lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog

Overview
Namelipopolysaccharide-induced tumor necrosis factor-alpha factor homolog
Smed IDSMED30035250
Length (bp)512
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (SMED30035250) t-SNE clustered cells

Violin plots show distribution of expression levels for lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (SMED30035250) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035250

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30035250 Contig52049uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035250 Contig52049newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30035250 dd_Smed_v4_2503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035250 dd_Smed_v4_2503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035250 dd_Smed_v4_2503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30035250 dd_Smed_v6_2503_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035250 dd_Smed_v4_2503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 58.9214 bits (141), Expect = 1.041e-11
Identity = 27/65 (41.54%), Postives = 37/65 (56.92%), Query Frame = 1
Query:  187 CPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            CP C + I++ + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:    3 CPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 67          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 60.8474 bits (146), Expect = 1.350e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  +  I F      + CP C + I++ + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 TVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 60.8474 bits (146), Expect = 1.350e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  +  I F      + CP C + I++ + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 TVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 60.8474 bits (146), Expect = 1.350e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  +  I F      + CP C + I++ + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 TVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Human
Match: LITAF (lipopolysaccharide induced TNF factor [Source:HGNC Symbol;Acc:HGNC:16841])

HSP 1 Score: 60.8474 bits (146), Expect = 1.350e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  +  I F      + CP C + I++ + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 TVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Celegans
Match: F16F9.1 (pep chromosome:WBcel235:X:8440192:8450406:1 gene:WBGene00017513.1 transcript:F16F9.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F16F9.1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.421e-11
Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  112 EKTESMRIVTDEKII-GFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +   ++ IVT  K    F + E +  C  C + + T+ KF +G  TW+  F + + C      +PFCL  CKDAHH+CP+C+  LG  KR
Sbjct:   69 QPNPTVVIVTTPKPAPSFASYETT--CYSCGKYVHTLPKFVIGSLTWI-VFILVLICFFPLAFVPFCLDSCKDAHHYCPRCNALLGIKKR 155          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Celegans
Match: F16F9.1 (pep chromosome:WBcel235:X:8447269:8450417:1 gene:WBGene00017513.1 transcript:F16F9.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F16F9.1)

HSP 1 Score: 57.3806 bits (137), Expect = 8.421e-11
Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  112 EKTESMRIVTDEKII-GFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +   ++ IVT  K    F + E +  C  C + + T+ KF +G  TW+  F + + C      +PFCL  CKDAHH+CP+C+  LG  KR
Sbjct:   69 QPNPTVVIVTTPKPAPSFASYETT--CYSCGKYVHTLPKFVIGSLTWI-VFILVLICFFPLAFVPFCLDSCKDAHHYCPRCNALLGIKKR 155          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Celegans
Match: F36G3.3 (pep chromosome:WBcel235:X:9798839:9801038:1 gene:WBGene00009484.1 transcript:F36G3.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F36G3.3)

HSP 1 Score: 56.9954 bits (136), Expect = 9.875e-11
Identity = 31/86 (36.05%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  121 ESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
             S  + T   II        + CP C  +I+T  K   G  TW+F   + +F    CC +PFCLR CKD  H CP C   +G ++R
Sbjct:   62 ASGPMPTSTIIIRLEPHATKLQCPYCRMDIVTRTKSVYGLLTWIFFAALFLFGCWCCCFLPFCLRSCKDIIHTCPNCRAMIGVHRR 147          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Celegans
Match: Y87G2A.19 (pep chromosome:WBcel235:I:13508785:13512026:1 gene:WBGene00044260.1 transcript:Y87G2A.19.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y87G2A.19)

HSP 1 Score: 46.9802 bits (110), Expect = 3.267e-7
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  106 DVEKTESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF----CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
                T SM +V  +K +      + + CP+C     T ++F  G  T++  F I IF     PL    +PFC+   KDA H+CP C  ++G Y+R
Sbjct:   14 SASHTPSM-LVNAKKYLS--DRPQLLDCPRCKVHGETELRFVNGFFTYVSFFIILIFGFAILPLFFLWVPFCVETFKDAEHYCPSCRAWIGTYRR 105          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Celegans
Match: Y87G2A.19 (pep chromosome:WBcel235:I:13508814:13512026:1 gene:WBGene00044260.1 transcript:Y87G2A.19.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y87G2A.19)

HSP 1 Score: 46.9802 bits (110), Expect = 3.267e-7
Identity = 31/95 (32.63%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  106 DVEKTESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF----CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
                T SM +V  +K +      + + CP+C     T ++F  G  T++  F I IF     PL    +PFC+   KDA H+CP C  ++G Y+R
Sbjct:   14 SASHTPSM-LVNAKKYLS--DRPQLLDCPRCKVHGETELRFVNGFFTYVSFFIILIFGFAILPLFFLWVPFCVETFKDAEHYCPSCRAWIGTYRR 105          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0073031)

HSP 1 Score: 67.0106 bits (162), Expect = 1.422e-14
Identity = 33/67 (49.25%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            ++CP C  EI T  + + G   +L  F I +F C LGCCLIP C+ +C D HH CP C  YLGRY+R
Sbjct:   64 MICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0073030)

HSP 1 Score: 67.0106 bits (162), Expect = 1.422e-14
Identity = 33/67 (49.25%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            ++CP C  EI T  + + G   +L  F I +F C LGCCLIP C+ +C D HH CP C  YLGRY+R
Sbjct:   64 MICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0344220)

HSP 1 Score: 67.0106 bits (162), Expect = 1.422e-14
Identity = 33/67 (49.25%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            ++CP C  EI T  + + G   +L  F I +F C LGCCLIP C+ +C D HH CP C  YLGRY+R
Sbjct:   64 MICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Fly
Match: CG32280 (gene:FBgn0052280 transcript:FBtr0073032)

HSP 1 Score: 67.0106 bits (162), Expect = 1.422e-14
Identity = 33/67 (49.25%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            ++CP C  EI T  + + G   +L  F I +F C LGCCLIP C+ +C D HH CP C  YLGRY+R
Sbjct:   64 MICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Fly
Match: CG13510 (gene:FBgn0034758 transcript:FBtr0071862)

HSP 1 Score: 59.3066 bits (142), Expect = 1.353e-11
Identity = 25/84 (29.76%), Postives = 44/84 (52.38%), Query Frame = 1
Query:  127 MRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            ++  T   ++  G+    I CP C  E+LT VK     +T  +   + +F    C  +P+C+  C++A+H+CP C  Y+G Y+ 
Sbjct:   46 IQTTTTSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPCVCLPYCMDSCQNANHYCPNCSAYIGTYEN 129          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Zebrafish
Match: litaf (lipopolysaccharide-induced TNF factor [Source:NCBI gene;Acc:431731])

HSP 1 Score: 67.3958 bits (163), Expect = 3.314e-14
Identity = 31/74 (41.89%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            FG       CP C + ++T +++  G   WL C G+ +F C  GCCLIPFC+ + KD  H CP C   LG +KR
Sbjct:   89 FGNVPVQAHCPVCSQSVITRLEYSSGPLVWLSCAGLAVFGCIYGCCLIPFCIEDLKDVTHHCPNCSSVLGVHKR 162          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Zebrafish
Match: si:ch211-202h22.8 (si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313-78])

HSP 1 Score: 65.0846 bits (157), Expect = 1.176e-13
Identity = 30/64 (46.88%), Postives = 38/64 (59.38%), Query Frame = 1
Query:  187 CPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            CP C ++I+T  ++  G  TWL C G+GI     CCLIPFC+  CKD  H CP C   +  YKR
Sbjct:   73 CPHCQQQIITETRYVNGLLTWLICGGLGILLIWPCCLIPFCVSACKDVEHRCPNCKHVVFLYKR 136          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Zebrafish
Match: si:ch211-202h22.8 (si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313-78])

HSP 1 Score: 65.0846 bits (157), Expect = 1.176e-13
Identity = 30/64 (46.88%), Postives = 38/64 (59.38%), Query Frame = 1
Query:  187 CPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            CP C ++I+T  ++  G  TWL C G+GI     CCLIPFC+  CKD  H CP C   +  YKR
Sbjct:   73 CPHCQQQIITETRYVNGLLTWLICGGLGILLIWPCCLIPFCVSACKDVEHRCPNCKHVVFLYKR 136          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Zebrafish
Match: si:ch211-202h22.7 (si:ch211-202h22.7 [Source:ZFIN;Acc:ZDB-GENE-090313-77])

HSP 1 Score: 62.7734 bits (151), Expect = 1.299e-12
Identity = 28/64 (43.75%), Postives = 36/64 (56.25%), Query Frame = 1
Query:  187 CPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            CP C ++++T   +  G   W  C G+GIF    CCLIPFC+  CKD  H CP C   +  YKR
Sbjct:   82 CPHCQQQVVTETTYVNGLLVWGICIGLGIFGIWPCCLIPFCVDSCKDVQHRCPGCKSLVYVYKR 145          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Zebrafish
Match: si:ch211-202h22.7 (si:ch211-202h22.7 [Source:ZFIN;Acc:ZDB-GENE-090313-77])

HSP 1 Score: 62.003 bits (149), Expect = 1.715e-12
Identity = 28/64 (43.75%), Postives = 36/64 (56.25%), Query Frame = 1
Query:  187 CPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            CP C ++++T   +  G   W  C G+GIF    CCLIPFC+  CKD  H CP C   +  YKR
Sbjct:   61 CPHCQQQVVTETTYVNGLLVWGICIGLGIFGIWPCCLIPFCVDSCKDVQHRCPGCKSLVYVYKR 124          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Xenopus
Match: ENSXETT00000031517.1 (LITAF domain containing [Source:NCBI gene;Acc:100498168])

HSP 1 Score: 72.4034 bits (176), Expect = 3.420e-16
Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            F     S  CP C + I+T + + +G  TWL    + IF C LGCCLIPFC+  CKD  H+CP C+ +L +YKR
Sbjct:   67 FQDTPASTTCPSCRQNIITNIHYNIGLLTWLLFGILFIFGCWLGCCLIPFCVDSCKDVDHYCPNCNHHLYKYKR 140          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 67.781 bits (164), Expect = 4.197e-14
Identity = 32/96 (33.33%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  103 MDVEKTESMRIVTDEKIIGFGTEEKSIV--CPKCLEEILTVVKFKVGCQTWLFCFGIGIF--CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            + V   + ++      I+G   ++  +   CP C + I+T +++ VG  +W+  F + +F  C LGCC+IPF +  CKD  H+CP C+  L +YKR
Sbjct:   77 VPVANAQPLQSAPVHTIVGSSFQDTPVTATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 171          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 66.6254 bits (161), Expect = 9.112e-14
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  109 VEKTESMRIVTDEKIIGFGTEEKSIV--CPKCLEEILTVVKFKVGCQTWLFCFGIGIF--CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            V   + ++      I+G   ++  +   CP C + I+T +++ VG  +W+  F + +F  C LGCC+IPF +  CKD  H+CP C+  L +YKR
Sbjct:   79 VVNAQPLQSAPVHTIVGSSFQDTPVTATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 171          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 66.6254 bits (161), Expect = 9.908e-14
Identity = 32/96 (33.33%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  103 MDVEKTESMRIVTDEKIIGFGTEEKSIV--CPKCLEEILTVVKFKVGCQTWLFCFGIGIF--CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            + V   + ++      I+G   ++  +   CP C + I+T +++ VG  +W+  F + +F  C LGCC+IPF +  CKD  H+CP C+  L +YKR
Sbjct:   77 VPVVNAQPLQSAPVHTIVGSSFQDTPVTATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 171          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Xenopus
Match: pfkfb4 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 [Source:Xenbase;Acc:XB-GENE-1001570])

HSP 1 Score: 66.6254 bits (161), Expect = 1.304e-13
Identity = 32/94 (34.04%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  109 VEKTESMRIVTDEKIIGFGTEEKSIV--CPKCLEEILTVVKFKVGCQTWLFCFGIGIF--CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            V   + ++      I+G   ++  +   CP C + I+T +++ VG  +W+  F + +F  C LGCC+IPF +  CKD  H+CP C+  L +YKR
Sbjct:   90 VVNAQPLQSAPVHTIVGSSFQDTPVTATCPNCNQRIITRLQYSVGLFSWIL-FAVFMFFGCWLGCCIIPFVMDRCKDVDHYCPSCNYLLHKYKR 182          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Mouse
Match: Litaf (LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1929512])

HSP 1 Score: 65.0846 bits (157), Expect = 2.774e-13
Identity = 30/86 (34.88%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  ++ + F      + CP C + I+T + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 AVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Mouse
Match: Litaf (LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1929512])

HSP 1 Score: 65.0846 bits (157), Expect = 2.774e-13
Identity = 30/86 (34.88%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  ++ + F      + CP C + I+T + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 AVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Mouse
Match: Gm5767 (predicted gene 5767 [Source:MGI Symbol;Acc:MGI:3643507])

HSP 1 Score: 62.3882 bits (150), Expect = 3.308e-13
Identity = 31/66 (46.97%), Postives = 38/66 (57.58%), Query Frame = 1
Query:  184 VCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            VCP C   I+TV  +  G  TWL C G+ +F C LGCCLIPFC+R   D  H CP C   +  + R
Sbjct:   10 VCPYCGNRIMTVTTYTPGLLTWLLCSGLFVFGCFLGCCLIPFCIRSTMDVTHSCPMCHHQIYYFHR 75          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Mouse
Match: Cdip1 (cell death inducing Trp53 target 1 [Source:MGI Symbol;Acc:MGI:1913876])

HSP 1 Score: 51.6026 bits (122), Expect = 3.832e-8
Identity = 29/70 (41.43%), Postives = 38/70 (54.29%), Query Frame = 1
Query:  184 VCPKCLEEILTVVKFKVGCQTWLFCFGIGIFC-----PLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            VCP C + I T + +++G    L  F +G FC      LGCCLIP  + + KD  H CP C  Y+  YKR
Sbjct:  124 VCPHCQQAITTKISYEIG----LMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKR 189          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Mouse
Match: Cdip1 (cell death inducing Trp53 target 1 [Source:MGI Symbol;Acc:MGI:1913876])

HSP 1 Score: 51.6026 bits (122), Expect = 5.138e-8
Identity = 29/70 (41.43%), Postives = 38/70 (54.29%), Query Frame = 1
Query:  184 VCPKCLEEILTVVKFKVGCQTWLFCFGIGIFC-----PLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            VCP C + I T + +++G    L  F +G FC      LGCCLIP  + + KD  H CP C  Y+  YKR
Sbjct:  141 VCPHCQQAITTKISYEIG----LMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKR 206          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. UniProt/SwissProt
Match: sp|Q8QGW7|LITAF_CHICK (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Gallus gallus OX=9031 GN=LITAF PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.272e-14
Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 1
Query:  133 IVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +   + ++ F      + CP C + I+T + ++ G  TWL C G+ +  C  GCCLIPFC+   KD  HFCP C+ ++G YKR
Sbjct:   65 VYVQQPVVLFYDRPVQMSCPSCNQMIVTRLCYESGALTWLSCGGLFLLGCIAGCCLIPFCVDALKDVEHFCPNCNAHVGSYKR 147          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. UniProt/SwissProt
Match: sp|Q6GMG8|LITAF_DANRE (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Danio rerio OX=7955 GN=litaf PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.501e-13
Identity = 31/74 (41.89%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            FG       CP C + ++T +++  G   WL C G+ +F C  GCCLIPFC+ + KD  H CP C   LG +KR
Sbjct:   89 FGNVPVQAHCPVCSQSVITRLEYSSGPLVWLSCAGLAVFGCIYGCCLIPFCIEDLKDVTHHCPNCSSVLGVHKR 162          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. UniProt/SwissProt
Match: sp|P0C0T0|LITAF_RAT (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Rattus norvegicus OX=10116 GN=Litaf PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.941e-12
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  ++ I F      + CP C + I+T + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 AVQTVYVQQPISFYDRPIQMCCPSCNKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. UniProt/SwissProt
Match: sp|Q9JLJ0|LITAF_MOUSE (Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Mus musculus OX=10090 GN=Litaf PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.941e-12
Identity = 30/86 (34.88%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  ++ + F      + CP C + I+T + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 AVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. UniProt/SwissProt
Match: sp|Q99732|LITAF_HUMAN (Lipopolysaccharide-induced tumor necrosis factor-alpha factor OS=Homo sapiens OX=9606 GN=LITAF PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 6.485e-11
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  124 SMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +++ V  +  I F      + CP C + I++ + +  G  TWL C  + +  C  GCC IPFC+   +D  H+CP C   LG YKR
Sbjct:   75 TVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. TrEMBL
Match: A0A1I8BH51 (LITAF domain-containing protein OS=Meloidogyne hapla OX=6305 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 4.563e-16
Identity = 39/88 (44.32%), Postives = 54/88 (61.36%), Query Frame = 1
Query:  118 TESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            T +   V D +   FG + ++  CP C +++LT VK   G  TWL   G  IF C LGCCL+PFC+ +C+D  HFC  C+ +LG+YKR
Sbjct:   51 TTTYVYVNDGQRPPFGPQPQNAYCPTCQQQVLTKVKHSAGLLTWLVFGGCLIFGCWLGCCLLPFCMDDCQDCEHFCSNCNTFLGQYKR 138          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. TrEMBL
Match: Q5DFA9 (Lipopolysaccharide-induced tumor necrosis factor-alpha factor isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_009733 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.658e-16
Identity = 42/77 (54.55%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  163 GTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGI----GIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 381
            G     I+CP C +EI T V +K G  TW+ CFGI    GIF   GCCLIPFC   CKDA H+CP C+ YLG Y+RC
Sbjct:   52 GPSPAVILCPYCRKEITTRVDYKTGILTWVGCFGIFLVGGIF---GCCLIPFCCDSCKDADHYCPLCNHYLGLYRRC 125          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. TrEMBL
Match: A0A4Z2DQY6 (Lipopolysaccharide-induced tumor necrosis factor-alpha factor isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009733 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.903e-16
Identity = 42/77 (54.55%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  163 GTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGI----GIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 381
            G     I+CP C +EI T V +K G  TW+ CFGI    GIF   GCCLIPFC   CKDA H+CP C+ YLG Y+RC
Sbjct:   73 GPSPAVILCPYCRKEITTRVDYKTGILTWVGCFGIFLVGGIF---GCCLIPFCCDSCKDADHYCPLCNHYLGLYRRC 146          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. TrEMBL
Match: A0A1S3IHU7 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Lingula unguis OX=7574 GN=LOC106164438 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.567e-15
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF--CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            FG   K + CP C   + T V++  G  TWL   GI +F  C LGCCLIPFC+++ KDA HFCP C+R LG Y R
Sbjct:   70 FGPNSKQMQCPYCQAHVTTSVEYYSGGATWLVA-GITLFVGCWLGCCLIPFCIQDLKDARHFCPNCNRTLGTYHR 143          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. TrEMBL
Match: A0A0N9K8D9 (Lipopolysaccharide-induced tumor necrosis factor-alpha factor 1 OS=Brachionus koreanus OX=1199090 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 6.601e-15
Identity = 34/71 (47.89%), Postives = 45/71 (63.38%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGI-GIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGR 369
             G     +VCP+C  +++T V +K G  TWL C G+  I C LGC  IPFC+  CKD+ H+CP C+ YLGR
Sbjct:   46 LGKNPSHVVCPQCKAQVVTRVNYKTGGGTWLICLGLCLIGCTLGCQFIPFCVDSCKDSEHYCPNCNTYLGR 116          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Cavefish
Match: litaf (lipopolysaccharide-induced TNF factor [Source:NCBI gene;Acc:431731])

HSP 1 Score: 70.0922 bits (170), Expect = 2.039e-15
Identity = 33/74 (44.59%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            FG     + CP C + ++T + +  G  TWL C G+ IF C  GCCLIPFC+   KD  H CP C   LG +KR
Sbjct:   78 FGHTPVQVHCPNCAQTVVTRLDYSSGTMTWLTCAGLFIFGCIYGCCLIPFCVDSLKDVTHHCPNCSSVLGVFKR 151          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Cavefish
Match: ENSAMXT00000041239.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:195968:202131:-1 gene:ENSAMXG00000040302.1 transcript:ENSAMXT00000041239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 7.834e-13
Identity = 32/73 (43.84%), Postives = 40/73 (54.79%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            F      + CP C    +T V++  G  T+LFC G+   C LGCCLIPFC+   +DA H C  C   LG YKR
Sbjct:   50 FTDSPVQVTCPTCRHTAVTQVQYTPGLLTYLFCGGL--LCFLGCCLIPFCVDRLRDAKHVCSNCKAVLGVYKR 120          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Cavefish
Match: si:ch211-157c3.4 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog [Source:NCBI gene;Acc:103024010])

HSP 1 Score: 61.2326 bits (147), Expect = 4.266e-12
Identity = 33/75 (44.00%), Postives = 44/75 (58.67%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPL--GCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
             G    +  C  C E++LT V +KVG   WL C  + I C L  GCCLIPF ++  KDA+H CP+C+R L   K+
Sbjct:   67 LGRSPGTTTCTSCREQVLTNVTYKVGAFAWLMCI-LFILCGLVIGCCLIPFFVKYFKDAYHTCPRCNRILHVEKK 140          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Cavefish
Match: cdip1 (cell death inducing p53 target 1 [Source:NCBI gene;Acc:103033134])

HSP 1 Score: 56.225 bits (134), Expect = 9.182e-10
Identity = 31/74 (41.89%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFC-FGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            F +     VCP C + I+T +   VG    LFC F   + C LGCCLIP  + + KD  H CP C  Y+  YKR
Sbjct:  137 FQSAPVQTVCPHCQQAIITRISHDVGLMNTLFCLFCFFVGCDLGCCLIPCLIDDLKDVTHTCPNCKGYIYTYKR 210          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Cavefish
Match: ENSAMXT00000036300.1 (lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog [Source:NCBI gene;Acc:111193504])

HSP 1 Score: 50.8322 bits (120), Expect = 2.286e-8
Identity = 31/74 (41.89%), Postives = 37/74 (50.00%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPL-GCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
             G     + C  C +EI+TV K   G  TW   FG+ + C +   CLIPFC   CKD  H CP C   L  YKR
Sbjct:   59 LGESPGRMKCMYCQQEIVTVTKPVTGILTWTI-FGVLLACLIWPFCLIPFCCAPCKDVEHTCPYCHNILSVYKR 131          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Nematostella
Match: EDO33373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF9])

HSP 1 Score: 68.5514 bits (166), Expect = 1.028e-15
Identity = 34/76 (44.74%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  154 IGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIF-CPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            IGF     S+ CP C   I+T   +  G  TWL CFG+ I  C LGCC IPFC+   KD  H CP C   +G ++R
Sbjct:   27 IGFYETPVSMNCPTCHATIVTATDYVTGTLTWLACFGLCIIGCDLGCCFIPFCVDSMKDVVHTCPNCRSQVGVFRR 102          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Nematostella
Match: EDO37753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SES1])

HSP 1 Score: 60.8474 bits (146), Expect = 2.894e-13
Identity = 32/67 (47.76%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCP-LGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +VC  C   I+T   ++ G  TWL   GI +    LGCCLIPFCL  CKD  H CP C   LG Y+R
Sbjct:    1 MVCSFCQTHIVTATTYRYGALTWLLSGGICLLGGWLGCCLIPFCLDGCKDVIHTCPNCQAQLGVYRR 67          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Nematostella
Match: EDO42963 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S062])

HSP 1 Score: 57.7658 bits (138), Expect = 1.084e-11
Identity = 30/75 (40.00%), Postives = 37/75 (49.33%), Query Frame = 1
Query:  154 IGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            + FG    S+VCP C   I+T   +  G   WL C  I  F    CC +PF L  CKD  H CP C R +G + R
Sbjct:   31 VSFGESPTSMVCPYCQATIVTATSYVPGTCAWLICLVIFCFF-WPCCFLPFVLDGCKDVVHSCPNCQRQVGVFTR 104          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Nematostella
Match: EDO37779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW4])

HSP 1 Score: 53.5286 bits (127), Expect = 2.323e-9
Identity = 30/90 (33.33%), Postives = 45/90 (50.00%), Query Frame = 1
Query:  121 ESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQT---WLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 381
            E  +   DE +  F        C  C+  ++TVV+F++G  T       F +G  C  GCCL+PF ++  +D  H CP C   LG+Y+R 
Sbjct:   77 EDRQDYRDESVYTF--------CGSCMNHMMTVVRFRIGRMTVAVSALVFMLG--CVAGCCLVPFIIKGLRDVIHSCPNCQITLGKYRRT 156          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Medaka
Match: ENSORLT00000037533.1 (pep primary_assembly:ASM223467v1:1:23682164:23683902:-1 gene:ENSORLG00000026577.1 transcript:ENSORLT00000037533.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 3.081e-14
Identity = 36/75 (48.00%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCP--LGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
             G     I CPKC   +L+ V    G  T+L C G+  FC   LGCCLIPFC+   KDA H CP C   LG YKR
Sbjct:   32 LGANPVQIACPKCHRTVLSKVDHSAGLLTYLLCGGL-FFCGFVLGCCLIPFCVDRVKDAKHSCPSCKTILGVYKR 105          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Medaka
Match: si:ch211-202h22.9 (si:ch211-202h22.9 [Source:ZFIN;Acc:ZDB-GENE-030131-1143])

HSP 1 Score: 64.3142 bits (155), Expect = 5.803e-13
Identity = 29/66 (43.94%), Postives = 39/66 (59.09%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            ++CP C   ++T  + KVG QTWL    +GI     CCLIPFC+  CKD  H CP C+  L  ++R
Sbjct:  122 MLCPHCQNTVVTKTEHKVGMQTWLIFGVLGIIGCWPCCLIPFCVNSCKDVQHSCPSCNNVLHVHRR 187          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Medaka
Match: ENSORLT00000034967.1 (pep primary_assembly:ASM223467v1:8:13374012:13375390:1 gene:ENSORLG00000029819.1 transcript:ENSORLT00000034967.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 8.094e-12
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:  187 CPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            C  C + +LT   F++G   W+FC GI +     C L+PFCL  CKD  H+CP C+  L  Y++
Sbjct:   49 CVYCQKNVLTRTSFEIGAMAWVFCGGITLLGCWPCMLLPFCLDSCKDVKHYCPSCNNLLHFYRK 112          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Medaka
Match: cdip1 (cell death inducing p53 target 1 [Source:NCBI gene;Acc:101173632])

HSP 1 Score: 55.8398 bits (133), Expect = 8.791e-10
Identity = 32/74 (43.24%), Postives = 39/74 (52.70%), Query Frame = 1
Query:  160 FGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFC-FGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            F T     VCP C + I+T +   VG    LFC F   + C LGCCLIP  + + KD  H CP C  Y+  YKR
Sbjct:  130 FQTSPVQTVCPHCQQAIVTRISHDVGLMNTLFCLFCFFVGCDLGCCLIPCLIDDLKDVTHTCPYCKGYIYTYKR 203          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Medaka
Match: ENSORLT00000010755.2 (cell death-inducing p53-target protein 1 homolog [Source:NCBI gene;Acc:105354377])

HSP 1 Score: 53.1434 bits (126), Expect = 2.968e-9
Identity = 28/67 (41.79%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGIGI-FCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +VCP C E + T VK   G Q W  C  + + FC  G CLIPF +  C+D  HFCP C + +  ++R
Sbjct:   67 VVCPHCQELVTTKVKHVAGKQAWGICMTLTLLFC--GFCLIPFAVPHCQDVAHFCPGCKKKIYVFER 131          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Planmine SMEST
Match: SMESG000033033.1 (SMESG000033033.1)

HSP 1 Score: 187.578 bits (475), Expect = 2.097e-62
Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 1
Query:  103 MDVEKTESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 381
            MDVEKTESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC
Sbjct:    1 MDVEKTESMRIVTDEKIIGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 93          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Planmine SMEST
Match: SMESG000020865.1 (SMESG000020865.1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.037e-14
Identity = 33/76 (43.42%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  154 IGFGTEEKSIVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKRC 381
            I +G+ +  + C KC  E+   + +K G  TWL CF I +F P+GCCLIPFC+   KD  + CP CD  L   +RC
Sbjct:   66 INYGSSK--VRCDKCENEVFPAISYKSGGFTWLMCFIIFLFAPIGCCLIPFCINGFKDEKYKCPICDHKLYELRRC 139          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Planmine SMEST
Match: SMESG000020864.1 (SMESG000020864.1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.397e-13
Identity = 37/101 (36.63%), Postives = 55/101 (54.46%), Query Frame = 1
Query:  106 DVEKTESMRIVTDE-KIIGFGTEEKS----------IVCPKCLEEILTVVKFKVGCQTWLFCFGIGIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYK 375
            D++ ++S R++ ++ KI+     + S          + CP C E I+T V  K+G  T L C  +G+  P GCCL PFCL   KDA H CPKC + +  +K
Sbjct:   36 DLQVSKSDRVIKNQIKILDRDQVDSSKSYLKDKPEIMHCPNCNEYIMTAVAHKIGRFTCLSCLVLGVLLPYGCCLAPFCLEGFKDAIHSCPKCKKVIFEHK 136          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Planmine SMEST
Match: SMESG000079265.1 (SMESG000079265.1)

HSP 1 Score: 61.2326 bits (147), Expect = 5.247e-13
Identity = 31/68 (45.59%), Postives = 43/68 (63.24%), Query Frame = 1
Query:  178 SIVCPKCLEEILTVVKFKVGCQTWLFCFGI-GIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            S+VCP C   I+T V++  G  T+L  F    I C  GCCLIPF +++ KD  H+CP+C+  LG Y+R
Sbjct:    4 SMVCPHCNSTIVTTVRYDNGTLTFLLAFITCFIGCVCGCCLIPFFVKQFKDVKHYCPRCNALLGEYRR 71          
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Planmine SMEST
Match: SMESG000079265.1 (SMESG000079265.1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.448e-12
Identity = 30/67 (44.78%), Postives = 42/67 (62.69%), Query Frame = 1
Query:  181 IVCPKCLEEILTVVKFKVGCQTWLFCFGI-GIFCPLGCCLIPFCLRECKDAHHFCPKCDRYLGRYKR 378
            +VCP C   I+T V++  G  T+L  F    I C  GCCLIPF +++ KD  H+CP+C+  LG Y+R
Sbjct:    1 MVCPHCNSTIVTTVRYDNGTLTFLLAFITCFIGCVCGCCLIPFFVKQFKDVKHYCPRCNALLGEYRR 67          
The following BLAST results are available for this feature:
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LITAF1.041e-1141.54lipopolysaccharide induced TNF factor [Source:HGNC... [more]
LITAF1.350e-1134.88lipopolysaccharide induced TNF factor [Source:HGNC... [more]
LITAF1.350e-1134.88lipopolysaccharide induced TNF factor [Source:HGNC... [more]
LITAF1.350e-1134.88lipopolysaccharide induced TNF factor [Source:HGNC... [more]
LITAF1.350e-1134.88lipopolysaccharide induced TNF factor [Source:HGNC... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F16F9.18.421e-1136.67pep chromosome:WBcel235:X:8440192:8450406:1 gene:W... [more]
F16F9.18.421e-1136.67pep chromosome:WBcel235:X:8447269:8450417:1 gene:W... [more]
F36G3.39.875e-1136.05pep chromosome:WBcel235:X:9798839:9801038:1 gene:W... [more]
Y87G2A.193.267e-732.63pep chromosome:WBcel235:I:13508785:13512026:1 gene... [more]
Y87G2A.193.267e-732.63pep chromosome:WBcel235:I:13508814:13512026:1 gene... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG322801.422e-1449.25gene:FBgn0052280 transcript:FBtr0073031[more]
CG322801.422e-1449.25gene:FBgn0052280 transcript:FBtr0073030[more]
CG322801.422e-1449.25gene:FBgn0052280 transcript:FBtr0344220[more]
CG322801.422e-1449.25gene:FBgn0052280 transcript:FBtr0073032[more]
CG135101.353e-1129.76gene:FBgn0034758 transcript:FBtr0071862[more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
litaf3.314e-1441.89lipopolysaccharide-induced TNF factor [Source:NCBI... [more]
si:ch211-202h22.81.176e-1346.88si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
si:ch211-202h22.81.176e-1346.88si:ch211-202h22.8 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
si:ch211-202h22.71.299e-1243.75si:ch211-202h22.7 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
si:ch211-202h22.71.715e-1243.75si:ch211-202h22.7 [Source:ZFIN;Acc:ZDB-GENE-090313... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000031517.13.420e-1645.95LITAF domain containing [Source:NCBI gene;Acc:1004... [more]
pfkfb44.197e-1433.336-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb49.112e-1434.046-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb49.908e-1433.336-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
pfkfb41.304e-1334.046-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Litaf2.774e-1334.88LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1... [more]
Litaf2.774e-1334.88LPS-induced TN factor [Source:MGI Symbol;Acc:MGI:1... [more]
Gm57673.308e-1346.97predicted gene 5767 [Source:MGI Symbol;Acc:MGI:364... [more]
Cdip13.832e-841.43cell death inducing Trp53 target 1 [Source:MGI Sym... [more]
Cdip15.138e-841.43cell death inducing Trp53 target 1 [Source:MGI Sym... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8QGW7|LITAF_CHICK5.272e-1438.55Lipopolysaccharide-induced tumor necrosis factor-a... [more]
sp|Q6GMG8|LITAF_DANRE2.501e-1341.89Lipopolysaccharide-induced tumor necrosis factor-a... [more]
sp|P0C0T0|LITAF_RAT1.941e-1236.05Lipopolysaccharide-induced tumor necrosis factor-a... [more]
sp|Q9JLJ0|LITAF_MOUSE1.941e-1234.88Lipopolysaccharide-induced tumor necrosis factor-a... [more]
sp|Q99732|LITAF_HUMAN6.485e-1134.88Lipopolysaccharide-induced tumor necrosis factor-a... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8BH514.563e-1644.32LITAF domain-containing protein OS=Meloidogyne hap... [more]
Q5DFA95.658e-1654.55Lipopolysaccharide-induced tumor necrosis factor-a... [more]
A0A4Z2DQY65.903e-1654.55Lipopolysaccharide-induced tumor necrosis factor-a... [more]
A0A1S3IHU74.567e-1550.67lipopolysaccharide-induced tumor necrosis factor-a... [more]
A0A0N9K8D96.601e-1547.89Lipopolysaccharide-induced tumor necrosis factor-a... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
litaf2.039e-1544.59lipopolysaccharide-induced TNF factor [Source:NCBI... [more]
ENSAMXT00000041239.17.834e-1343.84pep primary_assembly:Astyanax_mexicanus-2.0:12:195... [more]
si:ch211-157c3.44.266e-1244.00lipopolysaccharide-induced tumor necrosis factor-a... [more]
cdip19.182e-1041.89cell death inducing p53 target 1 [Source:NCBI gene... [more]
ENSAMXT00000036300.12.286e-841.89lipopolysaccharide-induced tumor necrosis factor-a... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO333731.028e-1544.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377532.894e-1347.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429631.084e-1140.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377792.323e-933.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037533.13.081e-1448.00pep primary_assembly:ASM223467v1:1:23682164:236839... [more]
si:ch211-202h22.95.803e-1343.94si:ch211-202h22.9 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
ENSORLT00000034967.18.094e-1240.63pep primary_assembly:ASM223467v1:8:13374012:133753... [more]
cdip18.791e-1043.24cell death inducing p53 target 1 [Source:NCBI gene... [more]
ENSORLT00000010755.22.968e-941.79cell death-inducing p53-target protein 1 homolog [... [more]
back to top
BLAST of lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033033.12.097e-62100.00SMESG000033033.1[more]
SMESG000020865.11.037e-1443.42SMESG000020865.1[more]
SMESG000020864.14.397e-1336.63SMESG000020864.1[more]
SMESG000079265.15.247e-1345.59SMESG000079265.1[more]
SMESG000079265.12.448e-1244.78SMESG000079265.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035250 ID=SMED30035250|Name=lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=512bp
CCGAAATTAGATACATTTTAATTTTAAAGCAGCTTTCAAAAATTGTTTAG
ACATTTGTATTTTACTTTCTGTATTTAATTTCGGAGCATCACACACAACT
AAATGGACGTCGAGAAAACAGAATCTATGCGTATTGTAACTGATGAAAAA
ATAATTGGTTTTGGCACCGAAGAAAAGAGCATTGTCTGTCCGAAATGCCT
CGAGGAAATTCTCACGGTCGTGAAATTCAAAGTCGGATGCCAAACATGGC
TCTTTTGTTTTGGGATTGGGATTTTCTGTCCATTGGGATGCTGCTTGATA
CCATTTTGCCTTCGGGAATGCAAAGATGCCCACCATTTTTGCCCAAAATG
CGATCGATATCTCGGACGATATAAACGATGCTAAAAATTATTTCCGCATT
TGACCTGCTTATTAAACAAAATCGCTTGCTTGTATATCAATTTTTTTTGA
ATTTTTTCTAAGCGCTTTTATTAATCAAAAAGCAAAATATTTAATAAATT
TTTTAATAATAA
back to top

protein sequence of SMED30035250-orf-1

>SMED30035250-orf-1 ID=SMED30035250-orf-1|Name=SMED30035250-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MVGIFAFPKAKWYQAASQWTENPNPKTKEPCLASDFEFHDRENFLEAFRT
DNALFFGAKTNYFFISYNTHRFCFLDVHLVVCDAPKLNTESKIQMSKQFL
KAALKLKCI*
back to top
Aliases
The feature 'lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog' has the following synonyms
Synonym
litaf
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR037519LITAF_fam
IPR006629LITAF
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006629LPS-induced tumour necrosis factor alpha factorSMARTSM00714litafcoord: 24..92
e-value: 6.2E-20
score: 82.2
IPR006629LPS-induced tumour necrosis factor alpha factorPFAMPF10601zf-LITAF-likecoord: 25..91
e-value: 2.7E-20
score: 72.4
IPR006629LPS-induced tumour necrosis factor alpha factorPROSITEPS51837LITAFcoord: 7..92
score: 18.567
IPR037519LITAF domain containing proteinPANTHERPTHR23292LIPOPOLYSACCHARIDE-INDUCED TRANSCRIPTION FACTOR REGULATING TUMOR NECROSIS FACTOR ALPHAcoord: 18..92
NoneNo IPR availablePANTHERPTHR23292:SF2LIPOPOLYSACCHARIDE-INDUCED TUMOR NECROSIS FACTOR-ALPHA FACTORcoord: 18..92
NoneNo IPR availableTMHMMTMhelixcoord: 48..70