Ubiquitin carboxyl-terminal hydrolase 1, putative

Overview
NameUbiquitin carboxyl-terminal hydrolase 1, putative
Smed IDSMED30035249
Length (bp)4009
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin carboxyl-terminal hydrolase 1, putative (SMED30035249) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase 1, putative (SMED30035249) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin carboxyl-terminal hydrolase 1, putative (SMED30035249) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin carboxyl-terminal hydrolase 1, putative (SMED30035249) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035249

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035249SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035249SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035249SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035249SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035249SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249SMESG000081574.1 SMESG000077556.1 SMESG000050479.1 SMESG000044971.1 SMESG000038481.1 SMESG000015216.1 Contig21206uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249SMESG000081574.1 SMESG000077556.1 SMESG000050479.1 SMESG000044971.1 SMESG000038481.1 SMESG000015216.1 Contig21206newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249SMESG000027783.1 SMESG000027888.1 Contig4616GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249SMESG000038481.1 Contig13466uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249SMESG000038481.1 Contig13466newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249SMESG000038481.1 SMESG000038485.1 Contig4616GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249 Contig13053uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035249 Contig13053newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30035249SMESG000038485.1 SMESG000038481.1 Contig6998uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30035249SMESG000038485.1 SMESG000038481.1 Contig6998newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30035249SMESG000038481.1 dd_Smed_v4_6644_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Celegans
Match: usp-48 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:G5ECC7])

HSP 1 Score: 54.6842 bits (130), Expect = 5.693e-7
Identity = 86/346 (24.86%), Postives = 137/346 (39.60%), Query Frame = 2
Query:   86 IEKIIEMTSKSSVTNSIHESSIEKRQNNFQSIKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKS-NPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELS------CCEYPNIKLSSQYAAVPQYIFIYLVRGAY--RINEKKVDTFIYFRSFIDIPTK----------DGNVKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEI 1063
            +EK  ++ ++   T    +   ++R  N Q     GL N  +FCY+NS LQ+ ++   FR  + ++  S N              + AL D+F ++++    E   + S L  L + +S   D  +  L+     NA+ RC   P++   +   K          L DLF+G  C    C CG+    + +T  S+ L +          +C L    D+   E  L       C +  ++   S Y  +P  I I L R  Y  +  +K      Y R   +IP K               Y + +V  H G  +E GHYY   L +S  + KW   ND  V  I
Sbjct:   77 LEKFEKLITQEQETKEEAKKDQKRRDLNDQP---AGLINGGNFCYVNSFLQVWFNVPEFRQLIYDFRPSENFVPPEAPRMNVQATMLALQDIFYTLQTTPFNETD-KTSNLGKLLRLNSEQQDSQEFGLKFF---NALERC--LPDHPNGKETLK---------RLKDLFTGETCTRIVCKCGQR-SEREETAISLTLNIEG--------YCTLLDALDAYFGEEHLDDFKCSKCNKTGDVSKQSDYVKLPPVIVIQLNRYKYTSKGRQKLKTPMAYPR---EIPAKAFQRTNNSIPPPAEMYDLFAVTIHEGNNAECGHYY--DLIKSPLNQKWYRYNDETVEAI 390          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Zebrafish
Match: usp46 (ubiquitin specific peptidase 46 [Source:NCBI gene;Acc:100148916])

HSP 1 Score: 52.373 bits (124), Expect = 2.480e-6
Identity = 73/335 (21.79%), Postives = 141/335 (42.09%), Query Frame = 2
Query:  185 HMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSIL--QTLFQTSSAGDDIHKCYLQ---------ILSRINAVTRCSTAPENIGDQ---NECKIKSKTQYDESLID------LFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELS-----CCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSF---IDIPTKDGNV-----KYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRF 1090
            + GL N  + CY NSVLQ LY C+ FR  +  +          +  +  N +  L DLF+S+ +Q +     +V ++  +         +D+   Y+Q         +L+ +  + +     E    +   N   I + T+ +++ ID      +F G +  ET+C   +++ SK + F  + ++V  +    SI HC L  F ++  + SE       CC     +   +   +P  + ++L R  Y     +     Y   F   + +    G+       Y +++V+ H G   N  +Y+  +   ++   WLL +D  +VE  D++  + F
Sbjct:   34 YFGLVNFGNTCYCNSVLQALYFCRPFRENVLAY--------KVQQKKKENLLTCLADLFHSIATQKK-----KVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTVADILQEERKQEKQNGRLKNNGTAIATDTEPEQNKIDPTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQN---TSITHC-LRDFSNTETLCSEYKYYCEMCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDAVNLDRMYDLVAVVVHCGSGPNRGHYITIV---KSHGFWLLFDDD-IVEKIDAQAIEEF 347          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Mouse
Match: Usp50 (ubiquitin specific peptidase 50 [Source:MGI Symbol;Acc:MGI:1922333])

HSP 1 Score: 61.2326 bits (147), Expect = 4.715e-9
Identity = 82/365 (22.47%), Postives = 156/365 (42.74%), Query Frame = 2
Query:  128 NSIHESSIEKRQNNFQSIKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXX---XXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQT--SSAGDDIHKCYLQILSRINAVTR--CSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIK----LSSQYAAVPQYIFIYLVRGAYR-INEKKVDTFIYFR-SFIDI-----PTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV-----------CKRFSIGILLEKAENGIQD 1135
            +S+ ES   K Q +FQ +   GL N  + CY+N++LQ L S       L E+  S   +T  +   +     F Y + D++      V  E+   +S + +L+         D  +  + +L+ ++   +  C            C  K   Q    +  LF G + +   C   +S   K++ F  + L +PS  ++ S++ C+   F+  T+  S    C +  IK    + +  + VP+ I  +  R   +   ++K+ T I++  + +D+     P    +  Y + +V++H G  + GHY   A  ++  +  W   +D++V EI D+ V           C+ FSI     K+++   D
Sbjct:   30 DSLPES---KTQPHFQGVT--GLRNLGNTCYMNAILQCLCSVS----PLVEYFLSGKYITALKKDCSEVTTAFAYLMTDMWLGDSDCVSPEI--FLSAVGSLYPAFLKKTQQDAQEFLIYVLNELHEALKKHCRRRVNEKRTGQSCCRKVPAQETSIITRLFEGQLSYSITCLKCESCTHKNEVFTILSLPIPSD-YECSLQDCLQCFFQQDTLTWSNQIYCSFCEIKQEAAVRTTISKVPKIIVFHFKRFDIQGTVKRKLRTDIHYPLTNLDLTPYICPVFRKHPMYNLCAVVNHFGDLDGGHY--TAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFYSCQPFSIPAQKRKSQDSTPD 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Mouse
Match: Usp50 (ubiquitin specific peptidase 50 [Source:MGI Symbol;Acc:MGI:1922333])

HSP 1 Score: 51.9878 bits (123), Expect = 3.070e-6
Identity = 63/290 (21.72%), Postives = 124/290 (42.76%), Query Frame = 2
Query:  335 FVYALGDLFNSMESQVEEEVQ-FRVSILQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIK----LSSQYAAVPQYIFIYLVRGAYR-INEKKVDTFIYFR-SFIDI-----PTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV-----------CKRFSIGILLEKAENGIQD 1135
            F+ A+G L+ +   + +++ Q F + +L  L +                 R+N         E    Q+ C+ K   Q    +  LF G + +   C   +S   K++ F  + L +PS  ++ S++ C+   F+  T+  S    C +  IK    + +  + VP+ I  +  R   +   ++K+ T I++  + +D+     P    +  Y + +V++H G  + GHY   A  ++  +  W   +D++V EI D+ V           C+ FSI     K+++   D
Sbjct:   52 FLSAVGSLYPAFLKKTQQDAQEFLIYVLNELHEALKK---------HCRRRVN---------EKRTGQSCCR-KVPAQETSIITRLFEGQLSYSITCLKCESCTHKNEVFTILSLPIPSD-YECSLQDCLQCFFQQDTLTWSNQIYCSFCEIKQEAAVRTTISKVPKIIVFHFKRFDIQGTVKRKLRTDIHYPLTNLDLTPYICPVFRKHPMYNLCAVVNHFGDLDGGHY--TAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFYSCQPFSIPAQKRKSQDSTPD 319          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. UniProt/SwissProt
Match: sp|O24454|UBP3_ARATH (Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana OX=3702 GN=UBP3 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.090e-9
Identity = 84/337 (24.93%), Postives = 149/337 (44.21%), Query Frame = 2
Query:  182 KHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEE--------VQFRVSILQTLFQTSSAGDDIHKCYLQILSRINAV-------------TRCSTAPENIGDQNECKIKSKTQYDESLI----DLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESE-----LSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGN-------VKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV 1078
            ++ G  N  + CY NSVLQ LY C  FR +L E+  SN  +     +   N +  L DLF+ + SQ ++         VQ R+     LF+ S    D H+    +L+ +  +             T  S++PE I +  +    +   + E ++    ++F G++  ET+C   +++ ++ +TF  + L++  +    SI  C+ N F  +  + +E       CC     +   +    P  + I+L R  Y I +      + +R    +  K  N       V+Y + +V+ H+G G  +GHY   +L +S N   WL  +D  V  I++S V
Sbjct:   21 RYFGFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKSVA----DAEENLMTCLADLFSQISSQKKKTGVIAPKRFVQ-RLKKQNELFR-SYMHQDAHEFLNYLLNEVVDILEKEAKATKTEHETSSSSSPEKIANGLKVPQANGVVHKEPIVTWVHNIFQGILTNETRCLRCETVTARDETFLDLSLDIEQNS---SITSCLKN-FSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKY-IEQLGRYKKLSYRVVFPLELKLSNTVEPYADVEYSLFAVVVHVGSGPNHGHYV--SLVKSHN--HWLFFDDENVEMIEESAV 342          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. UniProt/SwissProt
Match: sp|Q8LAM0|UBP4_ARATH (Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana OX=3702 GN=UBP4 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 2.613e-8
Identity = 85/335 (25.37%), Postives = 148/335 (44.18%), Query Frame = 2
Query:  182 KHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEE--------VQFRVSILQTLFQTSSAGDDIHKC--YL-----QILSRINAVTRC----STAPENIGDQNECKIKSKTQYDESLID----LFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESE-----LSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGN-------VKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV 1078
            ++ G  N  + CY NSVLQ LY C  FR +L E   +N      + +   N +  L DLF+ + SQ ++         VQ R+     LF+ S    D H+   YL     +IL +    T+     S++PE I +  +  + +   + E ++     +F G++  ET+C   +++ ++ +TF  + L++  +    SI  C+ N F  +  + +E       CC     +   +    P  + I+L R  Y     +     Y R    +  K  N       ++Y + +V+ H+G G  +GHY   +L +S N   WL  +D  V  I++S V
Sbjct:   21 RYFGFENFGNTCYCNSVLQALYFCAPFREQLLEHYANN------KADAEENLLTCLADLFSQISSQKKKTGVIAPKRFVQ-RLKKQNELFR-SYMHQDAHEFLNYLLNELVEILEKETQATKADNETSSSPEKIANVLKAPLANGV-HKEPIVTWVHKIFQGILTNETRCLRCETVTARDETFLDLSLDIEQNS---SITSCLKN-FSSTETLHAEDKFFCDKCCSLQEAQKRMKIKKPPHILVIHLKRFKYMEQLGRYKKLSY-RVVFPLELKLSNTVDEYVDIEYSLFAVVVHVGSGPNHGHYV--SLVKSHN--HWLFFDDESVEIIEESAV 337          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. UniProt/SwissProt
Match: sp|Q6P8X6|UBP50_MOUSE (Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.298e-8
Identity = 82/365 (22.47%), Postives = 156/365 (42.74%), Query Frame = 2
Query:  128 NSIHESSIEKRQNNFQSIKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXX---XXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQT--SSAGDDIHKCYLQILSRINAVTR--CSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIK----LSSQYAAVPQYIFIYLVRGAYR-INEKKVDTFIYFR-SFIDI-----PTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV-----------CKRFSIGILLEKAENGIQD 1135
            +S+ ES   K Q +FQ +   GL N  + CY+N++LQ L S       L E+  S   +T  +   +     F Y + D++      V  E+   +S + +L+         D  +  + +L+ ++   +  C            C  K   Q    +  LF G + +   C   +S   K++ F  + L +PS  ++ S++ C+   F+  T+  S    C +  IK    + +  + VP+ I  +  R   +   ++K+ T I++  + +D+     P    +  Y + +V++H G  + GHY   A  ++  +  W   +D++V EI D+ V           C+ FSI     K+++   D
Sbjct:   30 DSLPES---KTQPHFQGVT--GLRNLGNTCYMNAILQCLCSVS----PLVEYFLSGKYITALKKDCSEVTTAFAYLMTDMWLGDSDCVSPEI--FLSAVGSLYPAFLKKTQQDAQEFLIYVLNELHEALKKHCRRRVNEKRTGQSCCRKVPAQETSIITRLFEGQLSYSITCLKCESCTHKNEVFTILSLPIPSD-YECSLQDCLQCFFQQDTLTWSNQIYCSFCEIKQEAAVRTTISKVPKIIVFHFKRFDIQGTVKRKLRTDIHYPLTNLDLTPYICPVFRKHPMYNLCAVVNHFGDLDGGHY--TAFCKNSVTQAWYSFDDTRVSEIPDTSVQTATAYLLFYSCQPFSIPAQKRKSQDSTPD 380          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. UniProt/SwissProt
Match: sp|Q4R6D3|UBP50_MACFA (Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis OX=9541 GN=USP50 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 3.793e-7
Identity = 81/336 (24.11%), Postives = 142/336 (42.26%), Query Frame = 2
Query:  191 GLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXX---XXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQ--TSSAGDDIHKCYLQILSRINAVTRCSTAPENI----GDQNECKIKSKTQYDESLIDLFSGLICFETKC-SCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAA----VPQYIFIYLVRGAYR-INEKKVDTFIYFR-SFIDI-----PTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV-----------CKRFSIGI 1102
            GL N  + CY+N++LQ L S       L E+  S   +T  +   +     F Y + D++      V  E+ FR S L  L+   T     D  +  + +L+ ++   +    P       G    C  K  T     +  LF G + +   C  C K  Y K++ F  + L +PS  ++ S++ C+   F+  T+  +    C +   K  +   A     P+ I  +L R   +   ++K+ T I++  + +D+     P      KY + +V++H G  + GHY   A  ++  +  W   +D++V EI D+ V           C+ FSI I
Sbjct:   45 GLRNLGNTCYMNAILQCLCSIS----PLVEYFLSGKYITALQNDCSEVATAFAYLMTDMWLGDSDCVSPEI-FR-SALGNLYPAFTKKTQQDAQEFLIYVLNELHEALKKYHYPRRRSHEKGSAQRCCRKWITTETSVITQLFEGQLNYSIVCLKCEKCTY-KNEVFTVLSLPIPSE-YECSLQDCLQCFFQQDTLTWNNQIHCSFCETKQETAVRAGISKAPKIIIFHLKRFDIQGTTKRKLRTDIHYPLTNLDLTPYICPIFRKYPKYNLCAVVNHFGDLDGGHY--TAFCKNSFTQAWYSFDDTRVSEIPDTSVQNATAYLLFYSCQPFSIPI 370          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. UniProt/SwissProt
Match: sp|G5ECC7|UBP48_CAEEL (Ubiquitin carboxyl-terminal hydrolase usp-48 OS=Caenorhabditis elegans OX=6239 GN=usp-48 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 7.242e-6
Identity = 86/346 (24.86%), Postives = 137/346 (39.60%), Query Frame = 2
Query:   86 IEKIIEMTSKSSVTNSIHESSIEKRQNNFQSIKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKS-NPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELS------CCEYPNIKLSSQYAAVPQYIFIYLVRGAY--RINEKKVDTFIYFRSFIDIPTK----------DGNVKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEI 1063
            +EK  ++ ++   T    +   ++R  N Q     GL N  +FCY+NS LQ+ ++   FR  + ++  S N              + AL D+F ++++    E   + S L  L + +S   D  +  L+     NA+ RC   P++   +   K          L DLF+G  C    C CG+    + +T  S+ L +          +C L    D+   E  L       C +  ++   S Y  +P  I I L R  Y  +  +K      Y R   +IP K               Y + +V  H G  +E GHYY   L +S  + KW   ND  V  I
Sbjct:   77 LEKFEKLITQEQETKEEAKKDQKRRDLNDQP---AGLINGGNFCYVNSFLQVWFNVPEFRQLIYDFRPSENFVPPEAPRMNVQATMLALQDIFYTLQTTPFNETD-KTSNLGKLLRLNSEQQDSQEFGLKFF---NALERC--LPDHPNGKETLK---------RLKDLFTGETCTRIVCKCGQR-SEREETAISLTLNIEG--------YCTLLDALDAYFGEEHLDDFKCSKCNKTGDVSKQSDYVKLPPVIVIQLNRYKYTSKGRQKLKTPMAYPR---EIPAKAFQRTNNSIPPPAEMYDLFAVTIHEGNNAECGHYY--DLIKSPLNQKWYRYNDETVEAI 390          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. TrEMBL
Match: A0A4S2LDA5 (USP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009611 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.086e-9
Identity = 92/359 (25.63%), Postives = 163/359 (45.40%), Query Frame = 2
Query:  116 SSVTNSIHESSIEKRQNNFQSI---KHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEW--IKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRV-SILQTLFQTSSAGD-----DIHKCYLQILSRINAVTRCST--------APENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELS-CCEYPNIKLSSQ----YAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTK-----------DGNVKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCK 1084
            S  T  ++ S +EK   + +++   ++ GL N  + CY NSVLQ L+ CK FR K+ ++   KS+   T          +  L DLF+++ +Q +   Q      +  L + + A D     D H+  + IL+ I+ + +           A  +  D+N   I S  +    + D+F G +  ET+C   +++ +K + F  + +++  +    SI +C L  F D+ +M+SE    CE+   K  +Q        P  + ++L R  Y    ++V++F      +  PT+           D N  YK+I+V+ H G G   GHY        ++   WLL +D    E+ D E+C+
Sbjct:    4 SCCTMGLNSSQLEKEIADDRTLINERYFGLVNFGNTCYCNSVLQALFFCKPFREKVLQYRLTKSHKKET---------LLSCLADLFHAITTQKKSVGQIAPKKFISRLKRENGAFDNYLQQDAHEFLIYILNEISDILQAEQQADQQLRKAERSDNDKNPDSI-SADRSQNWIQDIFQGCLTNETRCLTCENVRTKDEDFLDLSVDIAQN---CSIVYC-LKFFSDTEMMQSENKYYCEFCRCKQEAQKCMRVKKPPLILALHLKRFKY---SEEVNSFTKLSCRVVFPTELRLPNTSGGAADQNWLYKLIAVVVHSGSGPNRGHYVTLV----KSHGLWLLFDD----EVVDVELCR 337          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. TrEMBL
Match: A0A078B3I6 (Ubiquitin carboxyl-terminal hydrolase family protein OS=Stylonychia lemnae OX=5949 GN=Contig16251.g17311 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.543e-9
Identity = 88/343 (25.66%), Postives = 150/343 (43.73%), Query Frame = 2
Query:  170 FQSIKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQT---SSAGDDIHKCYLQILSR----INAVTRCSTAPE--NIGDQNECKIKSKTQYDESLID-LFSGLICFETKCSCGKSLYSKSQTFKS-MPLEVP-SSPWKISIEHCILNHFRDSTI--MESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTK-----------DGNVKYKVISVIDHMGGS-ENGHY--YMKALHESENSSKWLLKNDSQVVEIQDSE--VCKRFSIGILL 1108
            F+ ++ +GL NPQ FCY+NSV+Q+L S K FR     + K    +T   + +   + ++L  LF  M +  EE    + +    L +    SS   D H+  + +LS+    +N    C           Q      +  Q   S+ID LF G IC   +C   K   +KS +F   M + +P +   K S++  +     + T   M S L+C    N  +  ++  +P+Y+ ++L     R  E +   FI  +  ID P +           +   K+ +I  + H G + E+GHY    K L        W   NDS++ ++Q  E  +  + S+ +L+
Sbjct:  598 FREVRVVGLDNPQYFCYMNSVIQVLLSIKDFRYYF--FYKEFGQVTYQTHFQKKTYCHSLAKLFKEMLTLEEEYDHLKPTFFHNLVERKFCSSLQHDAHEFLMYLLSQLQDELNPGPSCEVNRRFSTTSSQASNYWNNYLQAHPSIIDQLFVGQICQIVQC---KQCQNKSPSFIPFMDISLPITQNLKTSLQQYLATERIEGTAEEMYSCLACQTKTNANIKKKFINLPRYLVLHL----RRFEENEQSQFIKNKKPIDYPLEMDMDDYCNQAFEKLGKFSLIGAVLHKGKTLESGHYNCITKRL-----DGDWWFCNDSEIQQVQKEEHVLQSKKSVSVLI 926          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. TrEMBL
Match: E4XBQ1 (Ubiquitin carboxyl-terminal hydrolase OS=Oikopleura dioica OX=34765 GN=GSOID_T00006556001 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.194e-8
Identity = 76/335 (22.69%), Postives = 150/335 (44.78%), Query Frame = 2
Query:  176 SIKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQTSSAGDDIHKCYLQ-----ILSRINAVTRCSTAPENIGDQNECKIKSKTQ-------YDESLI-DLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELS-----CCEYPNIKLSSQYAAVPQYIFIYLVR----GAYRINEKKVDTFIYFRSFIDIPTK-----DGN-VKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSI 1096
            +  H GL N  + CY NSVLQ LY C+ FR ++ E+ K +          + + ++ L DLFN + ++ + +       +  L + + A D++ +   Q     +L+ I    R     E + +Q   + +S T        Y E+ + +LF G++   T+C   +S+  K + F  + +++  +    SI HC L  F  +  ++ E       CC       S +  + P+ + ++L R       R +  K+   + F   + IP+      DG+ + Y++ +V+ H G   N  +Y+  +    +  +WL+ +D +V  +  +E+   F +
Sbjct:   23 ATHHHGLINFGNTCYCNSVLQALYFCEPFRERVLEYRKQS-------KKTDGSLIWCLADLFNQLAAKKKRQPIKPTKFVHMLKKENDAFDNVLQHDAQEFLNFLLNHIGDTLR----DEIVRNQKVSQTQSDTHQHNSPCDYQETWVHELFEGVMTNVTRCLRCESVNQKDERFLDLSVDIEPN---TSINHC-LKSFSATETLKGEHKYYCEVCCSKQEAHKSLEIRSFPKVLALHLKRFRFEDGVRSHMTKLSYRVVFSRQLRIPSSKYSKDDGSTILYELNAVVVHCGKEINRGHYITLVRAHPSHDQWLVFDDEEVDFLPQAELEAFFGL 342          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. TrEMBL
Match: A0A4S2LDW7 (USP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009611 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.267e-8
Identity = 90/352 (25.57%), Postives = 159/352 (45.17%), Query Frame = 2
Query:  116 SSVTNSIHESSIEKRQNNFQSI---KHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEW--IKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRV-SILQTLFQTSSAGD-----DIHKCYLQILSRINAVTRCST--------APENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELS-CCEYPNIKLSSQ----YAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTK-----------DGNVKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEI 1063
            S  T  ++ S +EK   + +++   ++ GL N  + CY NSVLQ L+ CK FR K+ ++   KS+   T          +  L DLF+++ +Q +   Q      +  L + + A D     D H+  + IL+ I+ + +           A  +  D+N   I S  +    + D+F G +  ET+C   +++ +K + F  + +++  +    SI +C L  F D+ +M+SE    CE+   K  +Q        P  + ++L R  Y    ++V++F      +  PT+           D N  YK+I+V+ H G G   GHY        ++   WLL +D  V +I
Sbjct:    4 SCCTMGLNSSQLEKEIADDRTLINERYFGLVNFGNTCYCNSVLQALFFCKPFREKVLQYRLTKSHKKET---------LLSCLADLFHAITTQKKSVGQIAPKKFISRLKRENGAFDNYLQQDAHEFLIYILNEISDILQAEQQADQQLRKAERSDNDKNPDSI-SADRSQNWIQDIFQGCLTNETRCLTCENVRTKDEDFLDLSVDIAQN---CSIVYC-LKFFSDTEMMQSENKYYCEFCRCKQEAQKCMRVKKPPLILALHLKRFKY---SEEVNSFTKLSCRVVFPTELRLPNTSGGAADQNWLYKLIAVVVHSGSGPNRGHYVTLV----KSHGLWLLFDDEVVDKI 334          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. TrEMBL
Match: A0A5A7QWJ9 (Ubiquitin carboxyl-terminal hydrolase OS=Striga asiatica OX=4170 GN=STAS_26860 PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.443e-8
Identity = 85/332 (25.60%), Postives = 141/332 (42.47%), Query Frame = 2
Query:  182 KHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSILQTLFQTSSAGDDIHKCYLQ----------------ILSRINAVTRCST-APENIGDQNECKIKSKTQYDESLIDL----FSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESE-----LSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTK------DGNVKYKVISVIDHMG-GSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV 1078
            ++ GL N  + CY NSVLQ LY C  FR +L E+  +N        +   N +  L DLF  + SQ ++     V   +   Q     ++I + Y+                 IL +    T+    AP  I +     I S +   E +I      F G++  ET+C C +++ ++ +TF  + L++  +    SI  C+ N F  +  + +E       CC     +   +    PQ + I+L R  Y I +      + +R    I  K      D + +Y + +V+ H+G G  +GHY   +L +S N   WL  +D  V  I +S V
Sbjct:   21 RYFGLENFGNTCYCNSVLQALYFCVPFREQLLEYYSNN----KTPADAEENLLTCLADLFLQISSQKKKT---GVIAPKRFVQRLKKQNEIFRSYMHQDAHEFLNYLLNELVDILEKEARATKSDQEAPHKIAN-GPTNISSNSPQKEPVITWVHKNFQGILTNETRCLCCETVTARDETFLDLSLDIEQNS---SITSCLKN-FSSTETLNAEDKFFCDKCCSLQEAQKRMKIKRPPQILVIHLKRFKY-IEQLGRYKKLSYRVVFPIELKLSNTVEDADAEYSLFAVVVHVGSGPNHGHYV--SLVKSHN--HWLFFDDENVEMIDESAV 335          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Cavefish
Match: usp12b (ubiquitin carboxyl-terminal hydrolase 12-like [Source:NCBI gene;Acc:103024410])

HSP 1 Score: 53.9138 bits (128), Expect = 7.075e-7
Identity = 76/327 (23.24%), Postives = 140/327 (42.81%), Query Frame = 2
Query:  185 HMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVE-------EEVQFRVSILQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPEN-----IGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQ----YAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGNVK---------YKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRF 1090
            + GL N  + CY NSVLQ LY C+ FR K+  + K  P           + +  L DLFNS+ +Q +       ++   R+     LF  +    D H+    +L+ I  + +   + E      +    E +   KTQ +  + ++F G +  ET+C   +++ SK + F  + ++V  +    SI HC+       T+       CE    K  +Q       +P  + ++L R  Y +++    T + +R    +  +  N           Y +++V+ H G   N  +Y+  +   ++   WLL +D  +VE  D++  + F
Sbjct:   38 YFGLVNFGNTCYCNSVLQALYFCRPFREKVLAY-KVQP-------RRKESLLTCLADLFNSIATQKKKVGVIPPKKFVSRLRKENELFD-NYMQQDAHEFLNYLLNTIADLLQEEKSQERQQNGKLVQNGEAESDEKTQ-ETWVHEIFQGTLTNETRCLNCEAVSSKDEDFLDLSVDVEQN---TSITHCLRGFSNTETLCSEYKYYCEQCRSKQEAQKRMRVKKLPMILALHLKRFKY-MDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRGHYITIV---KSHGIWLLFDDD-IVEKIDAQAIEEF 346          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Medaka
Match: ENSORLT00000034666.1 (ubiquitin carboxyl-terminal hydrolase 48 [Source:NCBI gene;Acc:101168495])

HSP 1 Score: 55.4546 bits (132), Expect = 3.714e-7
Identity = 87/345 (25.22%), Postives = 138/345 (40.00%), Query Frame = 2
Query:  182 KHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFV-YALGDLFNSMESQVEEEVQFRVSILQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAV----PQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTK---DGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGI------QDVPKLLTSGKEFNS 1174
            ++ GL N  + CYLNSVLQ+L+  + FR  ++   KS              F+ + L DLF ++ +Q  +      SI+Q L         I + Y Q     +A   C             KI   T  D + I  F G +   T C   +  Y     F  +PL + +S    S++  I   FR S+        CE  + K  +   +V    P  + + L R  +  N     T+I     +++P       N  Y++ +VIDH G   +GHY  +    S+  S W   ND+ V  +     C + S     EK+++        +D+   LTS   F+S
Sbjct:   44 RYHGLKNHGATCYLNSVLQVLFMTEDFREAVNSSSKSE-------------FIDHHLKDLFKNLLTQTSDS----SSIIQAL--------GIERVYEQ----QDAAEYCQ------------KILRMTSPDAAKI--FHGQMTERTTCLSCQKQYDTDVPFWLLPLSLVNSGSDNSVDGNIEKFFRISSFSGENQIYCEKCDKKSDATSVSVVKHHPDVLILLLKRFIFCYNYM---TYIKVNLPVEVPFSMKIPENQTYELYAVIDHFGDLRSGHYSSRI--RSQPDSGWYQFNDNSVTALG----CCKLSKNGDTEKSKSAYLLFYRKKDIENSLTSNGGFSS 336          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Medaka
Match: ENSORLT00000043987.1 (uncharacterized LOC105356426 [Source:NCBI gene;Acc:105356426])

HSP 1 Score: 52.7582 bits (125), Expect = 2.731e-6
Identity = 74/322 (22.98%), Postives = 141/322 (43.79%), Query Frame = 2
Query:  179 IKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSI-LQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKI-SIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAV----PQYIFIYLVRGAYR---INEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQ---DSEVCKRFSIGILL 1108
            I++ GL N  + CYLNSVLQ+L+  + FR  ++   +SN +  +          + L DLF+ +     + +    ++ + T+ +   A +     Y Q + R+       T+P+                   +  +F G +     CS  K+     + F  +PL +  S  ++ S+++ I   F+ S     +   CE+ + K+ +    V    P+ + + L R  +    +   K++  +   +F++IP    N  Y++ +V+DH G    GHY  +    S+  S+W   ND+ V +I    DS++ KR +   LL
Sbjct:   13 IRYHGLKNHGATCYLNSVLQVLFMTEDFREAVNS--QSNAEFID----------HHLKDLFDHLVKGNSDALDLIKALDIDTVNKQQDASE-----YCQKILRL-------TSPQ-------------------VAKIFHGELTNRRICSSCKTETDTDEPFWILPLSLVDSCSELYSVDYGISEFFKASFFTGEDQMYCEHCDTKVDACTKYVVKHHPEVLILLLKRFDFSYKYMTYMKINNAVDVPTFLEIPE---NQAYELYAVVDHFGDLRGGHYCSRI--RSQVDSRWYEFNDTWVTQIDNNVDSDI-KRSNTAFLL 285          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Medaka
Match: ENSORLT00000042924.1 (uncharacterized LOC105356426 [Source:NCBI gene;Acc:105356426])

HSP 1 Score: 52.373 bits (124), Expect = 3.388e-6
Identity = 74/322 (22.98%), Postives = 141/322 (43.79%), Query Frame = 2
Query:  179 IKHMGLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLFNSMESQVEEEVQFRVSI-LQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKI-SIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAV----PQYIFIYLVRGAYR---INEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQ---DSEVCKRFSIGILL 1108
            I++ GL N  + CYLNSVLQ+L+  + FR  ++   +SN +  +          + L DLF+ +     + +    ++ + T+ +   A +     Y Q + R+       T+P+                   +  +F G +     CS  K+     + F  +PL +  S  ++ S+++ I   F+ S     +   CE+ + K+ +    V    P+ + + L R  +    +   K++  +   +F++IP    N  Y++ +V+DH G    GHY  +    S+  S+W   ND+ V +I    DS++ KR +   LL
Sbjct:   13 IRYHGLKNHGATCYLNSVLQVLFMTEDFREAVNS--QSNAEFID----------HHLKDLFDHLVKGNSDALDLIKALDIDTVNKQQDASE-----YCQKILRL-------TSPQ-------------------VAKIFHGELTNRRICSSCKTETDTDEPFWILPLSLVDSCSELYSVDYGISEFFKASFFTGEDQMYCEHCDTKVDACTKYVVKHHPEVLILLLKRFDFSYKYMTYMKINNAVDVPTFLEIPE---NQAYELYAVVDHFGDLRGGHYCSRI--RSQVDSRWYEFNDTWVTQIDNNVDSDI-KRSNTAFLL 285          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Medaka
Match: ENSORLT00000003855.2 (ubiquitin specific peptidase 50 [Source:NCBI gene;Acc:105356684])

HSP 1 Score: 51.9878 bits (123), Expect = 5.151e-6
Identity = 72/317 (22.71%), Postives = 128/317 (40.38%), Query Frame = 2
Query:  191 GLPNPQSFCYLNSVLQMLYSCKLFRLKLSEWIKSNPDLTXXXXXXXXXFVYALGDLF-NSMESQVEEEVQFRVSILQTLFQTSSAGD----------DIHKCYLQILSRINAVTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAA----VPQYIFIYLVR-GAYRINEKKVDTFIYFRSFIDIPT-KDGNV----KYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEV 1078
            GL N  + CYLN+VLQ L +      +L  W  +   L  ++   +  FV+ L  ++  S  S    EV+  +  +   F   S  D           +H  + +   R       S+ P  +      +IK  + +   +  LF G + +   C         +Q F  + L VP    K SI+ C+   F+ + +   E + C    +K  +         P+ + ++L R G+   ++ K+ T + F   +D+     G V     Y + +V++H G    GHY   AL  +  +  W   +D+ V E+Q+  V
Sbjct:  417 GLENSGNSCYLNAVLQCLCATVPLVEQLLHW-DTRKGLARSKCRVSEVFVHLLEKMWMGSGSSCSPLEVRSALCSVLPQFNNDSQQDAQELLLLLLNTLHDDFNKAAQRQALF---SSQPARME-----QIKGCSPHSNLVTRLFEGQLSYMCICMHCHHQAHNTQAFTVLSLPVPKGNIKCSIQDCLALFFKQTVLTGGEQAMCSVCGLKRETAIVTCVDRTPEILVLHLKRFGSKGKSQVKLRTNVLFFMKLDLSQFLSGLVPNESSYHLYAVVNHTGHLNMGHY--TALCYNSLAQTWHCFDDAAVCEVQEDRV 722          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Planmine SMEST
Match: SMESG000038485.1 (SMESG000038485.1)

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 488/600 (81.33%), Postives = 509/600 (84.83%), Query Frame = 2
Query:  446 DDIHKCYLQILSRINA-VTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKC-SCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNGLISFYEKEIVNRNTLIYGTRLGEILHYMSENNNKLVDILIEEFCFNWSNPFYSIKELCCDILQKVNFNIKKAKEIRENPKDNNYNDTEKSNSEKFQNKPKAEAPXXXXXXXXXXXXXXXXXXXPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNXXXXXXXXXXXXXXXXDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDINSNTLVAALM 2239
            +DIHKCYLQILSRI+A VTRCSTAPENIGDQNE  +  KT+ DESLI+LF G  C   KC SCGK+ + K Q FKSMPLEVPSSPWKISIEHCI NHFRDS IM+SELSCCEYPNIKLSSQY AVPQYIFIYLVR A+ ++EKK+ TFIYFRSFIDIPTKDGNVKYKVISVIDH  G ENGHYY+KALHESE+SSKWLLK +SQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKN LISFYEKEIVNRNTLIYGT            +NK + I             +SIKELCCDILQKVNFNIKKA+EIRENPKDNNYN +                                  CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDI +NTLVAALM
Sbjct:    4 EDIHKCYLQILSRIDAAVTRCSTAPENIGDQNEFPVNIKTKNDESLIELFGGRKCLLKKCVSCGKT-HEKFQRFKSMPLEVPSSPWKISIEHCIFNHFRDSAIMKSELSCCEYPNIKLSSQYDAVPQYIFIYLVREAFGMSEKKIHTFIYFRSFIDIPTKDGNVKYKVISVIDHEDGLENGHYYLKALHESESSSKWLLKKNSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNDLISFYEKEIVNRNTLIYGT------------SNKNIYI-------------FSIKELCCDILQKVNFNIKKAQEIRENPKDNNYNGS----------------------------------CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDIKTNTLVAALM 543          

HSP 2 Score: 458.759 bits (1179), Expect = 1.487e-142
Identity = 228/312 (73.08%), Postives = 259/312 (83.01%), Query Frame = 2
Query: 2936 NLEGLQLAHLVQIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTGDVEIGKNSEMREKSPFFEICSLYHSLVSCGTLGDEYPSSEAKCSKNIFSEEIGECYKSLLAKINEDIFSNFVESFDDDSVTSYSHLIQDLFKSQIYVEIICVNCTRTITSKEYVYYLSIEFPIDKNSESIQNCVNNGFIGNVFKMKDNCCSNQPLSTITKFNCSGDYLLICLNKTTKQRNRSGEINIKLDDGLLLEYI-----NCTQIYSLYAVIDESQSNAGNRYEIKFLSNEKWLRVNSTEAVPVDSNTITSTQNAAFLFKK 3856
            +++ LQLAHLV+IILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKT   ++GK SEM  KSPFFEICSLYHSLVSCGTLGDEYPSSE KC+KNIFSEE+GECY +LL  + +     F++  DDDSVT YS LI DLF ++I ++  C+NC     SKE+VYYLSI  PIDK SESIQNCVNNGFIGNVFK+KDNCCS Q  ST TKFNC G+YLLIC +K T++R++SGEIN+KLDDGLLLEYI       TQ+YSLYAVIDE QSN+G RYEIKFLSNEKWLRVNSTEAV VD+N ITS +NAAFLFKK
Sbjct:  623 DIKRLQLAHLVRIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTDSAKMGKYSEMPAKSPFFEICSLYHSLVSCGTLGDEYPSSEEKCTKNIFSEELGECYIALLQNLKKVFLPKFMKISDDDSVTGYSRLIHDLFGNKIVIKTSCLNCGLRTESKEFVYYLSIHLPIDKKSESIQNCVNNGFIGNVFKVKDNCCSKQSHSTKTKFNCCGEYLLICFDKKTRERSKSGEINMKLDDGLLLEYIKSLDNKSTQVYSLYAVIDEIQSNSGKRYEIKFLSNEKWLRVNSTEAVSVDNNAITSLENAAFLFKK 934          

HSP 3 Score: 69.3218 bits (168), Expect = 1.963e-11
Identity = 34/51 (66.67%), Postives = 34/51 (66.67%), Query Frame = 2
Query: 2630 RPLGPTAT----------------GDHENLECSNSISWPIGLKYRELEDIK 2734
             PLGPTAT                GDHENLECSNSISWPIGLKYRELEDIK
Sbjct:  575 HPLGPTATDNNKRISFSGNSSSDLGDHENLECSNSISWPIGLKYRELEDIK 625          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Planmine SMEST
Match: SMESG000038485.1 (SMESG000038485.1)

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 484/600 (80.67%), Postives = 503/600 (83.83%), Query Frame = 2
Query:  446 DDIHKCYLQILSRINA-VTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKC-SCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNGLISFYEKEIVNRNTLIYGTRLGEILHYMSENNNKLVDILIEEFCFNWSNPFYSIKELCCDILQKVNFNIKKAKEIRENPKDNNYNDTEKSNSEKFQNKPKAEAPXXXXXXXXXXXXXXXXXXXPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNXXXXXXXXXXXXXXXXDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDINSNTLVAALM 2239
            +DIHKCYLQILSRI+A VTRCSTAPENIGDQNE  +  KT+ DESLI+LF G  C   KC SCGK+ + K Q FKSMPLEVPSSPWKISIEHCI NHFRDS IM+SELSCCEYPNIKLSSQY AVPQYIFIYLVR A+ ++EKK+ TFIYFRSFIDIPTKDGNVKYKVISVIDH  G ENGHYY+KALHESE+SSKWLLK +SQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKN LISFYEKEIVNRNTLIYGT                                 +IKELCCDILQKVNFNIKKA+EIRENPKDNNYN +                                  CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDI +NTLVAALM
Sbjct:    4 EDIHKCYLQILSRIDAAVTRCSTAPENIGDQNEFPVNIKTKNDESLIELFGGRKCLLKKCVSCGKT-HEKFQRFKSMPLEVPSSPWKISIEHCIFNHFRDSAIMKSELSCCEYPNIKLSSQYDAVPQYIFIYLVREAFGMSEKKIHTFIYFRSFIDIPTKDGNVKYKVISVIDHEDGLENGHYYLKALHESESSSKWLLKKNSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNDLISFYEKEIVNRNTLIYGTS--------------------------------NIKELCCDILQKVNFNIKKAQEIRENPKDNNYNGS----------------------------------CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDIKTNTLVAALM 536          

HSP 2 Score: 555.444 bits (1430), Expect = 1.078e-178
Identity = 289/430 (67.21%), Postives = 317/430 (73.72%), Query Frame = 2
Query: 2630 RPLGPTAT----------------GDHENLECSNSISWPIGLKYRELEDIKSASQSQIFTHEGDTHPNLDSLIVNEKFNKQVSSENSDXXXXXXXXXXXXXXXXXXXXXXXXTNLSNKNLEGLQLAHLVQIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTGDVEIGKNSEMREKSPFFEICSLYHSLVSCGTLGDEYPSSEAKCSKNIFSEEIGECYKSLLAKINEDIFSNFVESFDDDSVTSYSHLIQDLFKSQIYVEIICVNCTRTITSKEYVYYLSIEFPIDKNSESIQNCVNNGFIGNVFKMKDNCCSNQPLSTITKFNCSGDYLLICLNKTTKQRNRSGEINIKLDDGLLLEYI-----NCTQIYSLYAVIDESQSNAGNRYEIKFLSNEKWLRVNSTEAVPVDSNTITSTQNAAFLFKK 3856
             PLGPTAT                GDHENLECSNSISWPIGLKYRELEDIKS SQS IFTHEGDTHP  DSL VNEKFNKQVS                                       LQLAHLV+IILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKT   ++GK SEM  KSPFFEICSLYHSLVSCGTLGDEYPSSE KC+KNIFSEE+GECY +LL  + +     F++  DDDSVT YS LI DLF ++I ++  C+NC     SKE+VYYLSI  PIDK SESIQNCVNNGFIGNVFK+KDNCCS Q  ST TKFNC G+YLLIC +K T++R++SGEIN+KLDDGLLLEYI       TQ+YSLYAVIDE QSN+G RYEIKFLSNEKWLRVNSTEAV VD+N ITS +NAAFLFKK
Sbjct:  568 HPLGPTATDNNKRISFSGNSSSDLGDHENLECSNSISWPIGLKYRELEDIKSVSQSPIFTHEGDTHPYPDSLFVNEKFNKQVSR--------------------------------------LQLAHLVRIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTDSAKMGKYSEMPAKSPFFEICSLYHSLVSCGTLGDEYPSSEEKCTKNIFSEELGECYIALLQNLKKVFLPKFMKISDDDSVTGYSRLIHDLFGNKIVIKTSCLNCGLRTESKEFVYYLSIHLPIDKKSESIQNCVNNGFIGNVFKVKDNCCSKQSHSTKTKFNCCGEYLLICFDKKTRERSKSGEINMKLDDGLLLEYIKSLDNKSTQVYSLYAVIDEIQSNSGKRYEIKFLSNEKWLRVNSTEAVSVDNNAITSLENAAFLFKK 959          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Planmine SMEST
Match: SMESG000038485.1 (SMESG000038485.1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 486/600 (81.00%), Postives = 505/600 (84.17%), Query Frame = 2
Query:  446 DDIHKCYLQILSRINA-VTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKC-SCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNGLISFYEKEIVNRNTLIYGTRLGEILHYMSENNNKLVDILIEEFCFNWSNPFYSIKELCCDILQKVNFNIKKAKEIRENPKDNNYNDTEKSNSEKFQNKPKAEAPXXXXXXXXXXXXXXXXXXXPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNXXXXXXXXXXXXXXXXDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDINSNTLVAALM 2239
            +DIHKCYLQILSRI+A VTRCSTAPENIGDQNE  +  KT+ DESLI+LF G  C   KC SCGK+ + K Q FKSMPLEVPSSPWKISIEHCI NHFRDS IM+SELSCCEYPNIKLSSQY AVPQYIFIYLVR A+ ++EKK+ TFIYFRSFIDIPTKDGNVKYKVISVIDH  G ENGHYY+KALHESE+SSKWLLK +SQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKN LISFYEKEIVNRNTLIYGT                                 +IKELCCDILQKVNFNIKKA+EIRENPKDNNYN                                F+ SCFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDI +NTLVAALM
Sbjct:    4 EDIHKCYLQILSRIDAAVTRCSTAPENIGDQNEFPVNIKTKNDESLIELFGGRKCLLKKCVSCGKT-HEKFQRFKSMPLEVPSSPWKISIEHCIFNHFRDSAIMKSELSCCEYPNIKLSSQYDAVPQYIFIYLVREAFGMSEKKIHTFIYFRSFIDIPTKDGNVKYKVISVIDHEDGLENGHYYLKALHESESSSKWLLKKNSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNDLISFYEKEIVNRNTLIYGTS--------------------------------NIKELCCDILQKVNFNIKKAQEIRENPKDNNYNGN--------------------------LILHFNGSCFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDIKTNTLVAALM 544          

HSP 2 Score: 550.051 bits (1416), Expect = 1.351e-176
Identity = 289/430 (67.21%), Postives = 316/430 (73.49%), Query Frame = 2
Query: 2630 RPLGPTAT----------------GDHENLECSNSISWPIGLKYRELEDIKSASQSQIFTHEGDTHPNLDSLIVNEKFNKQVSSENSDXXXXXXXXXXXXXXXXXXXXXXXXTNLSNKNLEGLQLAHLVQIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTGDVEIGKNSEMREKSPFFEICSLYHSLVSCGTLGDEYPSSEAKCSKNIFSEEIGECYKSLLAKINEDIFSNFVESFDDDSVTSYSHLIQDLFKSQIYVEIICVNCTRTITSKEYVYYLSIEFPIDKNSESIQNCVNNGFIGNVFKMKDNCCSNQPLSTITKFNCSGDYLLICLNKTTKQRNRSGEINIKLDDGLLLEYI-----NCTQIYSLYAVIDESQSNAGNRYEIKFLSNEKWLRVNSTEAVPVDSNTITSTQNAAFLFKK 3856
             PLGPTAT                GDHENLECSNSISWPIGLKYRELEDIKS SQS IFTHEGDTHP  DSL VNEKFNKQVS                                       LQLAHLV+IILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKT   ++GK SEM  KSPFFEICSLYHSLVSCGTLGDEYPSSE KC+KNIFSEE+GECY +LL  + +     F++  DDDSVT YS LI DLF ++I ++  C+NC     SKE+VYYLSI  PIDK SESIQNCVNNGFIGNVFK KDNCCS Q  ST TKFNC G+YLLIC +K T++R++SGEIN+KLDDGLLLEYI       TQ+YSLYAVIDE QSN+G RYEIKFLSNEKWLRVNSTEAV VD+N ITS +NAAFLFKK
Sbjct:  576 HPLGPTATDNNKRISFSGNSSSDLGDHENLECSNSISWPIGLKYRELEDIKSVSQSPIFTHEGDTHPYPDSLFVNEKFNKQVSR--------------------------------------LQLAHLVRIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTDSAKMGKYSEMPAKSPFFEICSLYHSLVSCGTLGDEYPSSEEKCTKNIFSEELGECYIALLQNLKKVFLPKFMKISDDDSVTGYSRLIHDLFGNKIVIKTSCLNCGLRTESKEFVYYLSIHLPIDKKSESIQNCVNNGFIGNVFK-KDNCCSKQSHSTKTKFNCCGEYLLICFDKKTRERSKSGEINMKLDDGLLLEYIKSLDNKSTQVYSLYAVIDEIQSNSGKRYEIKFLSNEKWLRVNSTEAVSVDNNAITSLENAAFLFKK 966          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Planmine SMEST
Match: SMESG000038485.1 (SMESG000038485.1)

HSP 1 Score: 885.945 bits (2288), Expect = 0.000e+0
Identity = 481/600 (80.17%), Postives = 500/600 (83.33%), Query Frame = 2
Query:  446 DDIHKCYLQILSRINA-VTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKC-SCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNGLISFYEKEIVNRNTLIYGTRLGEILHYMSENNNKLVDILIEEFCFNWSNPFYSIKELCCDILQKVNFNIKKAKEIRENPKDNNYNDTEKSNSEKFQNKPKAEAPXXXXXXXXXXXXXXXXXXXPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNXXXXXXXXXXXXXXXXDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDINSNTLVAALM 2239
            +DIHKCYLQILSRI+A VTRCSTAPENIGDQNE  +  KT+ DESLI+LF G  C   KC SCGK+ + K Q FKSMPLEVPSSPWKISIEHCI NHFRDS IM+SELSCCEYPNIKLSSQY AVPQYIFIYLVR A+ ++EKK+ TFIYFRSFIDIPTKDGNVKYKVISVIDH  G ENGHYY+KALHESE+SSKWLLK +SQVVEIQDSEVCKRFSIGILLEKAEN   DVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKN LISFYEKEIVNRNTLIYGT                                 +IKELCCDILQKVNFNIKKA+EIRENPKDNNYN +                                  CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDI +NTLVAALM
Sbjct:    4 EDIHKCYLQILSRIDAAVTRCSTAPENIGDQNEFPVNIKTKNDESLIELFGGRKCLLKKCVSCGKT-HEKFQRFKSMPLEVPSSPWKISIEHCIFNHFRDSAIMKSELSCCEYPNIKLSSQYDAVPQYIFIYLVREAFGMSEKKIHTFIYFRSFIDIPTKDGNVKYKVISVIDHEDGLENGHYYLKALHESESSSKWLLKKNSQVVEIQDSEVCKRFSIGILLEKAEN---DVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNDLISFYEKEIVNRNTLIYGTS--------------------------------NIKELCCDILQKVNFNIKKAQEIRENPKDNNYNGS----------------------------------CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDIKTNTLVAALM 533          

HSP 2 Score: 558.14 bits (1437), Expect = 8.103e-180
Identity = 288/425 (67.76%), Postives = 316/425 (74.35%), Query Frame = 2
Query: 2630 RPLGPTAT----------------GDHENLECSNSISWPIGLKYRELEDIKSASQSQIFTHEGDTHPNLDSLIVNEKFNKQVSSENSDXXXXXXXXXXXXXXXXXXXXXXXXTNLSNKNLEGLQLAHLVQIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTGDVEIGKNSEMREKSPFFEICSLYHSLVSCGTLGDEYPSSEAKCSKNIFSEEIGECYKSLLAKINEDIFSNFVESFDDDSVTSYSHLIQDLFKSQIYVEIICVNCTRTITSKEYVYYLSIEFPIDKNSESIQNCVNNGFIGNVFKMKDNCCSNQPLSTITKFNCSGDYLLICLNKTTKQRNRSGEINIKLDDGLLLEYINCTQIYSLYAVIDESQSNAGNRYEIKFLSNEKWLRVNSTEAVPVDSNTITSTQNAAFLFKK 3856
             PLGPTAT                GDHENLECSNSISWPIGLKYRELEDIKS SQS IFTHEGDTHP  DSL VNEKFNKQVS                                       LQLAHLV+IILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKT   ++GK SEM  KSPFFEICSLYHSLVSCGTLGDEYPSSE KC+KNIFSEE+GECY +LL  + +     F++  DDDSVT YS LI DLF ++I ++  C+NC     SKE+VYYLSI  PIDK SESIQNCVNNGFIGNVFK+KDNCCS Q  ST TKFNC G+YLLIC +K T++R++SGEIN+KLDDGLLLEY   TQ+YSLYAVIDE QSN+G RYEIKFLSNEKWLRVNSTEAV VD+N ITS +NAAFLFKK
Sbjct:  565 HPLGPTATDNNKRISFSGNSSSDLGDHENLECSNSISWPIGLKYRELEDIKSVSQSPIFTHEGDTHPYPDSLFVNEKFNKQVSR--------------------------------------LQLAHLVRIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTDSAKMGKYSEMPAKSPFFEICSLYHSLVSCGTLGDEYPSSEEKCTKNIFSEELGECYIALLQNLKKVFLPKFMKISDDDSVTGYSRLIHDLFGNKIVIKTSCLNCGLRTESKEFVYYLSIHLPIDKKSESIQNCVNNGFIGNVFKVKDNCCSKQSHSTKTKFNCCGEYLLICFDKKTRERSKSGEINMKLDDGLLLEYNKSTQVYSLYAVIDEIQSNSGKRYEIKFLSNEKWLRVNSTEAVSVDNNAITSLENAAFLFKK 951          
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Planmine SMEST
Match: SMESG000038485.1 (SMESG000038485.1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 463/600 (77.17%), Postives = 481/600 (80.17%), Query Frame = 2
Query:  446 DDIHKCYLQILSRINA-VTRCSTAPENIGDQNECKIKSKTQYDESLIDLFSGLICFETKC-SCGKSLYSKSQTFKSMPLEVPSSPWKISIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAYRINEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKALHESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNGLISFYEKEIVNRNTLIYGTRLGEILHYMSENNNKLVDILIEEFCFNWSNPFYSIKELCCDILQKVNFNIKKAKEIRENPKDNNYNDTEKSNSEKFQNKPKAEAPXXXXXXXXXXXXXXXXXXXPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNXXXXXXXXXXXXXXXXDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDINSNTLVAALM 2239
            +DIHKCYLQILSRI+A VTRCSTAPENIGDQNE  +  KT+ DESLI+LF G  C   KC SCGK+ + K Q FKSMPLEVP                        ELSCCEYPNIKLSSQY AVPQYIFIYLVR A+ ++EKK+ TFIYFRSFIDIPTKDGNVKYKVISVIDH  G ENGHYY+KALHESE+SSKWLLK +SQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKN LISFYEKEIVNRNTLIYGT                                 +IKELCCDILQKVNFNIKKA+EIRENPKDNNYN +                                  CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDI +NTLVAALM
Sbjct:    4 EDIHKCYLQILSRIDAAVTRCSTAPENIGDQNEFPVNIKTKNDESLIELFGGRKCLLKKCVSCGKT-HEKFQRFKSMPLEVP------------------------ELSCCEYPNIKLSSQYDAVPQYIFIYLVREAFGMSEKKIHTFIYFRSFIDIPTKDGNVKYKVISVIDHEDGLENGHYYLKALHESESSSKWLLKKNSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLTSGKEFNSHFRSAMQAIFRIFYLCEDFKNDLISFYEKEIVNRNTLIYGTS--------------------------------NIKELCCDILQKVNFNIKKAQEIRENPKDNNYNGS----------------------------------CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSEQANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDFTFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQGSISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKSDIKTNTLVAALM 512          

HSP 2 Score: 556.214 bits (1432), Expect = 2.828e-179
Identity = 289/430 (67.21%), Postives = 317/430 (73.72%), Query Frame = 2
Query: 2630 RPLGPTAT----------------GDHENLECSNSISWPIGLKYRELEDIKSASQSQIFTHEGDTHPNLDSLIVNEKFNKQVSSENSDXXXXXXXXXXXXXXXXXXXXXXXXTNLSNKNLEGLQLAHLVQIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTGDVEIGKNSEMREKSPFFEICSLYHSLVSCGTLGDEYPSSEAKCSKNIFSEEIGECYKSLLAKINEDIFSNFVESFDDDSVTSYSHLIQDLFKSQIYVEIICVNCTRTITSKEYVYYLSIEFPIDKNSESIQNCVNNGFIGNVFKMKDNCCSNQPLSTITKFNCSGDYLLICLNKTTKQRNRSGEINIKLDDGLLLEYI-----NCTQIYSLYAVIDESQSNAGNRYEIKFLSNEKWLRVNSTEAVPVDSNTITSTQNAAFLFKK 3856
             PLGPTAT                GDHENLECSNSISWPIGLKYRELEDIKS SQS IFTHEGDTHP  DSL VNEKFNKQVS                                       LQLAHLV+IILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKT   ++GK SEM  KSPFFEICSLYHSLVSCGTLGDEYPSSE KC+KNIFSEE+GECY +LL  + +     F++  DDDSVT YS LI DLF ++I ++  C+NC     SKE+VYYLSI  PIDK SESIQNCVNNGFIGNVFK+KDNCCS Q  ST TKFNC G+YLLIC +K T++R++SGEIN+KLDDGLLLEYI       TQ+YSLYAVIDE QSN+G RYEIKFLSNEKWLRVNSTEAV VD+N ITS +NAAFLFKK
Sbjct:  544 HPLGPTATDNNKRISFSGNSSSDLGDHENLECSNSISWPIGLKYRELEDIKSVSQSPIFTHEGDTHPYPDSLFVNEKFNKQVSR--------------------------------------LQLAHLVRIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTDSAKMGKYSEMPAKSPFFEICSLYHSLVSCGTLGDEYPSSEEKCTKNIFSEELGECYIALLQNLKKVFLPKFMKISDDDSVTGYSRLIHDLFGNKIVIKTSCLNCGLRTESKEFVYYLSIHLPIDKKSESIQNCVNNGFIGNVFKVKDNCCSKQSHSTKTKFNCCGEYLLICFDKKTRERSKSGEINMKLDDGLLLEYIKSLDNKSTQVYSLYAVIDEIQSNSGKRYEIKFLSNEKWLRVNSTEAVSVDNNAITSLENAAFLFKK 935          
The following BLAST results are available for this feature:
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp-485.693e-724.86Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp462.480e-621.79ubiquitin specific peptidase 46 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Usp504.715e-922.47ubiquitin specific peptidase 50 [Source:MGI Symbol... [more]
Usp503.070e-621.72ubiquitin specific peptidase 50 [Source:MGI Symbol... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O24454|UBP3_ARATH4.090e-924.93Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabido... [more]
sp|Q8LAM0|UBP4_ARATH2.613e-825.37Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabido... [more]
sp|Q6P8X6|UBP50_MOUSE3.298e-822.47Putative ubiquitin carboxyl-terminal hydrolase 50 ... [more]
sp|Q4R6D3|UBP50_MACFA3.793e-724.11Putative ubiquitin carboxyl-terminal hydrolase 50 ... [more]
sp|G5ECC7|UBP48_CAEEL7.242e-624.86Ubiquitin carboxyl-terminal hydrolase usp-48 OS=Ca... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LDA51.086e-925.63USP domain-containing protein OS=Opisthorchis feli... [more]
A0A078B3I62.543e-925.66Ubiquitin carboxyl-terminal hydrolase family prote... [more]
E4XBQ11.194e-822.69Ubiquitin carboxyl-terminal hydrolase OS=Oikopleur... [more]
A0A4S2LDW72.267e-825.57USP domain-containing protein OS=Opisthorchis feli... [more]
A0A5A7QWJ92.443e-825.60Ubiquitin carboxyl-terminal hydrolase OS=Striga as... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
usp12b7.075e-723.24ubiquitin carboxyl-terminal hydrolase 12-like [Sou... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000034666.13.714e-725.22ubiquitin carboxyl-terminal hydrolase 48 [Source:N... [more]
ENSORLT00000043987.12.731e-622.98uncharacterized LOC105356426 [Source:NCBI gene;Acc... [more]
ENSORLT00000042924.13.388e-622.98uncharacterized LOC105356426 [Source:NCBI gene;Acc... [more]
ENSORLT00000003855.25.151e-622.71ubiquitin specific peptidase 50 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin carboxyl-terminal hydrolase 1, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038485.11.487e-14281.33SMESG000038485.1[more]
SMESG000038485.11.078e-17880.67SMESG000038485.1[more]
SMESG000038485.11.351e-17681.00SMESG000038485.1[more]
SMESG000038485.18.103e-18080.17SMESG000038485.1[more]
SMESG000038485.12.828e-17977.17SMESG000038485.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035249 ID=SMED30035249|Name=Ubiquitin carboxyl-terminal hydrolase 1, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=4009bp
TCTATATAAATCTTATATGATACATTTGATTCAATTCTCAAAAGTAAAAT
ATTTGTGTTAATTTTAAAGTAAAACCAATCCAGTAATCGAAAAAATTATT
GAAATGACATCTAAATCTAGTGTTACTAACTCTATACATGAAAGTTCAAT
TGAAAAAAGACAAAATAATTTCCAATCGATTAAGCATATGGGCCTTCCAA
ATCCACAATCCTTTTGTTATTTAAATTCAGTCTTACAAATGCTTTATTCT
TGTAAACTATTCCGATTAAAACTTAGTGAGTGGATAAAAAGCAATCCAGA
TCTTACAAATAATGAAAATAACGAAAATTTGAATTTTGTTTATGCTCTGG
GAGATTTATTCAATTCTATGGAATCTCAGGTTGAAGAAGAAGTTCAATTT
AGAGTTTCTATATTGCAAACATTGTTTCAAACTTCATCAGCTGGAGATGA
TATTCACAAGTGCTACCTTCAGATATTGAGCAGGATTAATGCCGTTACTA
GATGCTCGACTGCACCAGAAAATATTGGGGACCAAAATGAATGTAAAATA
AAGAGTAAAACACAATATGATGAATCTTTGATTGACTTATTTAGTGGCCT
TATATGCTTTGAAACAAAATGTTCGTGTGGAAAATCTCTTTATAGTAAAT
CTCAAACATTCAAATCAATGCCATTGGAAGTTCCGTCGTCTCCCTGGAAA
ATTTCAATTGAGCATTGCATTTTAAATCATTTTAGAGATTCAACAATTAT
GGAATCGGAATTGTCTTGCTGTGAATATCCAAATATCAAGCTTTCCTCAC
AATATGCTGCGGTCCCACAATACATTTTTATCTATTTAGTTCGCGGAGCA
TATAGAATAAATGAAAAGAAAGTTGATACTTTCATATATTTTCGGAGTTT
TATAGATATCCCAACGAAGGATGGAAATGTAAAATATAAAGTCATATCGG
TAATTGATCATATGGGTGGATCTGAAAATGGCCACTATTATATGAAAGCA
CTTCATGAAAGTGAAAACTCTTCTAAATGGCTGTTAAAAAATGATTCACA
AGTTGTCGAAATCCAAGATTCTGAAGTTTGCAAAAGATTTTCCATTGGAA
TATTGCTTGAAAAAGCCGAAAATGGTATTCAAGATGTTCCTAAATTGTTG
ACTTCTGGAAAAGAATTCAATTCTCATTTCCGGAGCGCCATGCAAGCAAT
TTTTCGAATTTTTTACTTATGTGAAGATTTTAAAAATGGTCTTATCAGTT
TCTATGAAAAAGAAATAGTTAATAGAAATACTTTAATTTATGGTACAAGA
CTCGGCGAGATCTTGCATTATATGTCAGAAAATAATAATAAATTGGTTGA
CATTTTGATAGAGGAATTTTGTTTTAATTGGTCAAATCCTTTTTATAGTA
TCAAAGAATTATGTTGCGATATTTTACAAAAAGTTAATTTTAACATAAAG
AAAGCTAAAGAGATCCGTGAAAATCCAAAGGATAATAATTATAATGATAC
GGAAAAATCAAATTCAGAAAAGTTTCAAAATAAACCGAAAGCCGAAGCTC
CTACCTCAACAAAATTAAAAACATCAAAAAAATCCCGTTCATTTTCATGT
TCATGTTTCCCTAAGAATTTCAAAAGTAATAAACGAAATAAAAACACAGA
AAGATGTCAAAATAAAAATAATTTGAATAAAGATAATTATCAGAAAGGCT
GTGATACACCAATGAAAAGAGAATGTAAAGAAAAATTTAAGGAAACATCA
GAACAAGCAAATGATGTCAAGCAAATAAAAGAACAAATATATTCCGATAA
TGAAAAGGAGCAGCCGGAACCTGAAATTATCCCAATAATTCCAGAAATAG
ATAATTGCAATGGAAAAATATTCGAACTTTTGGGATTCAAAATCGTTGAT
TTTACTTTTCCAGAAGAAAAATATTTTTTTTCAACGGAAAAACATTATTT
GCAAATTAAGAAATGCCCGAAGACTGAAAAAAGCCAATTTATACCGAAAT
ATTTGTTTCTTTGTTTTAGTGTGAATGAAAATCATGCTGAAATTAACCAA
GGAAGTATCAGTCAAGCTCAATTTGAAGAACGGGTTTATTCATTGCTTTC
TATTGTAAATTATGATCAATCAAATGGGCGAAATAAATATTATGTGAAAT
GTGTTGAAAAATCGGCACAATTATCTGGAGATTTTGAATCTATTTCTAAA
TCTGATATTAATTCGAATACTCTCGTAGCTGCTCTGATGGAACTGAAAGA
ACCGCCAAAAAATGAAGAAAAAAATGAGAAGAAAATCGAGGAGCAAAATA
ATTACCTAAATAAAGAGAAAAATAATGACAGAAATGAGGAGCGAAATGAG
GATAAAAATGAGAAAATAGAGGATAAATATGATAACCAAAACGAAGTGAA
AAGAGAGGAGAAAGTTGTAGGTGAAAATAATAAGCAAAATTATGATCAAA
ATAAAGACAAAACTGAGGGGGGGAAACAGAAGAAAAAGGAAGAGAAAAAT
AATGATAAAAATGATCAGCGAAATGAGGAGAAATATGATAATCAAAACGA
AGGGAAAAGAGAGGAGAAAAATGTAGGTGAAAATGAGAAGCAAAATGATG
ACCAAAATGAAGAGAAAAATAATGAAAAACGTCCTTTAGGTCCTACAGCA
ACCGGAGACCATGAAAATCTTGAATGTTCAAATTCTATTTCGTGGCCTAT
AGGGCTAAAATATAGAGAACTCGAGGATATCAAAAGTGCTTCACAAAGTC
AAATATTTACACACGAAGGGGATACACATCCTAATCTAGATTCTTTAATT
GTGAACGAAAAATTCAATAAACAAGTGTCTAGTGAAAATTCTGATATATC
TTTAGAAATTATTTCTCTATCAAATTTCGAAGAAGAAATAAATGAGGAAA
ATGTGAATTCATTTGAAACGAATCTTTCGAACAAAAATCTTGAAGGACTT
CAATTAGCTCATTTAGTTCAAATCATTTTGAAATCCGACGAAAAAACTTG
TTATTCTTCTATAATAAGTTTATTATTTCTCTGCCCTAAATTTAGAGATT
TTGTGCTGGAAATATATAAAAAGACTGGCGACGTAGAGATAGGTAAAAAT
AGTGAAATGCGGGAGAAATCTCCATTTTTTGAAATCTGCTCCTTATATCA
TAGCTTAGTCTCCTGTGGGACCCTTGGTGATGAATATCCTTCTTCAGAGG
CAAAATGCTCCAAAAATATATTTTCCGAAGAAATCGGTGAATGTTACAAA
TCTTTGCTTGCAAAAATAAATGAAGATATTTTCTCTAATTTCGTTGAAAG
TTTCGATGATGACTCCGTTACTAGTTACAGTCACTTGATTCAGGATTTAT
TTAAAAGCCAAATTTATGTCGAAATCATCTGTGTAAATTGTACACGCACT
ATAACATCCAAAGAATATGTTTATTACCTTTCTATTGAATTTCCTATTGA
TAAAAATAGTGAAAGTATTCAGAATTGTGTGAATAATGGCTTCATTGGAA
ATGTTTTCAAAATGAAAGATAATTGCTGCTCAAACCAGCCTCTTTCAACT
ATAACTAAATTCAATTGTTCCGGAGATTATCTGTTAATTTGCTTGAACAA
AACTACAAAACAACGAAATAGAAGTGGAGAAATCAATATCAAACTCGACG
ATGGACTTTTATTAGAATATATTAACTGCACACAGATTTATTCATTATAC
GCAGTGATTGATGAAAGCCAATCAAATGCTGGAAACCGGTATGAAATTAA
ATTTCTATCCAATGAAAAATGGTTGCGAGTTAATTCAACTGAAGCTGTCC
CTGTGGATAGTAATACCATTACTTCGACTCAAAATGCGGCTTTCTTATTC
AAAAAAAGTGATTTAAAATGAATTCAAAGTTTTATGATTTTGACTTTAAA
AATTTTATTAAAATCGTTTATTTGATGCTGAATTTTACATTTTTAAGTTT
TTCAATATTTTATGTATTTCATATAATAAGTTTGTTGTTTTCTTTATTTA
TTAAACGCC
back to top

protein sequence of SMED30035249-orf-1

>SMED30035249-orf-1 ID=SMED30035249-orf-1|Name=SMED30035249-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1256bp
MTSKSSVTNSIHESSIEKRQNNFQSIKHMGLPNPQSFCYLNSVLQMLYSC
KLFRLKLSEWIKSNPDLTNNENNENLNFVYALGDLFNSMESQVEEEVQFR
VSILQTLFQTSSAGDDIHKCYLQILSRINAVTRCSTAPENIGDQNECKIK
SKTQYDESLIDLFSGLICFETKCSCGKSLYSKSQTFKSMPLEVPSSPWKI
SIEHCILNHFRDSTIMESELSCCEYPNIKLSSQYAAVPQYIFIYLVRGAY
RINEKKVDTFIYFRSFIDIPTKDGNVKYKVISVIDHMGGSENGHYYMKAL
HESENSSKWLLKNDSQVVEIQDSEVCKRFSIGILLEKAENGIQDVPKLLT
SGKEFNSHFRSAMQAIFRIFYLCEDFKNGLISFYEKEIVNRNTLIYGTRL
GEILHYMSENNNKLVDILIEEFCFNWSNPFYSIKELCCDILQKVNFNIKK
AKEIRENPKDNNYNDTEKSNSEKFQNKPKAEAPTSTKLKTSKKSRSFSCS
CFPKNFKSNKRNKNTERCQNKNNLNKDNYQKGCDTPMKRECKEKFKETSE
QANDVKQIKEQIYSDNEKEQPEPEIIPIIPEIDNCNGKIFELLGFKIVDF
TFPEEKYFFSTEKHYLQIKKCPKTEKSQFIPKYLFLCFSVNENHAEINQG
SISQAQFEERVYSLLSIVNYDQSNGRNKYYVKCVEKSAQLSGDFESISKS
DINSNTLVAALMELKEPPKNEEKNEKKIEEQNNYLNKEKNNDRNEERNED
KNEKIEDKYDNQNEVKREEKVVGENNKQNYDQNKDKTEGGKQKKKEEKNN
DKNDQRNEEKYDNQNEGKREEKNVGENEKQNDDQNEEKNNEKRPLGPTAT
GDHENLECSNSISWPIGLKYRELEDIKSASQSQIFTHEGDTHPNLDSLIV
NEKFNKQVSSENSDISLEIISLSNFEEEINEENVNSFETNLSNKNLEGLQ
LAHLVQIILKSDEKTCYSSIISLLFLCPKFRDFVLEIYKKTGDVEIGKNS
EMREKSPFFEICSLYHSLVSCGTLGDEYPSSEAKCSKNIFSEEIGECYKS
LLAKINEDIFSNFVESFDDDSVTSYSHLIQDLFKSQIYVEIICVNCTRTI
TSKEYVYYLSIEFPIDKNSESIQNCVNNGFIGNVFKMKDNCCSNQPLSTI
TKFNCSGDYLLICLNKTTKQRNRSGEINIKLDDGLLLEYINCTQIYSLYA
VIDESQSNAGNRYEIKFLSNEKWLRVNSTEAVPVDSNTITSTQNAAFLFK
KSDLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0016579protein deubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR028889USP_dom
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 16..338
e-value: 2.0E-37
score: 131.0
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 8..319
NoneNo IPR availablePANTHERPTHR21646:SF23UBIQUITIN CARBOXYL-TERMINAL HYDROLASE USP2coord: 8..319
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 102..325
e-value: 5.61122E-19
score: 84.0718
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 30..325
e-value: 2.1E-25
score: 89.7
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 29..338
score: 28.673
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 29..327