64.17%), Query Frame = 3
Query:   75 NVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIK-MSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKS 1595
            N E      P +F   AG++ SCLGCV+GTGNIWRFPR+VA  S   G+  F + W   LFTWSIPL+V EY +GR++R  P+   + F G+K I +G W+T + F I AY+ V++GWC YY Y+     +LPS E ES+ IFD F+++ W     TLC +   V+V  G+K IE  N VLVP+ L I++ +F++S +  ++E G KF+FT DW TL +P LY++A  QNAFDTAA  GL +AYA Y +++   +RYS+ +P++NNLVSL   +TIF TVF  ++  +PT+T   IV I+K  G   TGLTF WIP+L+  +GV GR+LC +FF+CLSFAGISS+I+ +EL   T+  FG+KR W+ +  +   FL G  S   +  L NQDFVW F+L++SGL Y +LVI Y P  +   IVN+   K D+ LP++WVI I  + P++A+ L+ WW Y  +      WYI    S+  T++EWTI  +++  V+L +    I  +K+
Sbjct:  182 NQENQTTSRPTNFTYSAGLVLSCLGCVLGTGNIWRFPRMVAVASSDLGSLTFILTWVFFLFTWSIPLIVTEYTLGRFTRGSPVVAFYKFLGEKCIWVGLWVTSIAFMISAYFSVVVGWCFYYFYVACAWPTLPSTEPESRVIFDHFIQTYWPLFNHTLCLLICGVAVFKGVKGIEIANGVLVPLQLLIVILVFYWSLSREYAEIGIKFMFTPDWDTLLDPKLYVEAACQNAFDTAAGMGLFSAYAAYFSRDTGAVRYSVILPVINNLVSLTCGLTIFATVFSTLIQTSPTLTVPQIVAIMKESGPGSTGLTFTWIPVLMSKLGVMGRILCGLFFLCLSFAGISSMIAYIELTARTIQDFGVKRLWATVGSLVVTFLVGVPSAVSINILSNQDFVWSFALMISGLCYCALVIFYNPVRYLRVIVNDFAIK-DWRLPFVWVIGIVAVVPVEAIGLIAWWAYQNVAFT--KWYIINAESLTITFLEWTILVVLVGAVNLAVNIFKIQALKT 686          
BLAST of Sodium dependent neurotransmitter transporter vs. TrEMBL
Match: A0A564YT74 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9397 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 1.563e-142
Identity = 229/512 (44.73%), Postives = 328/512 (64.06%), Query Frame = 3
Query:   69 DVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIK-MSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNT 1601
            ++ V    EK PK F   AG+I S +GCV+GTGN+WRFPRI+A  S   G+  F I WA  L TWSIPL+V EY+IGR++R  P      F G K I +G W++ V FFIGAY+ V++GWCLYY+Y+      LP+ E ES+ IF++F  + W  +  T+C     +++  G K IE  N +LVP+   I+L +FF+S +  +++ G KF+FT DW+TL NP LY++A  QN FDTAA  GL++AYA Y ++    + Y +F+P +NNLVS++  +TIF TVF  ++  +PT+T   IV IIK  G   TGLTF WIP+L+  +G+ GR+LC +FFICLS  G+SS+IS LEL    +  FG++RRW+++  +   FL G  S   +  L NQDFVWGF+LI+SGL +  LVI Y PF FR  IVN+    +D+NLPY +V +I  L P++A+ L+IWW Y+ I      WY     S+ +T++EW+I  + ++  + V + L    +K +T
Sbjct:   32 NIQVVSKAEKQPK-FTYSAGLILSLIGCVMGTGNVWRFPRIIAVTSSDTGSLTFLIAWACFLLTWSIPLIVTEYSIGRFTRSSPTIAFQRFMGDKFIWIGCWVSAVAFFIGAYFSVVVGWCLYYVYVACAWQELPATEPESRLIFENFTHTYWPLLNHTICLAICGLAIFKGAKGIEIANGLLVPMQAIIILIVFFWSLSRDYADIGIKFMFTPDWSTLLNPKLYVEAACQNGFDTAAGMGLLSAYAAYFSRNTGAVLYGVFLPSINNLVSIICGLTIFSTVFSTLIQTSPTLTIPQIVAIIKETGPGSTGLTFTWIPVLMSKLGLMGRILCGLFFICLSSGGLSSMISFLELTVRVIQDFGVRRRWAIIAALLLSFLVGVPSALSIDILSNQDFVWGFALILSGLCFCILVISYNPFKFRKVIVNDFGI-NDWNLPYFFVFIIGGLVPLEALGLIIWWAYTNIAST--KWYELAAESLASTFLEWSILLVAVLAFNFVTYLLKCPIVKPST 539          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Cavefish
Match: slc6a22.2 (sodium- and chloride-dependent GABA transporter 2-like [Source:NCBI gene;Acc:103021985])

HSP 1 Score: 89.7373 bits (221), Expect = 2.349e-18
Identity = 138/607 (22.73%), Postives = 250/607 (41.19%), Query Frame = 3
Query:   78 VEITKEKPPKSFQSVAGVIF--SCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC---IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIY--------------------------------LPIKMSLPSEEVESQKIF------DDFVKSNWSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISS-------LISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIR--------YGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKL-NHGFENDSNFIDGHSVDR 1718
            V   + KP +  Q  + + F  +  G +IG GN+WRFP +  +N    G   FF+ + + LF+  IPL  +E ++G+Y+    I C   I   F  +G+  G  +  V  + G YY++IL W   Y++                                +P K++ P  E   ++I       ++     W   +   L +I     V  G+K   KV          +L  +     TLP +  G KF    D + L++P +++DA SQ  +     +G++TA   Y   EN+  R  +++ ++N++ S +A   IF +V G M  +     Q   ++++     +G GL FI  P  +  M V  ++    FFI + F G+ S       L++ +     +    G +R+  +LII    FL G   V E    V Q F +      SG+  ++  I         YG       I +   ++   ++ Y W  V  ++     V  L+   Y+ +  N  ++  P W   I  +  +T+ + +L+ + ++             + +     +D  +  +  K+L +H FE  ++     +VDR
Sbjct:   20 VAQPQPKPQQREQWASKLEFFLAVAGHIIGLGNVWRFPYLCYKN----GGGAFFVPYVLFLFSCGIPLFFLETSLGQYTSQGGITCWRKICPLF--EGLGYGSQV--VVLYTGVYYIIILAWAFLYLFSSFTSELPWASCKNSWNTEFCVEFSQNNVTENIPEKVTSPVMEFWERRILGLSGGIEEIGNVRWDLALCLLLAWIICYFCVWNGVKSTGKVVYFTATFPYLMLAVLLVRGLTLPGAINGIKFYLYPDPSRLSDPQVWMDAGSQIFYSYGVCTGVLTALGSYNKYENNCYRDCVYLCLLNSMTSFVAGFAIF-SVLGFMADE-----QGMDISMVAE---SGPGLAFIAYPRAVALMPV-PQLWAIFFFIMIIFLGLDSEFVYHEALVTAISDMYPSFFKMGYRRKILLLIICLVSFLAGLLMVTEGGLYVFQLFDY---YACSGMTLLAFAILQSICVGWVYGADRLYNNIEDMIGYRPWPHMKYCWKFVTPIICTGTFVFSLV--KYTPLKFN-NTYEYPWWGYAIGGF--FTLSSTLLVPLWMMYAVCKTPGSMRQRMRTLCSPAEDLPSPKSPKKELSSHTFETFTDLQTLRTVDR 600          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Cavefish
Match: slc6a7 (sodium-dependent proline transporter-like [Source:NCBI gene;Acc:103039122])

HSP 1 Score: 89.3521 bits (220), Expect = 3.742e-18
Identity = 99/365 (27.12%), Postives = 152/365 (41.64%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP--SEEVESQKIFDDFVKSNWSFVPF-------------------------TLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSI-FFICLSFAGISSLISNLE 1121
            + SC+G  +G GN+WRFP +  RN    G   F I + I LF   +PL ++E ++G+Y    PI   +C       KGI +G  +  V+  +  YY VI+ W  YY+    +  LP   + + + K+  +      S   F                          LC     + I + +L GI+   KV  V       +L+ +     TL  S  G  F  T  W  LAN  ++ DA SQ  +      G + + A Y   +N++IR +L I I N   S  A   IF  +  +   K   + +  I         +G GL F+  P  L  +   G V  +I FF+ L   G+ +L  N+E
Sbjct:   89 LLSCIGYCVGLGNVWRFPYLCYRN----GGGVFLIPYFIMLFFTGMPLFLMELSLGQYGAAGPITVWKCCPLL---KGIGIG--MLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWSCDAIANAKLCRNNTNGTLSPSEFFWNERVLGVSHSTGLSNPGPVRWQLALCLLAAWVIIFLCMLKGIRSSGKVVYVTATFPYLVLVVLIIRGATLEGSLQGVAFYLTPVWGRLANAQVWNDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTLVITIGNCATSFFAGFAIFSILGHMAWRKGVPVEKVAI---------SGPGLAFVAYPEALALLP--GSVFWAILFFLMLFMLGVDTLFGNME 433          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Cavefish
Match: slc6a1b (solute carrier family 6 member 1b [Source:ZFIN;Acc:ZDB-GENE-041114-57])

HSP 1 Score: 88.5817 bits (218), Expect = 5.965e-18
Identity = 91/386 (23.58%), Postives = 165/386 (42.75%), Query Frame = 3
Query:   78 VEITKEKPPKSFQSVAG---VIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN-----------WS--------------------FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            V++ K+K     ++ AG    + SC+G  IG GN+WRFP +  +N    G   F I + + L    +PL ++E A+G+Y+ +  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y      LP +  +    + + F ++  ++           W                      +   + ++ +   +  G+    KV          +LL +FF   TLP ++ G  F  T D+  L    ++LDA +Q  F      G + A   Y    N++ + S+ +  +N+  S+ A   IF ++ G M      IT+  I  + K    +G GL F+  P  +  + +   +   +FF  L   GI S    +E
Sbjct:   36 VKVQKKKDLPDRETWAGKFDFLLSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLIFAGVPLFLLETALGQYTSIGGLGVWKLAPMFKGVGLAAAV--LSFWLNIYYIVIIAWAIYYLYNSFTTDLPWKSCDNPWNTDRCFSNYSLASTANMTSAVVEFWERNMHQLTNGLEEPGEVRGPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYFMLLILFFRGVTLPGAKEGILFYITPDFEKLKESEVWLDAATQIFFSYGLGLGSLIALGSYNPFNNNVYKDSIIVCCINSFTSMFAGFVIF-SIVGFMS----HITKRPIADVAK----SGPGLAFLAYPEAVTQLPI-SPLWAILFFSMLLMLGIDSQFCTVE 405          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Cavefish
Match: slc6a18 (solute carrier family 6 member 18 [Source:ZFIN;Acc:ZDB-GENE-080219-9])

HSP 1 Score: 88.1965 bits (217), Expect = 6.327e-18
Identity = 129/546 (23.63%), Postives = 230/546 (42.12%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVP-------------------------FTLCFIFI-SVSVLGGIKVIEKVNXXXXXXXXXXXXXXFF-YSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPT------ITQTG---------IVTIIKGGGLAGTGLTFI-WIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRW-----------SVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQW--------NSIITTWIEWTIFALILIVVSLVIFQL 1574
            + +C+G  +G GN+WRFP +        G   F I + + L    +PLL +E AIG+  R   I     I  + G  G+        V+F +G +Y  IL W L+Y +   +  LP  +         +V+      P                           LC     SV  +  I+ IE + + +      ++L IF   + TLP +  G ++LFT     L NP ++LDA +Q  F  + A G + A++ Y  K N   R ++ +  +N+  SL AS+ I    F ++  K  T      +  TG          V +++    +GTGL FI +   ++E  G   +V   +FF+ L   G+SS+  NLE     L+   +  +W            V  +VA +F  GS +     F    ++V    L+V     I+ V+    F   ++  ++ K+       + W I    ++PI  + +L+ ++  +  E+P     P W        +S + ++ +W +FA+ +++ ++ +  +
Sbjct:   26 MLTCIGFAVGLGNVWRFPYLCQI----YGGGAFLIPYLVALVFEGLPLLYLELAIGQSLRKGSIGVWNSISPYLGGVGVA----SMIVSFLVGLFYNTILAWVLWYFFNSFQEPLPWSQCPLDDSQTSYVEECVQGTPVNYFWYRETLNITPDITSSGSLQWWLVLCLATAWSVVYICFIRGIETIGVYVTATFPYLVLTIFLVRALTLPGATDGLEYLFTPK--VLINPRVWLDAATQIFFSLSLAFGGLIAFSSYNPKRNDCERDAVLVGCINSATSLFASIPI----FAILGFKATTNNNNCFLRYTGCECVCVCVTSVCVLRVCSASGTGLAFIVFTEAVIEMPG--SQVWAVLFFVMLFSLGLSSMFGNLEGVLTPLLDLNMVPKWIPKELFTGVICIVSFLVALIFTMGSGNYWLEIF---NNYVGSVPLLVIAFFEITAVVL---FYGMSRFSDDIKYMTGRRPNWFWKICWMGISPIMLLVVLVAYVIVQGQEHPT---YPAWDPGYEQFPDSEVKSYPDW-VFAICVLLSAVPVLPI 545          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Cavefish
Match: slc6a1l (solute carrier family 6 member 1, like [Source:ZFIN;Acc:ZDB-GENE-041210-296])

HSP 1 Score: 87.4261 bits (215), Expect = 1.218e-17
Identity = 99/422 (23.46%), Postives = 178/422 (42.18%), Query Frame = 3
Query:   81 EITKEKPPK-SFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----SQKIFDDFVKSN------------------------------WSFV-PFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFG---IKRRWSVLIIVASM--FLFGSASVAE 1223
            E   E P + +++     + SC+G  IG GN+WRFP +  +N    G   F I +   L    IPL ++E A+G+Y+ V  +         KG+ L   +  ++F++  YY++I+ W LYY++      LP +  E    ++  F ++   +                              W  V    L ++ +  S+  G++   KV          +L  +FF   TLP +  G  F  T D+  L    ++LDA +Q  F      G + A   Y    N++ R ++ +  +N+  S+ A + IF ++ G M      IT+  I  +      +G GL F+  P  +  + +   +   +FF  L   G+ S    +E     LM      +++R  V I++  +  FL G +++ +
Sbjct:   36 EKKSELPDRGTWKGKFDFLLSCIGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFTTLVFAGIPLFLLETALGQYTSVGGLGVWKLIPMMKGVGLAAAV--LSFWLNIYYIIIISWALYYLFSSFTSELPWQSCENPWNTESCFSNYSLPDTTNLTSAVTEFWERNMHQLTDGLEEPGELRWPLVGTLALAWVLVYFSIWKGVEWTGKVVYFSATYPYFMLFILFFRGVTLPGAIDGVLFYITPDFNKLLKSEVWLDAATQIFFSYGLGLGSLIALGSYNPFNNNVYRDAVIVCCINSFTSMFAGIVIF-SIVGFM----SNITKKPIQELAA----SGPGLAFLAYPQAVTQLPM-SSLWSILFFSMLLMLGLDSQFCTVEGFITALMDEYPSVLRKRKKVFILIVCIISFLIGLSNITQ 441          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Sea Lamprey
Match: slc6a1a (solute carrier family 6 member 1a [Source:ZFIN;Acc:ZDB-GENE-060519-23])

HSP 1 Score: 80.4925 bits (197), Expect = 2.946e-16
Identity = 84/348 (24.14%), Postives = 147/348 (42.24%), Query Frame = 3
Query:   90 KEKPPK-SFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEV----ESQKIFDDF-----------VKSNWS--------------------FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSII-RYSLFIPIVNNLVSLLASMTIFPTV-FGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIP 1019
            KE P + +++     + SC+G  IG GN+WRFP +  +N    G   F I + + L    IPL ++E ++G+Y+ V  +         KG+ L   +  ++F++  YY+VI+ W +YY+Y      LP ++      + K F ++           V   W                      +   + ++ +   +  G+    KV          +L  +FF   TLP ++ G  F  T D+  L + +++LDA +Q  F      G + A   Y    N++  R S+ +  +N++ S+ A   IF  V F   + K P          +K    +G GL F+  P
Sbjct:    5 KELPVRGAWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFLTLVFAGIPLFLLETSLGQYTSVGGLGVWKLAPMFKGVGLASVV--ISFYLNIYYIVIISWAIYYLYNSFTSMLPWQDCNNPWNTDKCFSNYSILDTTNLTSTVVEFWERNMHQLSSGLDEPGQVRGPLAITLAISWVMVYFCIWKGVAWTGKVVYFSATFPYVMLFVLFFRGITLPGAKEGILFYITPDFRRLTDSAVWLDAATQIFFSYGLGLGSLVALGSYNPFHNNVYNRDSIIVCCINSVTSVFAGFVIFSIVGFMSHITKKP----------VKELAASGPGLAFLAYP 336          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Sea Lamprey
Match: slc6a4b (solute carrier family 6 member 4b [Source:ZFIN;Acc:ZDB-GENE-060314-2])

HSP 1 Score: 53.5286 bits (127), Expect = 1.019e-7
Identity = 66/262 (25.19%), Postives = 102/262 (38.93%), Query Frame = 3
Query:  267 IPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVE----------------------SQKIFDDFVKSNWSFVPFT------------------LCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLM 923
            IPL  +E A+G++ R   I   R I   F  KG+  G  I  +NF++  YY  I+ W LYY+Y     +LP  + +                      S+   ++F   N   + ++                  L F  +  S+  G+K   KV  V       +L  +     TLP +  G  F    +W  L    +++DA +Q  F      G++ A A Y    N+  R +L    VN   S ++   IF TV G M
Sbjct:   16 IPLFYMELALGQFHRNGAISIWRRICPIF--KGV--GFAICIINFYVAFYYNTIIAWALYYLYSSFTSTLPWTKCDNPWNTVNCTSYFDTTGVAWGKHSRSPAEEFYTRNVLEIQYSKGLGGVGGLRWQLLLCLFLIFTIVYFSLWKGVKTSGKVVWVTATFPYVVLFILLIRGATLPGAWRGVLFYLKPNWKKLLTTEVWVDAAAQIFFSLGPGFGVLLALASYNKFNNNCYRDALVTSSVNCFTSFMSGFVIF-TVLGYM 272          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004857.1 (pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 gene:ENSPMAG00000004412.1 transcript:ENSPMAT00000004857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 8.948e-7
Identity = 64/253 (25.30%), Postives = 102/253 (40.32%), Query Frame = 3
Query:  648 FFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICL-------SFAGISSLISNL-ELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDF----------VW--GFSLIVSGLIY---------ISLVIRYGPF 1319
            F    TLP S  G  +    DW+ L  P +++DA +Q  F  A   G ++A   Y    N+  R +  + +VN+  S  A   +F T+  +   +   I+Q            +G GL FI  P  +  M +   +  ++FF  L        F G+   ++ + +L    L G G +R   V +   + FL   + V E    V Q F          +W  G+  IV   +Y         I+L+I Y PF
Sbjct:   18 FINGMTLPGSYDGIMYYLKPDWSKLGQPQVWIDAGTQIFFSYAIGLGALSALGSYNRFNNNCYRDTFILALVNSGTSFFAGFVVFSTLGFMAAEQGVDISQV---------AESGPGLAFIAYPKAVSLMPM-APLWAALFFFMLILLGLDSQFVGVEGFVTGISDLFPAALTG-GYRREVFVGVCCFTSFLIAISMVTEGGMYVFQLFDYYSASGMTLLWQAGWECIVVAWVYAGGDRFMDNIALMIGYRPF 259          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001684.1 (pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 gene:ENSPMAG00000001516.1 transcript:ENSPMAT00000001684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 1.626e-6
Identity = 35/122 (28.69%), Postives = 61/122 (50.00%), Query Frame = 3
Query:  108 SFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFV-NFFIGAYYMVILGWCLYYIYLPIKMSLP 470
            ++ S +  + S +G  +G GN+WRFP +  +N    G   F I + I L    +PL  +E +IG+++ + PI         KG+   GW+  + +  I  YY  I+ + L+Y++      LP
Sbjct:    8 NWASKSEYMLSMIGNAVGLGNLWRFPYLAYKN----GGGAFLIPYIIMLAFVGLPLFFLECSIGQFASLGPITIWKVVPLLKGL---GWMMVITSSLIALYYNSIIAYGLFYLFASFTSELP 122          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Nematostella
Match: EDO40151 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6])

HSP 1 Score: 98.9821 bits (245), Expect = 7.664e-22
Identity = 103/432 (23.84%), Postives = 175/432 (40.51%), Query Frame = 3
Query:   63 KMDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC------IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP---------------------SEEVESQKIF---------DDFVKSNWSFVPFTLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLM-----GFGIKRRWSVLIIVASMFLFGSASVAE 1223
            K D   ++   +  + +      +F+C+G  +G GN WRFP +  +N    G   F I + + L    IPL  +E ++G+  +  PI+       +F   G   I+       ++F +  YY VIL W LY++Y      +P                     +  V S + F             +     V  TLC     I +  S+  GI+   KV  V   +   IL+  F    TLP +  G  +  T  W  L +P +++DA SQ  +      G++  +A Y  ++N++   +L I ++N   S+ A   IF  V  +  ++  ++ +             G GL FI  P  +  +  F ++   IFF+ L   G+ S    +E+    L+          R   VL+I   MFL G + V++
Sbjct:   10 KNDEKKDLVTVESRERWDRKIEFLFACIGFAVGYGNFWRFPYMCFKN----GGGAFLIPYVLFLCLGGIPLFFMELSLGQLLQEGPIKAWQKICPLFSGIGFASIV-------ISFIVSIYYNVILAWSLYFLYNSFFADIPWVGCHHSWNTPDCYVYNASANASGVSSSREFLVKNVLEITKSIEEPGGLSVHLTLCLLVAWILVYFSIWRGIRTTGKVVYVTATLPYIILVIFFIKGVTLPGAIDGVLYFITPQWDRLQDPKVWIDAASQILYSLTIGFGVLIGFASYNPRKNNVFSDALLISVINCATSVFAGFVIFAIVGYMAHVQEKSVPEVAS---------QGPGLVFIVYPAAISQLP-FPQIWAVIFFLMLIALGLDSQFGQVEVVAAALIEQWPRQLHKHRELVVLVICFVMFLLGLSCVSK 420          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Nematostella
Match: EDO49707 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RFF4])

HSP 1 Score: 92.0485 bits (227), Expect = 1.132e-19
Identity = 125/502 (24.90%), Postives = 205/502 (40.84%), Query Frame = 3
Query:  123 AGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC----IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVK------SNWSFVPFTL-------------------CFIF----ISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLA----------GTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFG----IKRRWSVLIIVASMFLFGSASVAELKFLVNQ---DFVWGFSLIVSGLIY-ISLVIRYGPFNFRTKIVNEQKFKHDFNLPYI-WVIVISVLAPIQAVALLIWWIYSEIIENPK 1472
            A  I + +G  +G GN+WRFP +  +N    G   F + + I +    +PL  +E +IG+  R   I C        FG     +G     V+  +  YY+VI+ WC Y+ ++     LP ++    K FD F        S + F    L                   C +F      + V+ GIK   KV          IL+ +FF   TL  +  G K LFT DW  L + +++ DA +Q  F  +   G + A+A Y+   N +++    + +VN   SL A + +F ++ G    KT  I  T + TI +  G A          G GL FI     +  M V   +   +FF+ L   GI S    LE     +M       +++    L +   + L G    +   + + Q   D+     L+V  L   I +   YG      +  ++ +F      P++ W+I    ++PI  + +LI  +  +   +PK
Sbjct:   10 AEFILATIGLAVGLGNVWRFPYLCQKN----GGGAFLVPYIIFMLIEGLPLFFLELSIGQRMRKSAINCWRDIHPCLFG-----IGVACLMVSLMLCLYYIVIIAWCCYFFFISFTSDLPWKKGLKAK-FDSFPDCCVRDPSAYYFYHHALEVSTSIEDTGVGINVKLAGCLVFAWILTYLCVVKGIKSSGKVVYFTATFPYIILIILFFRGVTLEGAGNGIKTLFTPDWGLLLDANIWKDAATQMFFTLSLGFGALIAFASYMPMHNQVMKDGYTVVLVNCGTSLFAGIVVF-SILGYREAKT-GIPVTEVWTIRRVSGFAYGGRGLRVGSGPGLAFITFSDAMLLMDV-SPLWAILFFMMLILLGIDSEFGTLEAAIGPIMELNLFPKVRKELVTLGVAVILLLLGLCMTSGAGYYIFQMFDDYSVTIPLLVIALFQCIGVAWVYG----NDRFADDIQFMTG-KRPWVGWMICWKYISPIALLVVLIALVAQQSQVSPK 493          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Nematostella
Match: EDO32356 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2])

HSP 1 Score: 85.5001 bits (210), Expect = 1.700e-17
Identity = 144/600 (24.00%), Postives = 226/600 (37.67%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC-----IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQ--------------------KIFDDFVKS-------------------------NWSFVPFTLCFIF----ISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE--LQTITLMGFGIKRRW---SVLIIVASMFLF--GSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIR------YGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYS-EIIENPKSWYIPQWNSIITTWIEWTIFALI--LIVVSLVIFQLD-IDWIKSNT---------VYSNSLTMQDQSNIANSNKKLNHGFENDSN 1691
            I + +G  +G GNIWRFP +  +N    G  CF I + ICL    +PLL++E  +G++     I       +F   G   +++   + ++N     YY+VILGW  YY++   +  LP    ++                     K    F+KS                         NW      LC +F      + V  G+K   +V          +L  I   + TLP +  G +F    DW+ L + S++L A +Q  F  +   G + A   Y   +N+  R  +    VN+  S      IF +V G M  K     Q            +G GL FI  P  +  M +   +   +FF  +   G+ S    +E  +  I  M  G  RR     + I   S F F  G   V E    V Q F   +S     L++ISL         YG   F   + +   F+ +  L   W+       PI  +A+ I+ + + E +    ++  P W   I   +  +    I  L V++L+  + D ID ++S T          Y+   T  D  N         H FE D+ 
Sbjct:   19 ILALIGFSVGLGNIWRFPYLCYKN----GGGCFLIPYLICLLLAGVPLLILEVCLGQFMSQGGITAWKICPLFQGIGYASVVI---VQYLNI----YYIVILGWAFYYMFHSFQAVLPWSHCDNDWNTEKCHVGRKMITTFNSGSKCCQLFIKSFKCLWKDAADYVLNISGGLDQIGTINWQ---MALCLLFAWIVCYLCVFKGVKSTGRVVYFTATFPYVLLTIICVRAVTLPGAREGIRFYLEPDWSRLQDGSVWLQAATQVFFSYSIGLGTLIALGSYNKFKNNCYRDCIIFACVNSGTSFYGGFVIF-SVLGFMAEKQGVPIQE--------VAESGPGLAFIAYPAAVAEMPI-SPLWSILFFFMVILLGLDSEFVGVEGFVTAIVDMFPGYLRRGYRKEIFIAACSTFWFFIGLVMVTEGGMYVFQLFD-NYSASGICLLWISLFESIGIGWVYGAERFYQNMTDMIGFRINPYLKVCWIFC----TPIFCLAVFIFSLVNYEPLTYNLTYKYPVWGDAIGWLLALSSIVCIPLLAVINLMRAEGDFIDRLRSVTTPCLPPGRGCYTKQET--DAMNGKAMGNGREHNFEVDTK 587          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Nematostella
Match: EDO39708 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978])

HSP 1 Score: 83.9593 bits (206), Expect = 4.743e-17
Identity = 85/342 (24.85%), Postives = 134/342 (39.18%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSR---------VPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQ---------------------------------KIFDDFVKSNWSFVPFTLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIP 1019
            + SC+G  +G GN+WRFP +  +N    G A F I + +CL    IP+  +E A+G+Y+          V PI          GI  G  +T + F    YY VI+ W  YY++   +  +P  +  ++                                 ++  D  K         +C     I +   V  GIK   KV          +L  +     TLP +  G  F    D+T L +P +++DA  Q  F  +   G +  Y  Y    N+  R +L + ++N L S+ A   IF T+ G M  +     +     ++K    +G GL FI  P
Sbjct:   14 LLSCIGYAVGLGNVWRFPYLCYKN----GGASFLIPYLVCLVFCGIPIFYLEVALGQYTAQGVVNAWAVVSPIM--------TGI--GFAMTVITFLCSVYYNVIMAWSFYYMFDAWRAVVPWNDCNNEWNTQFCSCTHAMNIPSFHENTIISVTLSRRKVLQLSGDVGKPGEVRFELAMCLLLAWIVVYFCVWKGIKSAGKVVYFTATFPYLVLFILLIRGATLPGAANGALFYVKPDFTKLGDPRVWVDAAGQIFFSLSVGFGGLITYGSYNKFNNNCQRDTLIVSVINCLTSVFAGFVIF-TMMGFMAHELGVEVE----DVVK----SGPGLAFIAYP 332          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Nematostella
Match: EDO46589 (Transporter [Source:UniProtKB/TrEMBL;Acc:A7RPK8])

HSP 1 Score: 83.5741 bits (205), Expect = 7.305e-17
Identity = 90/383 (23.50%), Postives = 154/383 (40.21%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP---SEEVESQKIFDDFVKSN---------------------------WSF-VPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPT----------ITQTGIVTIIK---------GGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLE 1121
            I + +G  +G GN+WRFP +  +N    G   F I + +CL    IPL  +E AIG+  R   +     I  + G  GI        V F +  YY +I+ WC YY++   +  LP     +V +   + D  +                             W   +   L +I + + ++ G++   K           +L+  F    TL  +  G   +F   +  LA+P ++L+A +Q  +    A G + A + Y    N+ +R ++ + ++N   S+ AS+ IF ++ G    +T T          +T  G  T+ +         G    G GLTFI     +  M     +  ++FF  L   G+ S+   LE
Sbjct:   17 ILATVGYAVGLGNVWRFPYLCQKN----GGGAFLIPYVLCLALLGIPLFFMELAIGQSVRQGSVGVWNYIHPYLGGVGIS----SVIVCFLVAVYYNMIIAWCFYYLFASWQSPLPYSYCPQVLTNSKYYDLPECGLAGRTQYYWYQNALKIAPTIDESGGLVWPMCLSLLLAWIVVFLCMMKGVQSAGKAVYFTATFPYLVLIIFFGRGVTLEGAGPGVAHMFKPQFEKLADPRVWLEAATQIFYSLGVAFGGLIAMSSYNPVHNNCLRDAVMVSLINCGTSVFASIVIF-SILGFKAHETFTECIELYTKDNVTLPGNQTVGEACKTLEYWLGQSAEGPGLTFIAFTEAIVKMPALSPLWATLFFCMLLTLGLGSMFGTLE 390          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Medaka
Match: slc6a22.1 (sodium- and chloride-dependent GABA transporter 2 [Source:NCBI gene;Acc:101167601])

HSP 1 Score: 96.6709 bits (239), Expect = 1.480e-20
Identity = 111/450 (24.67%), Postives = 186/450 (41.33%), Query Frame = 3
Query:   63 KMDVNVEITKEKPPKS---FQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC---IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPF-------------------------------------TLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICL-------SFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDF 1250
            ++ V +++    P  S   + +    + +  G +IG GN+WRFP +  +N    G   FFI + + LFT  IPL ++E A+G+Y+    I C   I   F  +GI  G  +  V  +   YY++IL W   Y++      LP     +    D+ V+ + S  PF                                      LC     I     V  G+K   KV          +L+ +     TLP +  G KF    D + LA+P +++DA +Q  +  A   G +TA   Y    N+  +  +++ ++N+  S +A   IF +V G M  +     QT I  + +    +G GL FI  P  +  M +  ++  ++FF+ +        F G+ +L + +     +    G +R+  +L+I    FL G   V E    V Q F
Sbjct:    8 EVQVQMDLGTAHPAPSRGQWSNKMEFLLAVAGQIIGLGNVWRFPYLCYKN----GGGVFFIPYILFLFTCGIPLFLLETALGQYTSQGSITCWRKICPLF--EGIGYGSQV--VVSYSSMYYIIILAWAFLYLFSSFNAELPWATCSNSWNTDNCVEFHQSLEPFNTTLTENATSPVREFWERRILNITGNINELGSVRWELALCLLLSWIICYFCVWKGVKSTGKVVYFTATFPYLMLVVLLIRGLTLPGALNGIKFYLYPDPSRLADPQVWMDAGTQIFYSYAICIGCLTALGSYNKYNNNCYKDCIYLCLLNSGTSFVAGFAIF-SVLGFMAFE----QQTDISKVAE----SGPGLAFIAYPRAVTLMPL-PQLWATLFFMMIILLGLDSQFVGLEALATAISDLNPSFFQVGHRRKLLLLVICVICFLIGLVMVTEGGLYVFQVF 439          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Medaka
Match: slc6a22.1 (sodium- and chloride-dependent GABA transporter 2 [Source:NCBI gene;Acc:101167601])

HSP 1 Score: 96.6709 bits (239), Expect = 1.480e-20
Identity = 111/450 (24.67%), Postives = 186/450 (41.33%), Query Frame = 3
Query:   63 KMDVNVEITKEKPPKS---FQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRC---IFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPF-------------------------------------TLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICL-------SFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDF 1250
            ++ V +++    P  S   + +    + +  G +IG GN+WRFP +  +N    G   FFI + + LFT  IPL ++E A+G+Y+    I C   I   F  +GI  G  +  V  +   YY++IL W   Y++      LP     +    D+ V+ + S  PF                                      LC     I     V  G+K   KV          +L+ +     TLP +  G KF    D + LA+P +++DA +Q  +  A   G +TA   Y    N+  +  +++ ++N+  S +A   IF +V G M  +     QT I  + +    +G GL FI  P  +  M +  ++  ++FF+ +        F G+ +L + +     +    G +R+  +L+I    FL G   V E    V Q F
Sbjct:    8 EVQVQMDLGTAHPAPSRGQWSNKMEFLLAVAGQIIGLGNVWRFPYLCYKN----GGGVFFIPYILFLFTCGIPLFLLETALGQYTSQGSITCWRKICPLF--EGIGYGSQV--VVSYSSMYYIIILAWAFLYLFSSFNAELPWATCSNSWNTDNCVEFHQSLEPFNTTLTENATSPVREFWERRILNITGNINELGSVRWELALCLLLSWIICYFCVWKGVKSTGKVVYFTATFPYLMLVVLLIRGLTLPGALNGIKFYLYPDPSRLADPQVWMDAGTQIFYSYAICIGCLTALGSYNKYNNNCYKDCIYLCLLNSGTSFVAGFAIF-SVLGFMAFE----QQTDISKVAE----SGPGLAFIAYPRAVTLMPL-PQLWATLFFMMIILLGLDSQFVGLEALATAISDLNPSFFQVGHRRKLLLLVICVICFLIGLVMVTEGGLYVFQVF 439          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Medaka
Match: slc6a7 (sodium-dependent proline transporter [Source:NCBI gene;Acc:101168229])

HSP 1 Score: 90.8929 bits (224), Expect = 1.199e-18
Identity = 99/387 (25.58%), Postives = 155/387 (40.05%), Query Frame = 3
Query:   84 ITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP--SEEVESQKIFDDFVKSNWSFV-------------------------------PFTLCF----IFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSI-FFICLSFAGISSLISNLE 1121
            +    P + +      + SC+G  +G GN+WRFP +  RN    G   F I + I LF   +PL ++E ++G+Y    PI   +C       KGI +G  +  V+  +  YY VI+ W  YY+    +  LP   + + +  +  +    N S                                 P  LC     I I + +L GI+   KV  V       +L+ +     TL  S  G  F  T DW  LA+  ++ DA SQ  +      G + + A Y   +N++IR ++ I   N   S  A   IF  +  +   K  ++ +             G GL F+  P  L  +   G V  SI FF+ L   G+ +L  N+E
Sbjct:   54 VANTTPREQWGGKYEFLLSCIGYCVGLGNVWRFPYLCYRN----GGGVFLIPYFIMLFVAGVPLFLMELSLGQYGAAGPITVWKCCPLL---KGIGIG--MLCVSTLVCLYYNVIIAWTFYYLGSSFQSPLPWSCDAIANAAVCSNNTAGNSSSGRARTPTEIFWNENVLGLVNSEGLHDPGPVRWPLALCLLAAWIIIFLCMLKGIRSSGKVVYVTATFPYFVLIVLIIRGATLEGSLQGIAFYLTPDWARLASAQVWSDAASQIFYSLGIGVGGLLSMASYNKFDNNVIRDTIIITTGNCCTSFFAGFAIFSILGHMAWRKGVSVGEVADT---------GPGLAFVAYPEALALLP--GSVFWSIMFFLMLFMLGVDTLFGNME 420          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Medaka
Match: slc6a18 (sodium-dependent neutral amino acid transporter B(0)AT3 [Source:NCBI gene;Acc:101171681])

HSP 1 Score: 90.5077 bits (223), Expect = 1.346e-18
Identity = 80/302 (26.49%), Postives = 128/302 (42.38%), Query Frame = 3
Query:   93 EKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPI---RCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------SEEVESQKIFDDF-------VKSN---------WSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIF 902
            E+ PK + +    + +C+G  +G GN+WRFP +        G   F I + I L    +PLL +E AIG+  R   I     I    G  GI        V+F +  +Y  IL W L+Y++   +  LP             +EE E     + F       +  N         W  V     +  + +  + GI  + K   V       +L        TLP +  G  +LFT DW  L NP ++LDA +Q  F  + A G + +++ Y ++ N   R ++ + ++N+  SL  S+ IF
Sbjct:   10 EERPK-WDNKVQYLLTCIGFAVGIGNVWRFPYLCQI----YGGGAFLIPYLIALVFEGLPLLYLELAIGQRLRKSSIGVWTSISPLLGGVGIA----SMIVSFLVAMFYNTILAWVLWYLFHSFQEPLPWSYCPLNENLTGFNEECEKSTPVNYFWYRETLNITPNIETSGSLQWWLVVCLASAWSIVYICFIKGIDSVGKAVYVTTTFPYLVLTIFLVRGLTLPGATDGLAYLFTPDWEILKNPQVWLDAATQIFFSLSVAFGGLISFSSYNSERNDCERDAVLVGVINSATSLYGSIPIF 302          
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Medaka
Match: slc6a1l (sodium- and chloride-dependent GABA transporter 1 [Source:NCBI gene;Acc:101175450])

HSP 1 Score: 87.0409 bits (214), Expect = 1.626e-17
Identity = 101/431 (23.43%), Postives = 170/431 (39.44%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP-------------------SEEVESQKIFDDFVKSN---------------WSFV-PFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMG---FGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRY 1310
            + SC+G  IG GN+WRFP +  +N    G   F I + + L    IPL  +E A+G+++ V  +         KG+ L   +  ++F++  YY+VI+ W LYY++      LP                   ++         +F + N               W  V    L +  +  S+  G++   KV          +L  +FF   TLP +  G +F  T D+  LA   ++LDA +Q  F      G + A   Y    N + + S+ +  +N+  S+ A + IF ++ G M   T    Q    +        G GL F+  P  +  + +   +   +FF  L   G+ S    +E     LM      +++R  V I++                     F+ GFS I  G +Y+  +  Y
Sbjct:   53 LLSCVGYAIGLGNVWRFPYLCGKN----GGGAFLIPYFMTLVFAGIPLFFLETALGQFTSVGGLGVWRLIPMMKGVGLAAVV--LSFWLNIYYIVIIAWALYYLFNSFSSELPWQSCNNPWNTVNCFSNYSLTDTTNLSSAVTEFWERNMHQLTGGLEEPGELRWPLVGTLALAWTLVYFSIWKGVEWTGKVVYFSATYPYVMLFILFFRGITLPGAIDGIRFYITPDFNKLARSEVWLDAATQIFFSYGLGLGSLIALGSYNPYNNDVYKDSIIVCCINSCTSMFAGLVIF-SIVGFMSYITKKPVQELAAS--------GPGLAFLAYPQAVTQLPL-SSLWAVLFFSMLLMLGLDSQFCTVEGFITALMDEYPLVLRKRKKVFILIVCFI----------------SFIIGFSNITQGGLYVFKMFDY 451          
BLAST of Sodium dependent neurotransmitter transporter vs. Planmine SMEST
Match: SMESG000031125.1 (SMESG000031125.1)

HSP 1 Score: 1114.37 bits (2881), Expect = 0.000e+0
Identity = 571/573 (99.65%), Postives = 572/573 (99.83%), Query Frame = 3
Query:   66 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVDRVYMYDDTNQRLSTFQYENSSAF 1784
            MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNIVLVPVLLGILLGIFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIEN K+WYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVDRVYMYDDTNQRLSTFQYENSSAF
Sbjct:    1 MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNIVLVPVLLGILLGIFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENSKTWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVDRVYMYDDTNQRLSTFQYENSSAF 573          
BLAST of Sodium dependent neurotransmitter transporter vs. Planmine SMEST
Match: SMESG000031127.1 (SMESG000031127.1)

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 386/560 (68.93%), Postives = 464/560 (82.86%), Query Frame = 3
Query:   66 MDVN-VEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVKSNWSFVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISNLELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFSLIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPIQAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVIFQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVDRVYMYDDTN 1742
            M+ N +EI   KPPKSFQ+ AGVIFSCLGCVIGTGNIWRFPRI+ARNSG +GAACFFI+W + LFTWSIPLL++EYAIGR+ RV PIRC  +F GK GI LGGW+TF+NFFIG+YYMVILGWCLYYIY+PIKM LPSEE ESQ+IFD FV+SNW+F+P+T+CFIFIS+SV GGIKVIEKVN++LVP+LL ILLGIFFYSTTL F E+GF FLF+ DW TLANPS+YLDAISQNAFDT AA G ITAY+MYLT+ +SI+RYSLFIPI+NNLVS +ASMTIFPTVFG++++K PT +QT I+ IIKGGGLAGTGLTFIW+PIL+ET+  +GR LCSIFFICLSFAGISSLIS LELQTI+LM FGIKR+W+V+II + M+LFG  SV +L+FLVNQD VWGFSLIVSG IYISLVI YGPFNFR KIVNE+K K+DF LPY W+  IS+LAP QA+AL+ WWIYSEI ENPKSWYIP WNS+ITTWIEW IF ++L++ +L I +L+I W+K  ++ S S+ M      A  N ++        ++I+    D      +++
Sbjct:    1 MNSNPIEIKINKPPKSFQNTAGVIFSCLGCVIGTGNIWRFPRIIARNSGSDGAACFFILWVVSLFTWSIPLLIVEYAIGRFLRVSPIRCFTHFMGKVGIGLGGWVTFINFFIGSYYMVILGWCLYYIYVPIKMKLPSEEFESQQIFDSFVQSNWAFIPYTMCFIFISISVSGGIKVIEKVNVILVPILLAILLGIFFYSTTLQFGEYGFDFLFSFDWKTLANPSMYLDAISQNAFDTGAALGQITAYSMYLTRSHSIMRYSLFIPIINNLVSFMASMTIFPTVFGVLLVKNPTYSQTAIIRIIKGGGLAGTGLTFIWLPILMETLDGYGRALCSIFFICLSFAGISSLISVLELQTISLMEFGIKRKWAVMIIASGMYLFGIGSVVDLRFLVNQDSVWGFSLIVSGTIYISLVIWYGPFNFRIKIVNEKKSKYDFTLPYAWIFFISILAPFQALALITWWIYSEIKENPKSWYIPSWNSLITTWIEWIIFLILLVITTLFILKLNIIWVKKISLPSVSIQMTPS---AYKNNQIGIQHSQYISYIESEYEDHASQIQESS 557          
BLAST of Sodium dependent neurotransmitter transporter vs. Planmine SMEST
Match: SMESG000003011.1 (SMESG000003011.1)

HSP 1 Score: 90.8929 bits (224), Expect = 9.026e-19
Identity = 84/342 (24.56%), Postives = 150/342 (43.86%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILGGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP---------------------------------SEE------VESQKIFDDFVKSNWS-FVPFTLCFIFISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETM 1037
            IF+C+   +G GN+WRFP +V +N    G   F I + + L    +P+  +E+AIG++S + PI C       KG+  G  +  + +++  YY VI+  C++Y++      LP                                 +E+      +E  K  +DF   +W   +   L +I ++  +L G+  + K++         +L  +   S  LP +  G K+  T  +  L++P+++ DA +Q  F  +  SG +   A Y   +N+  R ++ + ++N   S+ A   IF  +  +  +K  TI +     + KG    G GL FI  P  L  M
Sbjct:   76 IFTCISFAVGLGNVWRFPYLVYKN----GGGAFLIPYCLMLMCVGLPIFFLEFAIGQFSSLGPISCWIISPLFKGVGYG--MVIITWYLTLYYNVIVAHCVFYLFSSFTSKLPWSTCGNYWNDNTTCFDGSNNTIHLLAIENKISATEQYYEKYVLEVSKGIEDFGLPSWKLLLCLLLSWIIVTAVLLKGVSSLGKISYFTALFPYVLLTILLIRSAFLPGAGQGIKYYLTPQFYRLSDPNVWTDAATQIFFSLSCCSGGLINMASYNKFKNNCCRDAVIVALINCATSVFAGFVIFANLGFMANMKNVTIDK-----VAKG----GPGLAFIVYPEALSNM 402          
BLAST of Sodium dependent neurotransmitter transporter vs. Planmine SMEST
Match: SMESG000054904.1 (SMESG000054904.1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.954e-16
Identity = 122/488 (25.00%), Postives = 208/488 (42.62%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILG-GW-ITFVNFFIGAYYMVILGWCLYYIYLPIKMSLP----SEEVESQKIF-----------DDFVKSN---WS-----FVPF-------------------TLCFIFI----SVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVTIIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFA-GISSLISNLELQTITLMG----FGIKRRWSVLIIVASMFLFGSASV------AELKFLVNQDFVWGFSL-IVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPI 1415
            + SC+G  +G GN+WRFP  V  N    G   F I + I      +PLL++E  +G+++   P +     F    I+ G GW +  ++  I  YY  I+    +Y++  +   +P    + E  S+K              D+V S+   W      FV +                   TLC +F       +++ GIKV  K+    V      L+ IF  +++LP +  G KF  T +W  L +P++   AI Q  F  + A G +  YA Y    ++  R ++ I I++   S+LA + IFP V G +  +T    +  I +        G+ L FI +   L T+   G  L +I  + ++ + G+ S I+  E  +  +M        K+ +  +++ A   LF    +       +  F +    V  F L I++ L  I L + YG    R     + +    F+L + W IVI+ + P+
Sbjct:   63 LLSCIGFAVGLGNVWRFPIKVYEN----GGGAFLITYTIICIILGVPLLMLELGLGQFTGRGPTKA----FKVVPIMYGIGWSMVMISLIIEIYYAPIIAISYFYLFGSLNKVMPWTVCNHEFNSKKCLGSFQENMDLNISDYVSSSSEYWDYYVTGFVKYPERTIYTLNEFPGPPQWHLTLCLLFTWITGGFALMNGIKVSGKIMYFSVLYPYFALISIFCVASSLPGAMNGIKFYLTPNWKKLYDPTVLRVAIEQLFFSCSIAMGGMITYASYNDFRDNFYRDAIIIIIIDYFTSVLAGLAIFP-VLGYLSQRTGAKIEKVISS--------GSSLFFITLTEALATIP--GSQLWTILLMVMAISLGLDSQIAMFETVSTGIMDAIPILQTKKEYKFMMVWALCSLFFLCGLLLITPGGKYWFDILDKRVSSFGLPILAILETICLGLIYGFKQLRY----DYRMMTGFSLSWYWFIVIAFVGPL 527          
BLAST of Sodium dependent neurotransmitter transporter vs. Planmine SMEST
Match: SMESG000054909.1 (SMESG000054909.1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.450e-16
Identity = 85/312 (27.24%), Postives = 131/312 (41.99%), Query Frame = 3
Query:  132 IFSCLGCVIGTGNIWRFPRIVARNSGPEGAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIILG-GWITFV-NFFIGAYYMVILGWCLYYIYLPIKMSLP----SEEVESQKIF---DD--------FVKSN---WSFV-----------PF-------------TLCFIF----ISVSVLGGIKVIEKVNXXXXXXXXXXXXXXFFYSTTLPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYLTKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLM 923
            + SC+G V+G GN+WRFP  V  N    G   F I++ I    +  PLL++E  +G++S   P +     F    ++ G GW   V + FI  YY  I+ +  +Y +   +  +P    S E  S +     DD        FV S    W +            P+             T+C +         V+ GI+V  K+    V      L  IFF   TLP +  G  F    D+   A P+LY +A+ Q  +    A G +  +A Y    ++  R S+ + +V+ L S+ A   IFP + G M
Sbjct:   82 LMSCVGFVVGIGNVWRFPARVYEN----GGGTFLIVYTIMCIIFGAPLLIMELGLGQFSGFSPPK----LFKLVPVMSGLGWSMIVMSMFIDIYYAAIVSYGYFYFFGSFRRVMPWTVCSHEFNSNRCLGTSDDKASFNITEFVSSTSEYWDYYVTGFIKYPSRQPYKLNEFPGSPIWHLTICLVIAWFTTGFIVMRGIRVSGKIVYFTVIYPYFALAAIFFLGCTLPGAMDGISFYVVPDFKFFARPALYRNALEQIFYSIGIAMGGLICFASYNNFRDNFFRDSILLILVDYLTSIFAGFAIFP-ILGYM 384          
The following BLAST results are available for this feature:
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC6A12.074e-1823.40solute carrier family 6 member 1 [Source:HGNC Symb... [more]
SLC6A13.951e-1723.01solute carrier family 6 member 1 [Source:HGNC Symb... [more]
SLC6A13.951e-1723.01solute carrier family 6 member 1 [Source:HGNC Symb... [more]
SLC6A13.951e-1723.01solute carrier family 6 member 1 [Source:HGNC Symb... [more]
SLC6A13.951e-1723.01solute carrier family 6 member 1 [Source:HGNC Symb... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dat-12.924e-1423.64Sodium-dependent dopamine transporter [Source:Uni... [more]
snf-21.692e-1234.13Transporter [Source:UniProtKB/TrEMBL;Acc:P90890][more]
snf-75.717e-1034.58Transporter [Source:UniProtKB/TrEMBL;Acc:G5EE39][more]
snf-111.041e-731.34Transporter [Source:UniProtKB/TrEMBL;Acc:G5EF43][more]
snf-91.263e-733.64Transporter [Source:UniProtKB/TrEMBL;Acc:Q9XUG5][more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SerT9.835e-2324.71gene:FBgn0010414 transcript:FBtr0072362[more]
SerT9.835e-2324.71gene:FBgn0010414 transcript:FBtr0343316[more]
ine1.023e-1922.86gene:FBgn0011603 transcript:FBtr0077447[more]
ine7.937e-1922.84gene:FBgn0011603 transcript:FBtr0077448[more]
ine7.937e-1922.84gene:FBgn0011603 transcript:FBtr0301408[more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a181.729e-2227.65solute carrier family 6 member 18 [Source:ZFIN;Acc... [more]
slc6a19a.14.115e-1923.41solute carrier family 6 member 19a, tandem duplica... [more]
slc6a73.629e-1828.80solute carrier family 6 member 7 [Source:ZFIN;Acc:... [more]
slc6a22.14.787e-1826.27solute carrier family 6 member 22, tandem duplicat... [more]
slc6a22.14.787e-1826.27solute carrier family 6 member 22, tandem duplicat... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rmnd5a7.302e-1925.88required for meiotic nuclear division 5 homolog A ... [more]
rmnd5a9.069e-1926.14required for meiotic nuclear division 5 homolog A ... [more]
slc6a131.749e-1824.32solute carrier family 6 (neurotransmitter transpor... [more]
slc6a132.309e-1824.32solute carrier family 6 (neurotransmitter transpor... [more]
slc6a132.316e-1824.32solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc6a183.274e-1928.94solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a183.640e-1928.94solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a183.647e-1928.94solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a184.066e-1928.94solute carrier family 6 (neurotransmitter transpor... [more]
Slc6a184.214e-1928.94solute carrier family 6 (neurotransmitter transpor... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P44849|Y736_HAEIN4.609e-3030.25Uncharacterized sodium-dependent transporter HI_07... [more]
sp|Q58715|Y1319_METJA3.841e-2729.49Uncharacterized sodium-dependent transporter MJ131... [more]
sp|P51905|SC6A4_DROME9.858e-2224.71Sodium-dependent serotonin transporter OS=Drosophi... [more]
sp|O07577|YHDH_BACSU1.858e-1827.47Uncharacterized sodium-dependent transporter YhdH ... [more]
sp|O88576|S6A18_MOUSE2.546e-1828.94Sodium-dependent neutral amino acid transporter B(... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ000.000e+068.93Slc6a-24 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
W6UDQ91.787e-14441.24Sodium-dependent transporter OS=Echinococcus granu... [more]
A0A5K3ELC95.512e-14340.98Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3X2556.673e-14345.08Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A564YT741.563e-14244.73Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a22.22.349e-1822.73sodium- and chloride-dependent GABA transporter 2-... [more]
slc6a73.742e-1827.12sodium-dependent proline transporter-like [Source:... [more]
slc6a1b5.965e-1823.58solute carrier family 6 member 1b [Source:ZFIN;Acc... [more]
slc6a186.327e-1823.63solute carrier family 6 member 18 [Source:ZFIN;Acc... [more]
slc6a1l1.218e-1723.46solute carrier family 6 member 1, like [Source:ZFI... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc6a1a2.946e-1624.14solute carrier family 6 member 1a [Source:ZFIN;Acc... [more]
slc6a4b1.019e-725.19solute carrier family 6 member 4b [Source:ZFIN;Acc... [more]
ENSPMAT00000004857.18.948e-725.30pep scaffold:Pmarinus_7.0:GL478393:33260:48162:-1 ... [more]
ENSPMAT00000001684.11.626e-628.69pep scaffold:Pmarinus_7.0:GL482707:4904:15978:1 ge... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401517.664e-2223.84Transporter [Source:UniProtKB/TrEMBL;Acc:A7S7X6][more]
EDO497071.132e-1924.90Transporter [Source:UniProtKB/TrEMBL;Acc:A7RFF4][more]
EDO323561.700e-1724.00Transporter [Source:UniProtKB/TrEMBL;Acc:A7SVA2][more]
EDO397084.743e-1724.85Transporter [Source:UniProtKB/TrEMBL;Acc:A7S978][more]
EDO465897.305e-1723.50Transporter [Source:UniProtKB/TrEMBL;Acc:A7RPK8][more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc6a22.11.480e-2024.67sodium- and chloride-dependent GABA transporter 2 ... [more]
slc6a22.11.480e-2024.67sodium- and chloride-dependent GABA transporter 2 ... [more]
slc6a71.199e-1825.58sodium-dependent proline transporter [Source:NCBI ... [more]
slc6a181.346e-1826.49sodium-dependent neutral amino acid transporter B(... [more]
slc6a1l1.626e-1723.43sodium- and chloride-dependent GABA transporter 1 ... [more]
back to top
BLAST of Sodium dependent neurotransmitter transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031125.10.000e+099.65SMESG000031125.1[more]
SMESG000031127.10.000e+068.93SMESG000031127.1[more]
SMESG000003011.19.026e-1924.56SMESG000003011.1[more]
SMESG000054904.13.954e-1625.00SMESG000054904.1[more]
SMESG000054909.18.450e-1627.24SMESG000054909.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035254 ID=SMED30035254|Name=Sodium dependent neurotransmitter transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1840bp
CTCAAAGTGATTAGGTAATTGAATATATGAAATATTCATTAATTGTACTG
ATTCGGTTTTAGAAAATGGATGTCAACGTAGAGATTACTAAGGAAAAACC
TCCGAAAAGTTTTCAAAGTGTTGCTGGAGTGATATTTAGTTGCTTAGGAT
GCGTTATTGGTACTGGAAATATATGGAGATTTCCTCGAATAGTTGCTAGA
AACAGTGGACCTGAGGGTGCTGCTTGTTTTTTCATAATGTGGGCAATTTG
CTTATTTACGTGGTCAATTCCATTATTGGTCATAGAATATGCAATTGGAA
GATATTCTAGGGTTCCTCCGATTCGATGTATTTTCTATTTCTTCGGCAAA
AAAGGCATAATTTTAGGAGGTTGGATCACGTTTGTTAATTTCTTTATTGG
AGCTTATTACATGGTCATCCTTGGATGGTGCCTGTATTACATATATCTCC
CGATAAAAATGAGCTTACCGTCAGAGGAGGTAGAAAGTCAAAAAATATTT
GATGATTTTGTGAAATCAAATTGGTCTTTTGTGCCTTTTACACTCTGTTT
TATATTTATATCTGTATCGGTTTTGGGAGGAATAAAAGTTATTGAAAAGG
TTAACATTGTCCTTGTACCGGTGTTGTTGGGAATTTTACTTGGGATATTT
TTCTATTCAACTACGTTACCTTTTTCGGAATTCGGATTTAAATTTCTTTT
CACTGGAGATTGGACAACTCTTGCTAATCCAAGTTTATATTTGGATGCGA
TTTCTCAGAATGCGTTTGATACTGCGGCCGCAAGTGGGCTCATCACAGCA
TATGCCATGTATTTAACGAAAGAGAATTCAATTATTAGATATTCTCTATT
TATCCCTATTGTTAATAATTTAGTCAGTTTACTAGCATCAATGACAATTT
TCCCAACCGTTTTCGGTTTAATGATGCTTAAAACTCCAACAATAACACAA
ACGGGAATAGTAACTATTATCAAAGGGGGCGGGCTAGCAGGCACTGGCTT
AACGTTTATTTGGATACCGATTCTTCTAGAAACAATGGGAGTATTTGGGC
GAGTTCTTTGCTCGATTTTCTTCATTTGTCTAAGTTTTGCTGGAATAAGT
TCACTTATTTCTAACTTGGAATTACAAACTATAACCTTGATGGGATTTGG
GATTAAAAGACGATGGTCTGTATTGATAATCGTGGCCAGTATGTTCTTAT
TCGGGTCAGCTTCCGTGGCTGAGCTAAAATTCTTAGTCAATCAAGACTTT
GTTTGGGGTTTCTCTTTAATTGTATCGGGTCTCATTTATATTTCTCTTGT
AATTCGGTATGGACCTTTTAATTTCCGAACAAAAATAGTTAACGAACAGA
AATTTAAGCATGATTTCAATTTACCTTACATTTGGGTAATCGTTATATCA
GTTCTAGCTCCAATTCAAGCAGTGGCTTTGCTTATTTGGTGGATTTATTC
TGAAATCATTGAAAATCCAAAAAGTTGGTATATTCCCCAATGGAATTCCA
TAATCACGACTTGGATTGAGTGGACCATTTTTGCTTTGATATTAATTGTT
GTCAGTTTAGTAATTTTTCAGCTTGATATAGACTGGATTAAGTCAAATAC
TGTGTACTCCAATTCATTGACAATGCAAGATCAAAGTAACATTGCGAACT
CAAATAAGAAACTAAATCATGGGTTTGAAAACGATTCAAATTTCATTGAT
GGACATTCAGTAGACAGGGTATATATGTATGATGATACTAACCAGAGACT
CTCAACTTTTCAATATGAAAATTCTTCCGCCTTCTGATGTTAATTGTGAT
ACTTGTAATAAATTCGTCATTATTGTCTTTTTGAAAAAAA
back to top

protein sequence of SMED30035254-orf-1

>SMED30035254-orf-1 ID=SMED30035254-orf-1|Name=SMED30035254-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MKKIEQRTRPNTPIVSRRIGIQINVKPVPASPPPLIIVTIPVCVIVGVLS
IIKPKTVGKIVIDASKLTKLLTIGINREYLIIEFSFVKYMAYAVMSPLAA
AVSNAF*
back to top

protein sequence of SMED30035254-orf-2

>SMED30035254-orf-2 ID=SMED30035254-orf-2|Name=SMED30035254-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=574bp
MDVNVEITKEKPPKSFQSVAGVIFSCLGCVIGTGNIWRFPRIVARNSGPE
GAACFFIMWAICLFTWSIPLLVIEYAIGRYSRVPPIRCIFYFFGKKGIIL
GGWITFVNFFIGAYYMVILGWCLYYIYLPIKMSLPSEEVESQKIFDDFVK
SNWSFVPFTLCFIFISVSVLGGIKVIEKVNIVLVPVLLGILLGIFFYSTT
LPFSEFGFKFLFTGDWTTLANPSLYLDAISQNAFDTAAASGLITAYAMYL
TKENSIIRYSLFIPIVNNLVSLLASMTIFPTVFGLMMLKTPTITQTGIVT
IIKGGGLAGTGLTFIWIPILLETMGVFGRVLCSIFFICLSFAGISSLISN
LELQTITLMGFGIKRRWSVLIIVASMFLFGSASVAELKFLVNQDFVWGFS
LIVSGLIYISLVIRYGPFNFRTKIVNEQKFKHDFNLPYIWVIVISVLAPI
QAVALLIWWIYSEIIENPKSWYIPQWNSIITTWIEWTIFALILIVVSLVI
FQLDIDWIKSNTVYSNSLTMQDQSNIANSNKKLNHGFENDSNFIDGHSVD
RVYMYDDTNQRLSTFQYENSSAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015293symporter activity
GO:0005328neurotransmitter:sodium symporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006836neurotransmitter transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR000175Na/ntran_symport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane