Nuclear RNA export factor 1

Overview
NameNuclear RNA export factor 1
Smed IDSMED30035246
Length (bp)2152
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear RNA export factor 1 (SMED30035246) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear RNA export factor 1 (SMED30035246) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear RNA export factor 1 (SMED30035246) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear RNA export factor 1 (SMED30035246) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035246

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035246SMESG000055230.1 SMESG000044253.1 Contig1491uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035246SMESG000055230.1 SMESG000044253.1 Contig1491newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035246SMESG000007145.1 Contig1491uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035246SMESG000007145.1 Contig1491newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear RNA export factor 1 vs. Ensembl Human
Match: NXF2B (nuclear RNA export factor 2B [Source:HGNC Symbol;Acc:HGNC:23984])

HSP 1 Score: 75.8702 bits (185), Expect = 1.531e-13
Identity = 86/340 (25.29%), Postives = 146/340 (42.94%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF-----NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            K+  L++S N++ +  EL  ++   + EL + GN    + + +      +R   P L  L+G +L   V +  D   SS+++ P       S++       F+  Y+S +D   R  L   Y+ E+  ++AI          SL  Y   S N+ T KD   + + ++R K  I+ + +  P T+H   ++ VD+   TE  + F V G F E+     GS  V  F+RT     G      I+  E   LF  D+   Q+ +S        +         +    E+ E+V+ F   S M +    + L+    +   A + F  LQ  G+IP EAF+
Sbjct:  297 KVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDID---SSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGS--VLAFTRTFIATPGSSSSLCIVNDE---LFVRDASP-QETQSAFSIPVSTLSSSSEPSLSQ----EQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQAFTMLQTEGKIPAEAFK 623          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Human
Match: NXF2B (nuclear RNA export factor 2B [Source:HGNC Symbol;Acc:HGNC:23984])

HSP 1 Score: 75.8702 bits (185), Expect = 1.531e-13
Identity = 86/340 (25.29%), Postives = 146/340 (42.94%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF-----NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            K+  L++S N++ +  EL  ++   + EL + GN    + + +      +R   P L  L+G +L   V +  D   SS+++ P       S++       F+  Y+S +D   R  L   Y+ E+  ++AI          SL  Y   S N+ T KD   + + ++R K  I+ + +  P T+H   ++ VD+   TE  + F V G F E+     GS  V  F+RT     G      I+  E   LF  D+   Q+ +S        +         +    E+ E+V+ F   S M +    + L+    +   A + F  LQ  G+IP EAF+
Sbjct:  297 KVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDID---SSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGS--VLAFTRTFIATPGSSSSLCIVNDE---LFVRDASP-QETQSAFSIPVSTLSSSSEPSLSQ----EQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQAFTMLQTEGKIPAEAFK 623          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Human
Match: NXF2 (nuclear RNA export factor 2 [Source:HGNC Symbol;Acc:HGNC:8072])

HSP 1 Score: 75.8702 bits (185), Expect = 1.531e-13
Identity = 86/340 (25.29%), Postives = 146/340 (42.94%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF-----NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            K+  L++S N++ +  EL  ++   + EL + GN    + + +      +R   P L  L+G +L   V +  D   SS+++ P       S++       F+  Y+S +D   R  L   Y+ E+  ++AI          SL  Y   S N+ T KD   + + ++R K  I+ + +  P T+H   ++ VD+   TE  + F V G F E+     GS  V  F+RT     G      I+  E   LF  D+   Q+ +S        +         +    E+ E+V+ F   S M +    + L+    +   A + F  LQ  G+IP EAF+
Sbjct:  297 KVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDID---SSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGS--VLAFTRTFIATPGSSSSLCIVNDE---LFVRDASP-QETQSAFSIPVSTLSSSSEPSLSQ----EQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQAFTMLQTEGKIPAEAFK 623          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Human
Match: NXF2 (nuclear RNA export factor 2 [Source:HGNC Symbol;Acc:HGNC:8072])

HSP 1 Score: 75.8702 bits (185), Expect = 1.531e-13
Identity = 86/340 (25.29%), Postives = 146/340 (42.94%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF-----NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            K+  L++S N++ +  EL  ++   + EL + GN    + + +      +R   P L  L+G +L   V +  D   SS+++ P       S++       F+  Y+S +D   R  L   Y+ E+  ++AI          SL  Y   S N+ T KD   + + ++R K  I+ + +  P T+H   ++ VD+   TE  + F V G F E+     GS  V  F+RT     G      I+  E   LF  D+   Q+ +S        +         +    E+ E+V+ F   S M +    + L+    +   A + F  LQ  G+IP EAF+
Sbjct:  297 KVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDID---SSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGS--VLAFTRTFIATPGSSSSLCIVNDE---LFVRDASP-QETQSAFSIPVSTLSSSSEPSLSQ----EQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQAFTMLQTEGKIPAEAFK 623          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Human
Match: NXF1 (nuclear RNA export factor 1 [Source:HGNC Symbol;Acc:HGNC:8071])

HSP 1 Score: 71.633 bits (174), Expect = 2.729e-12
Identity = 107/435 (24.60%), Postives = 190/435 (43.68%), Query Frame = 1
Query:  481 DELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQ----FRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPV---IYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII----QGGIILQESIHLFPNDSGLYQK-FRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            +EL    V+ LK  +  RY      ++  L+L     D  ++  N+ +  +        L I+++ + EL +LNLSNN +  +  + + V      K L++S N + +  EL  ++   + EL + GN     FR   T      +R+  P L  L+G +L   +A     +++  +LPP     +G ++  S   +F+  Y++ +D   R  L + Y+  +  +++I          SL  Y   S N+   KD   R   +K  +  ++      P T+H   +  VDI + T + + F V G F E+      S  +R F+RT   +     G  I+ + + +    S   Q+ F     T         S   +  LS E+ E+++ F T S MN+    + L+  + D   +++ F  L+A GEIP  AF
Sbjct:  202 NELKPEQVEQLKLIMSKRYD----GSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQST--YISAIRERFPKLLRLDGHELPPPIAF---DVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDS--LRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPT--------PSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAF 617          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Celegans
Match: nxf-1 (Nuclear RNA export factor 1 [Source:UniProtKB/TrEMBL;Acc:B5BM32])

HSP 1 Score: 67.0106 bits (162), Expect = 2.600e-11
Identity = 90/388 (23.20%), Postives = 163/388 (42.01%), Query Frame = 1
Query:  358 KGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRV---PDELPAPWVDVLKQALKTRYSINPQNNEAE---LNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVK-ITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLP--------PVIYGQKDSDSFNFMLNYFSKFDG----KTRDELCEFYNSES---FLTVAIF----------GESLPYYKSISCN-LYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTI 1416
            +G  E+Y++ + +      NN       R   +K    RV     ++PAPW+ + ++ ++  + +  + + AE   L+LS F+ED+     ++++  +   V   VL+ +  +   +  L+LSNN I  +    A VS  K + +LD+S+N +S   EL       +      GN   +S TQ       + +  P    L+G++++  V   G  L    ++P        P I    +     F+ +YF  +DG    +TR  L   Y++++    LT+              E    Y  +S N L   + A  R     RG   I    +  P + H+ +T  VD+   +   + F V G F +   ++T S     FSR+  +
Sbjct:  118 RGDFEWYVRDEDTASTIRANN-------RRVVHKESGTRVEFYTSKVPAPWMKLKREEIEIIHRVVDKRHNAENRVLDLSNFHEDEEFKAKDMMMNLTKGNVMLTVLDHIDDKYGNIVALSLSNNRIRHLDYASALVSIAKFVMELDLSHNHISTEKELEKFAGLPVERFFFEGNPVVESFTQRAAYISYIHQSFPRCNMLDGVEVQPLV--VGPDLDIHDAMPFRAGYYPNPQIRVLVE----QFVTSYFDFYDGPDGQRTRRNLHNAYDADASTFSLTIEHLRGSSHARHHNDECFAQYAGVSHNVLKQERFARHRASRSARGAMDIAVALSKLPTSSHMRDTFIVDVFLQSNDLLGFTVQGLFCDGDLTQTPSPSF--FSRSFLV 490          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Celegans
Match: nxf-2 (Nuclear RNA export factor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVS8])

HSP 1 Score: 59.6918 bits (143), Expect = 4.286e-9
Identity = 72/293 (24.57%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  568 LNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQ--ELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLP--PVIYGQKDSDSF--NFMLNYFSKFDG----KTRDELCEFY--NSESFLTVAIF------------GESLPYYKSISCNLYTNKD-ALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSS 1368
            LNLS F ++   +E ++++  +  RV   VL  +  +   ++ ++ SNN +  +  L +  S  K  K LD+S+N++S+  EL  L +  +  +   GN   +   Q  E    ++K  P    L+GM++E       D  +  + +P     YG  +  +    F++ Y+  +DG    +TR +L + Y  N+ +F    +              ES   Y   S N+   +  A  R   I  G   I+   +  P T HL +T  VD+   + + + F + GTF + PS+
Sbjct:   58 LNLSNFSKNTEFVERDMLMCLTKTRVMSVVLQHIGYKYPRISGISFSNNRLCHLDHLSSLSSISKFLKFLDLSHNQISSGEELKKLGTIPVETVFFEGNPVCEKFVQCAEYANFIQKTFPKCSNLDGMEVEP----KPDHNRIEQIIPFRNGYYGSDEVRTLVEEFIITYYKIYDGADGQQTRKQLLDAYDTNNSTFTHTVVCLWDPIKFVMYPDSESYRMYLRTSHNVLNQEYFAANRASRISHGAMDIVVALSRLPATIHLMDTFVVDVFLVSATLLGFTLHGTFRDGPSA 346          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Celegans
Match: nxf-2 (Nuclear RNA export factor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XVS8])

HSP 1 Score: 59.6918 bits (143), Expect = 4.286e-9
Identity = 72/293 (24.57%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  568 LNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQ--ELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLP--PVIYGQKDSDSF--NFMLNYFSKFDG----KTRDELCEFY--NSESFLTVAIF------------GESLPYYKSISCNLYTNKD-ALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSS 1368
            LNLS F ++   +E ++++  +  RV   VL  +  +   ++ ++ SNN +  +  L +  S  K  K LD+S+N++S+  EL  L +  +  +   GN   +   Q  E    ++K  P    L+GM++E       D  +  + +P     YG  +  +    F++ Y+  +DG    +TR +L + Y  N+ +F    +              ES   Y   S N+   +  A  R   I  G   I+   +  P T HL +T  VD+   + + + F + GTF + PS+
Sbjct:   58 LNLSNFSKNTEFVERDMLMCLTKTRVMSVVLQHIGYKYPRISGISFSNNRLCHLDHLSSLSSISKFLKFLDLSHNQISSGEELKKLGTIPVETVFFEGNPVCEKFVQCAEYANFIQKTFPKCSNLDGMEVEP----KPDHNRIEQIIPFRNGYYGSDEVRTLVEEFIITYYKIYDGADGQQTRKQLLDAYDTNNSTFTHTVVCLWDPIKFVMYPDSESYRMYLRTSHNVLNQEYFAANRASRISHGAMDIVVALSRLPATIHLMDTFVVDVFLVSATLLGFTLHGTFRDGPSA 346          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Fly
Match: sbr (gene:FBgn0003321 transcript:FBtr0473368)

HSP 1 Score: 73.1738 bits (178), Expect = 3.615e-13
Identity = 95/367 (25.89%), Postives = 167/367 (45.50%), Query Frame = 1
Query:  400 IEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVD-----VLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAF---VSSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGN--QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAI----AGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALR-------RPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVEL------PSSKTGSYRVREFSRTMTII 1419
            I+++  N +  + YRL        RV   +P   +D      +K  +  RY+I  +     L+LS F+ D  +    +        V G  ++I+   + +L  LNL++N+I+S+   K     + ++KI  L + +N++ +L  L  L++ SI+EL +  N  + R   +Q+   +VR+  P L  L+G  LE  +       G  L++  S    + G +      F+  YF  FD   R  L + Y+ ++ L++++   S      ++     N++  R       R  N+K G+   + T   +P T+H   T  VD+     S M+F VTG F EL      P+S    Y VR F+RT  ++
Sbjct:   31 IQHLGKNGHLPDGYRLMP------RVRSGIPLVAIDDAFKEKMKVTMAKRYNIQTK----ALDLSRFHADPDL--KQVFCPLFRQNVMGAAIDIMCDNIPDLEALNLNDNSISSMEAFKGVEKRLPNLKI--LYLGDNKIPSLAHLVVLRNLSILELVLKNNPCRSRYKDSQQFISEVRRKFPKLVKLDGETLEPQITFDLSEQGRLLETKASYLCDVAGAEVVR--QFLDQYFRIFDSGNRQALLDAYHEKAMLSISM--PSASQAGRLNSFWKFNRNLRRLLNGEENRTRNLKYGRLACVSTLDEWPKTQHDRRTFTVDLTIYNTSMMVFTVTGLFKELNDETNNPASME-LYDVRHFARTYVVV 378          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Fly
Match: sbr (gene:FBgn0003321 transcript:FBtr0473367)

HSP 1 Score: 73.1738 bits (178), Expect = 3.615e-13
Identity = 95/367 (25.89%), Postives = 167/367 (45.50%), Query Frame = 1
Query:  400 IEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVD-----VLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAF---VSSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGN--QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAI----AGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALR-------RPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVEL------PSSKTGSYRVREFSRTMTII 1419
            I+++  N +  + YRL        RV   +P   +D      +K  +  RY+I  +     L+LS F+ D  +    +        V G  ++I+   + +L  LNL++N+I+S+   K     + ++KI  L + +N++ +L  L  L++ SI+EL +  N  + R   +Q+   +VR+  P L  L+G  LE  +       G  L++  S    + G +      F+  YF  FD   R  L + Y+ ++ L++++   S      ++     N++  R       R  N+K G+   + T   +P T+H   T  VD+     S M+F VTG F EL      P+S    Y VR F+RT  ++
Sbjct:   31 IQHLGKNGHLPDGYRLMP------RVRSGIPLVAIDDAFKEKMKVTMAKRYNIQTK----ALDLSRFHADPDL--KQVFCPLFRQNVMGAAIDIMCDNIPDLEALNLNDNSISSMEAFKGVEKRLPNLKI--LYLGDNKIPSLAHLVVLRNLSILELVLKNNPCRSRYKDSQQFISEVRRKFPKLVKLDGETLEPQITFDLSEQGRLLETKASYLCDVAGAEVVR--QFLDQYFRIFDSGNRQALLDAYHEKAMLSISM--PSASQAGRLNSFWKFNRNLRRLLNGEENRTRNLKYGRLACVSTLDEWPKTQHDRRTFTVDLTIYNTSMMVFTVTGLFKELNDETNNPASME-LYDVRHFARTYVVV 378          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Fly
Match: sbr (gene:FBgn0003321 transcript:FBtr0073411)

HSP 1 Score: 72.7886 bits (177), Expect = 5.895e-13
Identity = 94/365 (25.75%), Postives = 164/365 (44.93%), Query Frame = 1
Query:  400 IEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVD-----VLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGN--QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAI----AGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALR-------RPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVEL------PSSKTGSYRVREFSRTMTII 1419
            I+++  N +  + YRL        RV   +P   +D      +K  +  RY+I  +     L+LS F+ D  +    +        V G  ++I+   + +L  LNL++N+I+S+   K     +   K L + +N++ +L  L  L++ SI+EL +  N  + R   +Q+   +VR+  P L  L+G  LE  +       G  L++  S    + G +      F+  YF  FD   R  L + Y+ ++ L++++   S      ++     N++  R       R  N+K G+   + T   +P T+H   T  VD+     S M+F VTG F EL      P+S    Y VR F+RT  ++
Sbjct:  167 IQHLGKNGHLPDGYRLMP------RVRSGIPLVAIDDAFKEKMKVTMAKRYNIQTK----ALDLSRFHADPDL--KQVFCPLFRQNVMGAAIDIMCDNIPDLEALNLNDNSISSMEAFKGVEKRLPNLKILYLGDNKIPSLAHLVVLRNLSILELVLKNNPCRSRYKDSQQFISEVRRKFPKLVKLDGETLEPQITFDLSEQGRLLETKASYLCDVAGAEVVR--QFLDQYFRIFDSGNRQALLDAYHEKAMLSISM--PSASQAGRLNSFWKFNRNLRRLLNGEENRTRNLKYGRLACVSTLDEWPKTQHDRRTFTVDLTIYNTSMMVFTVTGLFKELNDETNNPASME-LYDVRHFARTYVVV 514          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Fly
Match: Nxf3 (gene:FBgn0263232 transcript:FBtr0333073)

HSP 1 Score: 50.8322 bits (120), Expect = 4.335e-6
Identity = 92/349 (26.36%), Postives = 155/349 (44.41%), Query Frame = 1
Query:  466 EVRVPDELPAP---------WVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIY-------KLKAFV----SSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRDV-RKILPHLKCLNG-MKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF--NFMLNYFSKFDG-KTRDELCEFYNSESFLTVAIFGESLPY-------YKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTI 1416
            EVRV   LP           +   +++AL++RY ++ +     L+LS F+         L L F       C L+++K     L   N    ++ S+         LKAF     S   + +LDIS NR+ +L EL  +   S   + ++GN     G  +L  DV RK+LP LK ++G ++L E+   A D +  S+ L     G  +   F  +F+ +Y++ FD  + R +L ++Y+ +     A+F  S+P        YK  + N      +  +   ++ G+A +L   +  P      E + +DI   T S  +F +TG F E+ S    +   R F RT  +
Sbjct:   99 EVRVTPGLPKSMMCAQITDEFTTAIQEALRSRYEVDSRT----LDLSRFHASP-----ELSLHF-------CPLHMVKLLETVLVLSNHLFPHVTSLVLSNNYLCSLKAFAGNSQSFASLERLDISANRIQDLGELNYINKLSCKTIFLAGN-----GLAKLSVDVIRKMLPQLKNVHGCVQLGESTE-AVDNIPKSQQLQG---GGTNGLKFCQDFISSYYTFFDDTEERFKLKKYYDDQ-----AMFSLSVPVQLNYVYGYKLYNRNQKRQHSSFAQNAKLQVGRAALLLALSRLPLMHTDLENVGLDIQVFTSSLRIFTLTGYFKEISSD---TLEPRRFQRTFVL 414          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Fly
Match: Nxf3 (gene:FBgn0263232 transcript:FBtr0345389)

HSP 1 Score: 50.8322 bits (120), Expect = 4.335e-6
Identity = 92/349 (26.36%), Postives = 155/349 (44.41%), Query Frame = 1
Query:  466 EVRVPDELPAP---------WVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIY-------KLKAFV----SSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRDV-RKILPHLKCLNG-MKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF--NFMLNYFSKFDG-KTRDELCEFYNSESFLTVAIFGESLPY-------YKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTI 1416
            EVRV   LP           +   +++AL++RY ++ +     L+LS F+         L L F       C L+++K     L   N    ++ S+         LKAF     S   + +LDIS NR+ +L EL  +   S   + ++GN     G  +L  DV RK+LP LK ++G ++L E+   A D +  S+ L     G  +   F  +F+ +Y++ FD  + R +L ++Y+ +     A+F  S+P        YK  + N      +  +   ++ G+A +L   +  P      E + +DI   T S  +F +TG F E+ S    +   R F RT  +
Sbjct:   99 EVRVTPGLPKSMMCAQITDEFTTAIQEALRSRYEVDSRT----LDLSRFHASP-----ELSLHF-------CPLHMVKLLETVLVLSNHLFPHVTSLVLSNNYLCSLKAFAGNSQSFASLERLDISANRIQDLGELNYINKLSCKTIFLAGN-----GLAKLSVDVIRKMLPQLKNVHGCVQLGESTE-AVDNIPKSQQLQG---GGTNGLKFCQDFISSYYTFFDDTEERFKLKKYYDDQ-----AMFSLSVPVQLNYVYGYKLYNRNQKRQHSSFAQNAKLQVGRAALLLALSRLPLMHTDLENVGLDIQVFTSSLRIFTLTGYFKEISSD---TLEPRRFQRTFVL 414          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Zebrafish
Match: nxf1 (nuclear RNA export factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2585])

HSP 1 Score: 64.3142 bits (155), Expect = 3.198e-10
Identity = 99/425 (23.29%), Postives = 180/425 (42.35%), Query Frame = 1
Query:  511 LKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGN----QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFN-----FMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            LKQ +  R+      ++  L+L+    D  ++  N+ +  +       V+ I+++ + EL  LNLSNN +  +  L   +  V   K L++S+N +    EL  L+   +++L++ GN     F+     +    +R+  P L  L+G  L   +    D   S+  LPP       S+        F+  +++ +D   R  L + Y+  +  +++I          +L  Y+  S N+   KD   R   IK  +  ++      P T+H   +  VD+ + T + + F V G F E+      +YR   FSR    +  G     I+  E   LF  ++   +  R+ +           S   +  LS+ + E++  F   S MN+    + L+    D   A++ F  L+A G+IP  AF
Sbjct:  234 LKQCMAKRFD----GSQQALDLNNIRVDPDLVSQNIEVTLNRKNSMCAVIKIIEENIPELVCLNLSNNRLFRLDDLVDIIHKVPNLKILNLSHNELKTERELDKLKGLKLVDLSLEGNPLCHHFKIHA--DYISAIRERFPKLLKLDGHDLPPPIGFDLDDGPST--LPPSKASYFCSEEIKNIILCFLQQFYNVYDSGNRQPLLDAYHDGATFSLSIPFVSLNPSKSTLGEYQKDSRNIKRMKDPTTRYRLIKHTRLNVVAFLNELPKTQHDIASFVVDVNTYTATLLAFTVCGVFKEMDGKSRETYRA--FSRVFIAVPAGSTGLCIVNDE---LFVRNATTEEIRRAFVAPAPT-----PSSSPVPTLSAHQQEMLAAFSLKSGMNLEWSQKCLQDNDWDFERAAQIFTGLKAQGKIPDVAF 640          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Zebrafish
Match: zgc:153681 (zgc:153681 [Source:ZFIN;Acc:ZDB-GENE-060825-299])

HSP 1 Score: 50.8322 bits (120), Expect = 4.847e-6
Identity = 57/248 (22.98%), Postives = 103/248 (41.53%), Query Frame = 1
Query:  727 IYKLKAFVSSVK----ITKLDISNNRMSNLNELYSLQSSSIIELNISGNQF--RKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFN-----FMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLP------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII 1419
            +YKL      V     +  L++S N + +  EL  ++   ++EL + GN    R          V+K  P L  L+G  L   +    +T   S ++P        S+        F+  Y+S +D   R  L E Y+  +  ++ +   S P      Y+K+ S N+   KD+  R   +K  +  ++      P T+H   ++NVD+ +   + + F V+G F E+       ++   FSR    +
Sbjct:  302 LYKLDGLTELVNKAPNLQSLNLSCNELKSHCELDKVKGFRLVELCLDGNPLCDRFKDQTTYISAVQKCFPRLLRLDGHVLSLPICFEVET---SSNIPLCKGSHFVSNEIQGLIQRFLEQYYSIYDSGDRQPLLEAYHESACFSLCLPSISNPSRYKLDYFKN-SRNVKNIKDSPTRFRLLKHTRLTVVACLNELPKTQHDINSINVDVNAYASTLLAFTVSGVFKEVDDQSEDLFKA--FSRVFVTV 543          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Xenopus
Match: nxph1 (neurexophilin 1 [Source:Xenbase;Acc:XB-GENE-5808393])

HSP 1 Score: 65.4698 bits (158), Expect = 2.371e-10
Identity = 87/364 (23.90%), Postives = 147/364 (40.38%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNEL--YSLQSSSIIELNISGNQFRKS---------GTQELKRD-----------------VRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFG--------ESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII---QGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            ++  LDISNN++  L++L   +L++ ++  LN+S N  +             +EL  D                 VR+  P L  L+G +L   +      +++  +LPP       SD        F+  Y++ +D + R  L   Y+ E+  +++I           SL  Y   S N+   +D   R   +K  +  ++G     P T+H   +  VDI + + + + FVV G F E+    +    VR FSR    +    GG++L        N     ++ R    T         S   +  L+    ++V+ F   S MN     + L+    D   A + F KL A G+IP  AF
Sbjct:  266 ELLSLDISNNKLYKLDDLEEITLKAPNLKILNLSQNLLKSDRELDKVKGLKLEELWLDGNPLCDTFRDQTNYISAVRERFPKLLRLDGHELPPPITF---DVETPTTLPPCKGSYLASDDIKALVLRFLQQYYACYDSEDRQGLLNVYHDEACCSLSIPSNPGQNPSRSSLGEYFKDSRNIRRLRDPTLRFKLLKHKRLNVVGFLNELPRTQHDLNSFVVDITAHSNTLLCFVVNGIFKEVEGQSSNP--VRAFSRVFIAVPGSDGGLLLVNDEQFIRN--ATTEEIRKAFATPAPT----PSSSPVPVLAPVPHDMVQAFIQVSGMNAEWSQKCLEDNGWDFDQAGQIFMKLNAEGKIPDVAF 618          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Xenopus
Match: selenoi (selenoprotein I [Source:Xenbase;Acc:XB-GENE-991194])

HSP 1 Score: 59.6918 bits (143), Expect = 1.554e-8
Identity = 78/344 (22.67%), Postives = 138/344 (40.12%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKS--GTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPV---IYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPY--------YKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLE--------NLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            ++  +++S N++    E+  L    + EL + GN F  S   T    R V    P ++ L+G   +          K  +SLP +    +  +D  +F   F+  YF+ +D   R +L   Y+     + ++    LP+        Y   + NL   K A  R   +K  + Q++G   N P T+H   +  +D+   T S + F V G F E   S       R F R+  I+       E+     ND  +       I++  +Q E +      +         L    + ++R F   + M V   L+ L+  + ++  A + F  L+  G IP +AF+
Sbjct:  311 QLQSMNLSYNQICQAQEINVLHKLELKELWLEGNPFLASLESTSTYYRIVMNHFPSVQILDGHFFKPGCFFG----KVPRSLPQIKGSFFVNEDLRAFLVPFVSRYFTIYDSTQRQQLLPLYHENCCCSFSLPNVLLPHICVEQAKEYLKENRNLLRVKRAALRQQLMKYNRLQVVGFLCNLPRTEHDLSSFTLDVWFQTPSLIGFSVAGIFKE--ESPKWKKLCRSFRRSFLIVPA----MEACAQILNDQLV------IINSYVDQYEDKCGPASPDPGSPGSNVALCDGNMVVLRNFSESTGMKVEWALKCLEDNNWNVEQAQDVFSLLKEKGTIPQDAFQ 638          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Xenopus
Match: selenoi (selenoprotein I [Source:Xenbase;Acc:XB-GENE-991194])

HSP 1 Score: 59.3066 bits (142), Expect = 2.059e-8
Identity = 78/344 (22.67%), Postives = 138/344 (40.12%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKS--GTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPV---IYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPY--------YKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLE--------NLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            ++  +++S N++    E+  L    + EL + GN F  S   T    R V    P ++ L+G   +          K  +SLP +    +  +D  +F   F+  YF+ +D   R +L   Y+     + ++    LP+        Y   + NL   K A  R   +K  + Q++G   N P T+H   +  +D+   T S + F V G F E   S       R F R+  I+       E+     ND  +       I++  +Q E +      +         L    + ++R F   + M V   L+ L+  + ++  A + F  L+  G IP +AF+
Sbjct:  328 QLQSMNLSYNQICQAQEINVLHKLELKELWLEGNPFLASLESTSTYYRIVMNHFPSVQILDGHFFKPGCFFG----KVPRSLPQIKGSFFVNEDLRAFLVPFVSRYFTIYDSTQRQQLLPLYHENCCCSFSLPNVLLPHICVEQAKEYLKENRNLLRVKRAALRQQLMKYNRLQVVGFLCNLPRTEHDLSSFTLDVWFQTPSLIGFSVAGIFKE--ESPKWKKLCRSFRRSFLIVPA----MEACAQILNDQLV------IINSYVDQYEDKCGPASPDPGSPGSNVALCDGNMVVLRNFSESTGMKVEWALKCLEDNNWNVEQAQDVFSLLKEKGTIPQDAFQ 655          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Xenopus
Match: nxph1 (neurexophilin 1 [Source:Xenbase;Acc:XB-GENE-5808393])

HSP 1 Score: 58.151 bits (139), Expect = 3.585e-8
Identity = 65/270 (24.07%), Postives = 114/270 (42.22%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNEL--YSLQSSSIIELNISGNQFRKS---------GTQELKRD-----------------VRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFG--------ESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII---QGGIIL 1437
            ++  LDISNN++  L++L   +L++ ++  LN+S N  +             +EL  D                 VR+  P L  L+G +L   +      +++  +LPP       SD        F+  Y++ +D + R  L   Y+ E+  +++I           SL  Y   S N+   +D   R   +K  +  ++G     P T+H   +  VDI + + + + FVV G F E+    +    VR FSR    +    GG++L
Sbjct:  268 ELLSLDISNNKLYKLDDLEEITLKAPNLKILNLSQNLLKSDRELDKVKGLKLEELWLDGNPLCDTFRDQTNYISAVRERFPKLLRLDGHELPPPITF---DVETPTTLPPCKGSYLASDDIKALVLRFLQQYYACYDSEDRQGLLNVYHDEACCSLSIPSNPGQNPSRSSLGEYFKDSRNIRRLRDPTLRFKLLKHKRLNVVGFLNELPRTQHDLNSFVVDITAHSNTLLCFVVNGIFKEVEGQSSNP--VRAFSRVFIAVPGSDGGLLL 532          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Xenopus
Match: nxph1 (neurexophilin 1 [Source:Xenbase;Acc:XB-GENE-5808393])

HSP 1 Score: 58.151 bits (139), Expect = 4.282e-8
Identity = 65/270 (24.07%), Postives = 114/270 (42.22%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNEL--YSLQSSSIIELNISGNQFRKS---------GTQELKRD-----------------VRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFG--------ESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII---QGGIIL 1437
            ++  LDISNN++  L++L   +L++ ++  LN+S N  +             +EL  D                 VR+  P L  L+G +L   +      +++  +LPP       SD        F+  Y++ +D + R  L   Y+ E+  +++I           SL  Y   S N+   +D   R   +K  +  ++G     P T+H   +  VDI + + + + FVV G F E+    +    VR FSR    +    GG++L
Sbjct:  283 ELLSLDISNNKLYKLDDLEEITLKAPNLKILNLSQNLLKSDRELDKVKGLKLEELWLDGNPLCDTFRDQTNYISAVRERFPKLLRLDGHELPPPITF---DVETPTTLPPCKGSYLASDDIKALVLRFLQQYYACYDSEDRQGLLNVYHDEACCSLSIPSNPGQNPSRSSLGEYFKDSRNIRRLRDPTLRFKLLKHKRLNVVGFLNELPRTQHDLNSFVVDITAHSNTLLCFVVNGIFKEVEGQSSNP--VRAFSRVFIAVPGSDGGLLL 547          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Mouse
Match: Nxf1 (nuclear RNA export factor 1 [Source:MGI Symbol;Acc:MGI:1858330])

HSP 1 Score: 60.8474 bits (146), Expect = 4.242e-9
Identity = 99/435 (22.76%), Postives = 184/435 (42.30%), Query Frame = 1
Query:  475 VPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSV-KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKS-GTQE-LKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPV---IYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            V +EL    ++ LK  +  RY      N+  L+L     D  ++  N+ +  +        L I+++ + EL +LNLS+N +  +  + + V     +  L++S N +    EL  ++   + EL +  N    + G Q      +R+  P L  L+G +L   ++     +++   LPP     +G ++  S    F+  Y+  +D   R  L   Y+  +  +++I         ++L  Y   S N+   K+  +R   +K  +  ++      P T+H      VDI + T + + F V G F E+      S  +R F+RT   +        I+  E      +   + + F  +  T         S   +  LS E+ E+++ F T S MN+    + L+  + D   +++ F  L+A GEIP  AF
Sbjct:  199 VQNELKPEQIEQLKLIMSKRYD----GNQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSSNRLYKLDDMSSIVQKAPNLKTLNLSGNELKTERELDKIKGLKLEELWLDRNPMCDNFGDQSSYISAIRERFPKLLRLDGHELPPPISF---DVEAPTMLPPCKGSYFGTENLKSLVLRFLQQYYVIYDSGDRQGLLYAYHDGACCSLSIPYNPQNPVRKNLAEYVKDSRNVKKLKEPTQRFRLLKHTRLNVVAFLNELPKTQHDVNAFVVDISAQTSTLLCFSVNGVFKEVDGKSRDS--LRAFTRTFIAVPASNSGLCIVNDELFVRNASPEEIQRAFAMSAPT--------PSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTLLKAKGEIPEVAF 616          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Mouse
Match: Nxf2 (nuclear RNA export factor 2 [Source:MGI Symbol;Acc:MGI:1933192])

HSP 1 Score: 52.7582 bits (125), Expect = 1.375e-6
Identity = 63/251 (25.10%), Postives = 108/251 (43.03%), Query Frame = 1
Query: 1042 FMLNYFSKFDGKTRDELCEFYNSESFLTVAI-FGESLP-------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRK-SHKDLEN---------------LSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            F+  Y+  +D   R  L + Y+ ++  ++++ F  S P       Y+K  S +L   +D+  R   +K  K  I+ + +  P T+H   +  VD+   TE  + F V G F+E+     G   +R F+R    I              +DS ++  FR  I  + +++  R  S K+++                LS E+ E+V+ F   S M +    + L+    D   A E F  LQ  G+IP E F+
Sbjct:  458 FLKEYYLFYDNGDRLRLLDAYHDQACFSLSVPFDVSDPNLNNLEEYFK-YSRDLKRQQDSSMRMQLLKHTKHDIVNSLSLLPKTQHDLCSFLVDLFLHTEMMLCFSVNGLFMEVEGKCRGC--IRAFTRIFIAIPC------------SDSRVHSSFRICI--MNDELIVRNASPKEIQKAFTSLPAPDTSFKPLLSEEQQEMVKSFSVQSGMKLDWSQKCLQDNEWDYTKAGEAFTALQNEGKIPKEFFK 691          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Mouse
Match: Nxf2 (nuclear RNA export factor 2 [Source:MGI Symbol;Acc:MGI:1933192])

HSP 1 Score: 50.0618 bits (118), Expect = 9.352e-6
Identity = 65/242 (26.86%), Postives = 104/242 (42.98%), Query Frame = 1
Query: 1042 FMLNYFSKFDGKTRDELCEFYNSESFLTVAI-FGESLP-------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRS--TIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            F+  Y+  +D   R  L + Y+ ++  ++++ F  S P       Y+K  S +L   +D+  R   +K  K  I+ + +  P T+H   +  VD+   TE  + F V G F+E+     G   +R F+R    I        I+  E I    +   + + F S    DT         S K L  LS E+ E+V+ F   S M +    + L+    D   A E F  LQ  G+IP E F+
Sbjct:  458 FLKEYYLFYDNGDRLRLLDAYHDQACFSLSVPFDVSDPNLNNLEEYFK-YSRDLKRQQDSSMRMQLLKHTKHDIVNSLSLLPKTQHDLCSFLVDLFLHTEMMLCFSVNGLFMEVEGKCRGC--IRAFTRIFIAIPCSDSRICIMNDELIVRNASPKEIQKAFTSLPAPDT---------SFKPL--LSEEQQEMVKSFSVQSGMKLDWSQKCLQDNEWDYTKAGEAFTALQNEGKIPKEFFK 685          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Mouse
Match: Nxf2 (nuclear RNA export factor 2 [Source:MGI Symbol;Acc:MGI:1933192])

HSP 1 Score: 50.0618 bits (118), Expect = 9.684e-6
Identity = 65/242 (26.86%), Postives = 104/242 (42.98%), Query Frame = 1
Query: 1042 FMLNYFSKFDGKTRDELCEFYNSESFLTVAI-FGESLP-------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRS--TIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            F+  Y+  +D   R  L + Y+ ++  ++++ F  S P       Y+K  S +L   +D+  R   +K  K  I+ + +  P T+H   +  VD+   TE  + F V G F+E+     G   +R F+R    I        I+  E I    +   + + F S    DT         S K L  LS E+ E+V+ F   S M +    + L+    D   A E F  LQ  G+IP E F+
Sbjct:  444 FLKEYYLFYDNGDRLRLLDAYHDQACFSLSVPFDVSDPNLNNLEEYFK-YSRDLKRQQDSSMRMQLLKHTKHDIVNSLSLLPKTQHDLCSFLVDLFLHTEMMLCFSVNGLFMEVEGKCRGC--IRAFTRIFIAIPCSDSRICIMNDELIVRNASPKEIQKAFTSLPAPDT---------SFKPL--LSEEQQEMVKSFSVQSGMKLDWSQKCLQDNEWDYTKAGEAFTALQNEGKIPKEFFK 671          
BLAST of Nuclear RNA export factor 1 vs. UniProt/SwissProt
Match: sp|Q9GZY0|NXF2_HUMAN (Nuclear RNA export factor 2 OS=Homo sapiens OX=9606 GN=NXF2 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.352e-13
Identity = 86/340 (25.29%), Postives = 146/340 (42.94%), Query Frame = 1
Query:  760 KITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF-----NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            K+  L++S N++ +  EL  ++   + EL + GN    + + +      +R   P L  L+G +L   V +  D   SS+++ P       S++       F+  Y+S +D   R  L   Y+ E+  ++AI          SL  Y   S N+ T KD   + + ++R K  I+ + +  P T+H   ++ VD+   TE  + F V G F E+     GS  V  F+RT     G      I+  E   LF  D+   Q+ +S        +         +    E+ E+V+ F   S M +    + L+    +   A + F  LQ  G+IP EAF+
Sbjct:  297 KVKTLNLSKNKLESAWELGKVKGLKLEELWLEGNPLCSTFSDQSAYVSAIRDCFPKLLRLDGRELSAPVIVDID---SSETMKPCKENFTGSETLKHLVLQFLQQYYSIYDSGDRQGLLGAYHDEACFSLAIPFDPKDSAPSSLCKYFEDSRNMKTLKDPYLKGELLRRTKRDIVDSLSALPKTQHDLSSILVDVWCQTERMLCFSVNGVFKEVEGQSQGS--VLAFTRTFIATPGSSSSLCIVNDE---LFVRDASP-QETQSAFSIPVSTLSSSSEPSLSQ----EQQEMVQAFSAQSGMKLEWSQKCLQDNEWNYTRAGQAFTMLQTEGKIPAEAFK 623          
BLAST of Nuclear RNA export factor 1 vs. UniProt/SwissProt
Match: sp|Q9U1H9|NXF1_DROME (Nuclear RNA export factor 1 OS=Drosophila melanogaster OX=7227 GN=sbr PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 5.909e-12
Identity = 94/365 (25.75%), Postives = 164/365 (44.93%), Query Frame = 1
Query:  400 IEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVD-----VLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGN--QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAI----AGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALR-------RPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVEL------PSSKTGSYRVREFSRTMTII 1419
            I+++  N +  + YRL        RV   +P   +D      +K  +  RY+I  +     L+LS F+ D  +    +        V G  ++I+   + +L  LNL++N+I+S+   K     +   K L + +N++ +L  L  L++ SI+EL +  N  + R   +Q+   +VR+  P L  L+G  LE  +       G  L++  S    + G +      F+  YF  FD   R  L + Y+ ++ L++++   S      ++     N++  R       R  N+K G+   + T   +P T+H   T  VD+     S M+F VTG F EL      P+S    Y VR F+RT  ++
Sbjct:  167 IQHLGKNGHLPDGYRLMP------RVRSGIPLVAIDDAFKEKMKVTMAKRYNIQTK----ALDLSRFHADPDL--KQVFCPLFRQNVMGAAIDIMCDNIPDLEALNLNDNSISSMEAFKGVEKRLPNLKILYLGDNKIPSLAHLVVLRNLSILELVLKNNPCRSRYKDSQQFISEVRRKFPKLVKLDGETLEPQITFDLSEQGRLLETKASYLCDVAGAEVVR--QFLDQYFRIFDSGNRQALLDAYHEKAMLSISM--PSASQAGRLNSFWKFNRNLRRLLNGEENRTRNLKYGRLACVSTLDEWPKTQHDRRTFTVDLTIYNTSMMVFTVTGLFKELNDETNNPASME-LYDVRHFARTYVVV 514          
BLAST of Nuclear RNA export factor 1 vs. UniProt/SwissProt
Match: sp|Q9UBU9|NXF1_HUMAN (Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.310e-11
Identity = 107/435 (24.60%), Postives = 190/435 (43.68%), Query Frame = 1
Query:  481 DELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQ----FRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPV---IYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII----QGGIILQESIHLFPNDSGLYQK-FRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            +EL    V+ LK  +  RY      ++  L+L     D  ++  N+ +  +        L I+++ + EL +LNLSNN +  +  + + V      K L++S N + +  EL  ++   + EL + GN     FR   T      +R+  P L  L+G +L   +A     +++  +LPP     +G ++  S   +F+  Y++ +D   R  L + Y+  +  +++I          SL  Y   S N+   KD   R   +K  +  ++      P T+H   +  VDI + T + + F V G F E+      S  +R F+RT   +     G  I+ + + +    S   Q+ F     T         S   +  LS E+ E+++ F T S MN+    + L+  + D   +++ F  L+A GEIP  AF
Sbjct:  202 NELKPEQVEQLKLIMSKRYD----GSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQST--YISAIRERFPKLLRLDGHELPPPIAF---DVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIPFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDS--LRAFTRTFIAVPASNSGLCIVNDELFVRNASSEEIQRAFAMPAPT--------PSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAF 617          
BLAST of Nuclear RNA export factor 1 vs. UniProt/SwissProt
Match: sp|Q1RMS5|NXF1_BOVIN (Nuclear RNA export factor 1 OS=Bos taurus OX=9913 GN=NXF1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.937e-11
Identity = 109/436 (25.00%), Postives = 190/436 (43.58%), Query Frame = 1
Query:  475 VPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQ----FRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPV---IYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-FGESLP-------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEF---RKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            V +EL    V+ LK  +  RY      ++  L+L     D  ++  N+ +  +        L I+++ + EL +LNLSNN +  +  L + V      K L++S N + +  EL  ++   + EL + GN     FR   T      VR+  P L  L+G +L   +A     +++  +LPP     +G +   +   +F+  Y++ +D   R  L + Y+  +  +++I F    P       Y+K  S N+   KD   R   +K  +  ++      P T+H   +  VDI + T + + F V G F E+      S  +R F+RT   +        S     ND    +   ++ D I+          S   +  LS E+ E+++ F T S MN+    + L+  + D   +++ F  L+A GEIP  AF
Sbjct:  201 VQNELKPEQVEQLKLIMSKRYD----GSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNKLYRLDDLSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNTLCDTFRDQST--YISAVRERFPKLLRLDGHELPPPIAF---DVEAPTTLPPCKGSYFGTETLKNLVLHFLQQYYAVYDSGDRQRLLDAYHDGACCSLSIPFTPQNPARSNLAEYFKD-SRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDINSFVVDISAQTSTLLCFSVNGVFKEVDGKSRDS--LRAFTRTFVAVPAS----NSGLCIVNDELFVRN--ASADEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQAFTHLKAKGEIPEVAF 618          
BLAST of Nuclear RNA export factor 1 vs. UniProt/SwissProt
Match: sp|P58797|NXF1_COTJA (Nuclear RNA export factor 1 OS=Coturnix japonica OX=93934 GN=NXF1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.590e-11
Identity = 112/482 (23.24%), Postives = 207/482 (42.95%), Query Frame = 1
Query:  352 FDKGMLEFYIK--MKKSEIEYVINNSYKIEHYRLKCYKNEEVRVP---DELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAF-VSSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQ----FRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF-----NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-FGESLP-------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQM---EFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            +D    +FY++     S ++ V       ++Y++    N     P   +EL    ++ LK  +  RY       +  L+L     D  ++  ++ +  +       VL I+++ + EL +LNLS+N +  +  L    + +  +  LD+S N + +  EL  ++   + EL + GN     FR   +      VR+  P L  L+G +L   +A     +++  +LPP       SD        F+  Y+S +D   R  L + Y+  +  +++I FG   P       Y+K  S N+   KD   R   +K  +  ++      P T+H   +  VD+ + T + + F V G F E+      S  VR F+R    +  G     +  L   +  L+ +  +T D +++         S   + +L++E+ E++  F   S MN+    + L+    D G A + F +L+  G+IP  AF
Sbjct:  151 YDHNRAQFYVEDATTASALKQVSRKITDRDNYKVVIIINSSAPPPSLQNELKPEEIEQLKVCMSKRYD----GAQRALDLKGLRVDPDLVSQSIDVVLNQRSCMMVVLRIIEENIPELQSLNLSSNKLYRLDDLAELAIKAAGLKVLDLSRNELKSERELDKVKGLKLEELWLDGNPLCDGFRDQSS--YISSVRERFPKLLRLDGHELPPPIAF---DVEAPVTLPPCKGSYFGSDDLKVLVLRFLQQYYSIYDSSDRQGLLDAYHDGACCSLSIPFGPQNPPRNTLNEYFKD-SRNVKKLKDPTMRFKLLKHTRLNVVAFLNELPRTQHDVSSFVVDVCAQTNTLLCFAVHGIFKEVDGKSRDS--VRAFTRMFIAVPAG-----NTGLCIVNDKLFVR-NATADELRKAFVMPAPTPSSSPVPSLAAEQQEMLAAFAMQSGMNLEWSQKCLQDNDWDYGRAGQVFTQLKLEGKIPEVAF 614          
BLAST of Nuclear RNA export factor 1 vs. TrEMBL
Match: A0A0N0BG26 (Nuclear RNA export factor 1 OS=Melipona quadrifasciata OX=166423 GN=WN51_13539 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.046e-20
Identity = 120/438 (27.40%), Postives = 199/438 (45.43%), Query Frame = 1
Query:  484 ELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSS-VKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQF---RKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPP-----VIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPY-------YKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG---IILQESIHLF-PNDSGLYQ-KFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTF-----SRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            E+ A   + LKQA+  RY ++  N    L+LS F+ D  +I +     F  P++   VL+I+ + + +L  LNL  N +  I +L       +K+  L I +NR++++N++ +++   + EL ++GN      KS   +   DVRK  P L  L+GM L + +    D +     +PP     V   +    +  F+  YF  FD + R+ L + Y   +  ++ +F    P+       Y   + NLY   D  +R   +K+G+  I+   +  P T H   T  +DI   T+  M+  VTG F EL   +     +R F+RT  II  G    I  E +H+  P D+ L Q   +S         +        E L  +  E V+Q  T      + MN+   L+ L+  S +  +A   F++    G+IP EAF
Sbjct:  205 EIDAKLKERLKQAMAKRY-VHATN---ALDLSRFHRDPDLISDYFCALFR-PQILKAVLDIVSEHIPDLEALNLDGNKLQIIERLSILNQKFLKLRILYIGDNRINDMNQIDTIKDLKLEELKLAGNPICNKYKSRQNDYISDVRKRFPKLLRLDGMDLPKPILF--DVVDEGNKMPPFQRMFVANAKAQQVASQFLQQYFLIFDSENREPLLDAYVEHACFSMTVFYPHNPHNSNKLNGYLMENRNLYRINDTNKRQKLLKQGRLPIVSFISEMPQTSHYLNTFTMDISLITDGIMLITVTGLFKELDKKEQP---IRYFNRTFIIIPEGSGYCIRNEQLHITQPTDAQLKQLNSQSEAQMTDPGSQTSSVSGTTEPLPVQLSEDVKQQMTMTLSQQTNMNLEWSLKCLEEVSWNYDNALSAFQEFYKRGQIPAEAF 632          
BLAST of Nuclear RNA export factor 1 vs. TrEMBL
Match: A0A3S3P2L8 (Nuclear RNA export factor 1-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_07766 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.512e-20
Identity = 137/574 (23.87%), Postives = 268/574 (46.69%), Query Frame = 1
Query:  100 KFNKRNDYNYNKPR----------FNNSYKKNSGIHINVKGFN-DINDTAPSFKWLKVTCLTHSPGCCND-IVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVP---DELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAI-AGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFG-ESLPYYKSI----SCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKF-RSTIDT-----IKEQ---MEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAFR 1719
            +FN+ N ++YNK +           NN +++    +  V  +N + N+     +W KVT + H      D +++ +  +C +     + H       D   + FY+ M +   E +   S +I +     Y     R P    +L +  ++ LK+A+  RY      N   L++S F  D  ++E  L +  +   +   ++ I+K+ + +L +LN+++N ++ +   K+   + K+ K +D+SNN++ +++E+ +L+   + +L + GN    S          VR + P +  L+   L   +    G++ K   SL   I  + +     F+  YF+ +D   R  L E Y+ ++  +  I   ++  Y+ S     S NL   +DA  +   +++GKA I+ T   FP TKH  ++  +D+   +++ +  V+ G + E+  SK    + R F R+  II   +I+ + + L        QK+ +S+++T     ++EQ   M          ++   +  +V++F   + MN    ++ L+ FS +L +A + F KL  NGEIP EAF+
Sbjct:   26 QFNRNNRFSYNKNQNRGRTVYFNNANNDFRRGGHRNNRVGRYNANRNEDDLENQWYKVT-IPHGCKSTKDFLLNSLQSMCEKPFVPFNYHN------DGQSVVFYV-MGQDTSESLKACSRRITNPNGFKYTIISSRAPFPSTQLDSSTINHLKEAMSRRYD----GNRKILDISKFRADSYLLEQGLFIPLNRTNMLIAIIRIIKENIPDLISLNIADNKLSILEPFKSITDTCKLLKAVDLSNNQIRHMSEIENLKGLELEQLLLRGNPCASSYKDHTSYISSVRAVFPKILKLDNEDLPPPIGFDVGESSKLVSSLGSHIPPETNEFVVGFINQYFAIYDSDDRQPLLEAYHDQALFSFTISSNKNQVYFPSHMFQESRNLLKVRDANSKCKLLQQGKANIVSTLCGFPKTKHELDSFLIDVYLCSQNLINIVINGVYREI--SKKNGVQTRAFCRSFLIIP-NLIINDLLFLTNATVEQIQKYGKSSMETPATNKMEEQPITMTVNGDTPTSNSMYMNKANMVKKFSEATGMNEGFSMQCLEEFSYNLETAMDAFHKLNQNGEIPAEAFQ 584          
BLAST of Nuclear RNA export factor 1 vs. TrEMBL
Match: E9IDJ4 (Uncharacterized protein (Fragment) OS=Solenopsis invicta OX=13686 GN=SINV_06310 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.050e-19
Identity = 105/369 (28.46%), Postives = 178/369 (48.24%), Query Frame = 1
Query:  466 EVRVPDELPAPWVD-----VLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITKLDI--------SNNRMSNLNELYSLQSSSIIELNISGNQF---RKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPP-----VIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAI---FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII---QGGIILQESIHLF-PNDSGLYQKF 1488
            +V+V   LP   +D      LKQA+  RY    Q   A L+LS FY D  +  +     F  P +   V++I+ + +  L  LNL  N + +I +L   V S K +KL I        S N+  N+N+L S+++  ++EL ++GN      KS   +   D+R   P L  L+G++L   +    D +  +  +PP     V+  +    +  F+  YF+ FD + R  L + Y+  ++ T+ I   F   L  Y   + NL+   D ++R   +K G+  ++   +  P TKHL  T  +DI  +T++ M+  +TG F EL +       +R F+RT  I+   +G  I  E +H+  P+++ L Q +
Sbjct:  195 QVKVQPGLPICEIDDKLKERLKQAMVKRYV---QETNA-LDLSKFYLDPELYSDYFCALFH-PIILTTVMDIVGEHIPNLEALNLEGNKMQNIERLA--VLSKKFSKLKILYIGDNKVSVNKKRNINQLDSIKNLKLVELKLTGNPVCNKYKSRQNDYVGDIRSRFPKLLRLDGIELPRPIVF--DVVDDAVKIPPSQRMFVVNAKVQEIASQFLQQYFTIFDNENRQPLLDAYDEHAYFTMTIPTSFNNKLYEYSKGNRNLFRINDRIKRQKLLKYGRLYVVSFMSQMPRTKHLLNTFTMDISLATQAMMIITITGYFQELDNKDEP---IRYFNRTFIIVPKGEGCCIRNEQLHISQPSETQLKQLY 551          
BLAST of Nuclear RNA export factor 1 vs. TrEMBL
Match: A0A4Z2DKG7 (Nuclear RNA export factor 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_000074 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.567e-19
Identity = 144/592 (24.32%), Postives = 252/592 (42.57%), Query Frame = 1
Query:  214 APSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEI----------------EYVINNSYKIEHYRLKCYKNEEVRVPD-ELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSS------VKITKLDISNNRMSNLNELYSLQS-SSIIELNISGNQFRK---SGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDT-LKSS------KSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDE-LCEFYNSESFLTVAIFGES---------------------------------LPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELP-----SSKTGSYR------VREFSRTMTIIQ-GGIILQESIHLFPNDSGLYQKFRSTIDT---IKEQMEFRKSHKDLENLSSEEIE--IVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            AP   W+++T + H  G  + ++ L   +CT       Q +  N   +   L  Y K+++ ++                  +I +   +   RL    +++   P+  LP  W++ LKQ    R+    Q     L+LS  + D  ++   L L  +   V   ++ ILKQ   +L  LNLSNN +  +       S+      V I ++D+S+N ++ +  L  L+    ++EL+++            +     + KILP +K LNG +L  TV  A +  L SS      K LP  I G   +D       +F+  Y S++D K R E L  +Y + S L  ++  E+                                    + S S NL   +D  RR D I RG   I       P T+H  E+L+VD+   + + ++F + G F E+      S  +GS        +R F+RTM ++  GG ++Q+   +    + L +K+ + + T   +  Q+  ++      +L + +I+  IV +F   + MN+P   + L  +  D  +A   F+ + + G+IPPEAF
Sbjct:   82 APGEVWVRIT-IVH--GVNHSMMDLQQLVCT---CVGHQLRFFNTCIEGRNLMMYAKIRQKDVNGYRRSLQNLRDPSQSSQLITDLTIVPEPRLPSTSDKKNESPNTSLPETWIEALKQCFVQRF----QPTTRSLDLSSLHTDPALLSQGLYLPLNKQAVVHTLITILKQNQAQLAVLNLSNNRLTHLNAFSPLSSTSVGCIPVSIERIDLSSNPLNGIPILSGLRDIVGLVELDLTETPLLSKFNPNDRSFAAKLHKILPTVKRLNGQELPHTVQFAIEQGLDSSSKRPQTKPLPQSILGYFPNDEVKVALLSFLKLYLSRYDSKPRGESLLPYYTTVSQLAFSVAPENRLSNTQSSSFTTRVEIENSSGQPTTSYLTTSRLTQAHFSRSRNLLRCRDQTRRRDMIIRGSLAIAHFLDELPSTEHQLESLSVDVAFHSATQILFTMGGVFYEVSPMNSNSVTSGSLEKSVRKVLRCFTRTMILVAPGGHVVQDDYIVSNPSTSLCKKYITEMATKCKLGNQVPNQQQPVTNSSLDAPDIKENIVLEFSQRTGMNIPFSKQCLDEYGWDTNAALSAFETMNSAGKIPPEAF 663          
BLAST of Nuclear RNA export factor 1 vs. TrEMBL
Match: A0A0K8TNF8 (Putative mrna export factor tap/mex67 (Fragment) OS=Tabanus bromius OX=304241 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.168e-18
Identity = 115/454 (25.33%), Postives = 201/454 (44.27%), Query Frame = 1
Query:  469 VRVPDELPAPWVDV-LKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSS---PRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLP----PVIYGQKDSDSFN-FMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALRRPD------NIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELP--SSKTGSYRVREFSRTMTI---IQGGIILQESIHLFP-------------NDSGLYQKFRSTIDTIKEQMEFRKSHKDLENL---SSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            ++V   LPA  +D  LK+ +K   S   + +   L+L+ F+ D      +LV  F     P +     +I+ Q +  L  LNLS N I  +   K     +   K L + NNR+ +L  + SL+   + EL ++GN  +   +     ++RK LP L  L+G ++   +   G  +    +LP      +     +D    F+  YF+ FD   R  L + Y+  +  ++ +   + P  + ++     N++ LR  +      N+K GK  I+  F+  PPT+H  +++ VD    T  F+ F VTG F EL   S+   + ++R F R+  I     G II  E +H+               N S + Q+    I    +QM       ++  +    + + ++V+     +RMN+  C + L+  + +   A E F ++ A   IPPEAF
Sbjct:  167 IKVRSSLPAVQIDDNLKEKMKAAMSKRYKEDTKALDLARFHTDP-----DLVGSFCPLFRPAIMLAAFDIMHQYIPHLEALNLSENKIHHLDHFKCIKEKLPCLKILYLENNRIQSLGAIESLRGLPLTELVLNGNPIKDRYSNTYVSEIRKRLPKLLKLDGTEIPPQI---GFDITDQTTLPTPKASFLVSTNGADIIRMFIEQYFAIFDSNNRQPLLDAYHENAMFSITV-ASAGPQNERVANFWPYNRNLLRHRETDPVDKNMKVGKMAIVNFFSELPPTRHDPQSMAVDFCLQTPLFVTFTVTGVFKELSKESNNDSNSKLRSFQRSFVIEPFGTGYIISHEMLHIASASQTQISVYSNSTNQSAMSQQVPQPI----QQMPINPQPVEVAKVVDPDAAKFQMVQALSQQTRMNLAYCQKCLEDTNWNFQVAVEAFGQMHAKNLIPPEAF 607          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Cavefish
Match: zgc:153681 (nuclear RNA export factor 1-like [Source:NCBI gene;Acc:103043711])

HSP 1 Score: 70.8626 bits (172), Expect = 2.440e-12
Identity = 83/353 (23.51%), Postives = 147/353 (41.64%), Query Frame = 1
Query:  727 IYKLKAFVSSVK----ITKLDISNNRMSNLNELYSLQSSSIIELNISGN----QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSR---TMTIIQGGIIL--QESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            +YKL  F   V     +  L++S+N + +  EL  ++   + EL +  N     F+   +      +R+  P L  L+G  L   +    +T     +     +G  +   F   F+  Y+S +D   R  L + Y+  +  +++I       F   L  Y+  S NL   KD + R   +K  +  ++      P T+H   + +VD+ + +++ + F V+G F E+      S  VR FSR    +  +  G+ L   E    F N   + + F +   T         S   +  LS+ + E++  F   S MN+    + L+    D   A + F +L+A G IP  AF
Sbjct:  300 LYKLDDFAELVNKVPNLKTLNLSHNELKSERELDKVRGFKLTELCLDRNPLCDHFKDQSS--YISAIRQRFPKLLKLDGHDLPAPIGFDIETGTIIPTCKGSYFGSDEIKEFVLGFLQQYYSVYDSGDRQSLLDAYHEGASFSLSIPMSMHNPFRSFLGDYQKDSRNLKKLKDPVARFRLLKHNRLNVVAFLNELPRTQHDTASFSVDVNTYSQTLLAFTVSGVFKEVDGKSRDS--VRAFSRVFIAVPAVNSGLCLVNDELFVRFANTEDIRRAFFAPAPT--------PSSSPVPTLSAPQQEMLSAFSQKSEMNLEWSQKCLQHSDWDFNRAVQIFTELKAQGSIPEVAF 640          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Cavefish
Match: zgc:153681 (nuclear RNA export factor 1-like [Source:NCBI gene;Acc:103043711])

HSP 1 Score: 70.4774 bits (171), Expect = 3.264e-12
Identity = 83/353 (23.51%), Postives = 147/353 (41.64%), Query Frame = 1
Query:  727 IYKLKAFVSSVK----ITKLDISNNRMSNLNELYSLQSSSIIELNISGN----QFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSF--NFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSR---TMTIIQGGIIL--QESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            +YKL  F   V     +  L++S+N + +  EL  ++   + EL +  N     F+   +      +R+  P L  L+G  L   +    +T     +     +G  +   F   F+  Y+S +D   R  L + Y+  +  +++I       F   L  Y+  S NL   KD + R   +K  +  ++      P T+H   + +VD+ + +++ + F V+G F E+      S  VR FSR    +  +  G+ L   E    F N   + + F +   T         S   +  LS+ + E++  F   S MN+    + L+    D   A + F +L+A G IP  AF
Sbjct:  291 LYKLDDFAELVNKVPNLKTLNLSHNELKSERELDKVRGFKLTELCLDRNPLCDHFKDQSS--YISAIRQRFPKLLKLDGHDLPAPIGFDIETGTIIPTCKGSYFGSDEIKEFVLGFLQQYYSVYDSGDRQSLLDAYHEGASFSLSIPMSMHNPFRSFLGDYQKDSRNLKKLKDPVARFRLLKHNRLNVVAFLNELPRTQHDTASFSVDVNTYSQTLLAFTVSGVFKEVDGKSRDS--VRAFSRVFIAVPAVNSGLCLVNDELFVRFANTEDIRRAFFAPAPT--------PSSSPVPTLSAPQQEMLSAFSQKSEMNLEWSQKCLQHSDWDFNRAVQIFTELKAQGSIPEVAF 631          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Cavefish
Match: nxf1 (nuclear RNA export factor 1-like [Source:NCBI gene;Acc:103026606])

HSP 1 Score: 68.9366 bits (167), Expect = 1.002e-11
Identity = 117/490 (23.88%), Postives = 196/490 (40.00%), Query Frame = 1
Query:  337 ACNVLFDKGMLEFYI-------KMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVK-ITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRD----VRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFN-----FMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGE-------SLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGG-----IILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            A N   D    +FYI        ++K        + YKI      C       VP +L    ++ LKQ +  R+      ++  L+L+    D  ++  N+ +  +       V+ I+ + + EL  LNLSNN +  +  L   VS V  +  L++S N +    EL  L+   + EL+++ N     G  + + D    +R+  P L  L+G  L   +    D   +   LPP       S+        F+  Y++ +D   R  L + Y+  +  ++ I          SL  Y   S NL   KD+  R   +K  +  ++      P T+H   + NVDI + T + + F V+G F E+      SY  R FSR    +  G     I+  E          + + F +   T         S   +  LS+ + E++  F   S MN+    + L+    D   A++ F  L+  G+IP  AF
Sbjct:  190 AVNYHLDGNRAQFYIDDPSTANALQKVSRRITDKDGYKITVVTNPCPPPN--FVPQDLKPEDLEHLKQCMSKRFD----GSQQALDLNNIRVDPDLVSQNIEVALNRKNSMTAVIKIIGENIPELLCLNLSNNRLYKLDDLADIVSKVPNLKSLNLSYNELKTERELDKLKGLKLAELSLANNPL--CGHFKDQADYISAIRERFPRLLKLDGHDLPPPIGF--DLEVAPAVLPPCKPSYFCSEELKSLILCFLQQYYTIYDSADRQPLLDAYHDGATFSLVIPFTMQNPSKCSLGEYLKDSRNLKRVKDSTTRFRLLKHTRLNVVAFLNELPKTQHDIASFNVDINTYTNTLLSFTVSGVFREVDGKSRDSY--RSFSRVFIAVSPGNGTLCIVNDEMFIRNATTEEIRRAFVAPAPT--------PSSSPVPTLSATQQEMLSAFSLKSGMNLEWSQKCLQDNDWDFDRAAQIFTDLKIQGKIPDVAF 659          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Nematostella
Match: EDO39114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAV5])

HSP 1 Score: 70.0922 bits (170), Expect = 2.008e-12
Identity = 112/453 (24.72%), Postives = 194/453 (42.83%), Query Frame = 1
Query:  508 VLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITK-LDISNNRMSNLNELYSLQS-SSIIELNISGNQFRKS---GTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS------FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-----------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTII--QGG---IILQESIHLFPNDSGLYQKFRS-------TIDTIKEQMEFRKSHKDL-----------ENLS-SEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLG----SASEEFKKLQANGEIPPEAF 1716
            VLK+ L  RY  NPQ     ++L+  + D+++  NN+    +   +   +L ++ +   ++ +L++SNN +  +   K   +     K L++SN  + +++EL  ++    ++ LN++GN F KS    +      VR   P +  L+G +L   +   G  L++S  LP  + G    D         F+  YF  +D   R  L + Y+ ++  ++ +            G SL  Y   S N+    +   R   IK  +  ++    +FP TKH   +  VDI  +  + + F V G F+E    KT     R F+R    +   GG    I+ + +H+    S   +K  S       T +     M    S   L           +NL+  ++ ++V QF   S+MN        K  S+ G     ++E F  LQA G IPP+AF
Sbjct:  261 VLKECLSNRY--NPQTKT--MDLTDMFHDEVLKANNVFGALNKYPLAQEILKLIGENCPDVESLDVSNNRLFQLDHFKDLATQAPGIKCLNLSNTMLKSIDELDKVKGLKELVTLNLTGNTFCKSFEGKSSAYVSAVRSRFPKVTNLDGNELPPPI---GFDLQTSTVLP-TVQGSYIPDPAVKDLVLKFLEQYFKIYDSGDRQPLLDAYHDQAIFSMCVDTQANSSTKGSRGPSLGPYMRNSRNMKRVTETDHRAALIKHNRLSVVAMLNDFPGTKHDLASFVVDINLTLSTIISFSVRGLFME--EDKT----ARSFTRVFVAVPAAGGKALSIINDELHIRNASSSQAEKLASAASASIITPNVGSGIMAPAPSATPLPAATTVPAAGMQNLTPQQQQQMVLQFSNQSQMNPEWS---FKCLSENGWNYEKSAEIFTSLQAAGSIPPDAF 696          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Medaka
Match: zgc:153681 (nuclear RNA export factor 1 [Source:NCBI gene;Acc:101172252])

HSP 1 Score: 66.2402 bits (160), Expect = 8.523e-11
Identity = 102/428 (23.83%), Postives = 181/428 (42.29%), Query Frame = 1
Query:  502 VDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVK-ITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-----------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQM---EFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            ++ LKQ +  R+      ++  L+L+    D  ++  N+ +  +       V+ I+++ + ELT LNLSNN I  + +L   VS V  +  L++S+N +    EL  L+   ++EL ++ N        +      VR+  P L  L+G  L   +   G  +++  ++PP       SD        F+  Y+S +D   R  L + Y+  + L++              GE   YYK  S NL   KD   R   +K  +  ++      P T+H   +  +D+ + T + + F + G F E+            FSR    +  G     S     ND  L+ +  +T + I+          S   +  L++ + E++  F   S MN+    + L+    D   A+  F +L+A G+IP  AF
Sbjct:  226 LEYLKQCMAKRFD----GSQQALDLNNIRTDPDLVSQNIEVILNRKTSMEAVIKIIEENIPELTCLNLSNNRIHKLDELAELVSKVPNLKTLNLSHNELKTDRELDKLKGLKLVELWLNRNPLCALFKDQAAYISAVRQRFPRLLKLDGQDLPPPI---GFDVETPTAIPPCKGSCFGSDEIKVIILRFLQQYYSIYDSGNRQPLLDAYHDGASLSITTPYSTQNPSRSSLGE---YYKD-SRNLKRIKDTTMRFRLLKHTRLNVVAFLNELPKTQHDIASFVIDVNTCTNTLLSFTIGGVFKEVVVDGKSRESTMAFSRVFITVPAG----NSGLCIVNDQ-LFIRM-ATTEEIRRAFVAPAPTPSSSPVPTLTAPQQEMLTAFSQESGMNLEWSQKCLQDNEWDFNRAAHIFTQLKAEGKIPDVAF 636          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Medaka
Match: zgc:153681 (nuclear RNA export factor 1 [Source:NCBI gene;Acc:101172252])

HSP 1 Score: 65.4698 bits (158), Expect = 1.181e-10
Identity = 102/428 (23.83%), Postives = 181/428 (42.29%), Query Frame = 1
Query:  502 VDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVK-ITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-----------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQM---EFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            ++ LKQ +  R+      ++  L+L+    D  ++  N+ +  +       V+ I+++ + ELT LNLSNN I  + +L   VS V  +  L++S+N +    EL  L+   ++EL ++ N        +      VR+  P L  L+G  L   +   G  +++  ++PP       SD        F+  Y+S +D   R  L + Y+  + L++              GE   YYK  S NL   KD   R   +K  +  ++      P T+H   +  +D+ + T + + F + G F E+            FSR    +  G     S     ND  L+ +  +T + I+          S   +  L++ + E++  F   S MN+    + L+    D   A+  F +L+A G+IP  AF
Sbjct:  217 LEYLKQCMAKRFD----GSQQALDLNNIRTDPDLVSQNIEVILNRKTSMEAVIKIIEENIPELTCLNLSNNRIHKLDELAELVSKVPNLKTLNLSHNELKTDRELDKLKGLKLVELWLNRNPLCALFKDQAAYISAVRQRFPRLLKLDGQDLPPPI---GFDVETPTAIPPCKGSCFGSDEIKVIILRFLQQYYSIYDSGNRQPLLDAYHDGASLSITTPYSTQNPSRSSLGE---YYKD-SRNLKRIKDTTMRFRLLKHTRLNVVAFLNELPKTQHDIASFVIDVNTCTNTLLSFTIGGVFKEVVVDGKSRESTMAFSRVFITVPAG----NSGLCIVNDQ-LFIRM-ATTEEIRRAFVAPAPTPSSSPVPTLTAPQQEMLTAFSQESGMNLEWSQKCLQDNEWDFNRAAHIFTQLKAEGKIPDVAF 627          
BLAST of Nuclear RNA export factor 1 vs. Ensembl Medaka
Match: zgc:153681 (nuclear RNA export factor 1 [Source:NCBI gene;Acc:101172252])

HSP 1 Score: 65.4698 bits (158), Expect = 1.269e-10
Identity = 102/428 (23.83%), Postives = 181/428 (42.29%), Query Frame = 1
Query:  502 VDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVK-ITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELK--RDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDS-----FNFMLNYFSKFDGKTRDELCEFYNSESFLTVAI-----------FGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQM---EFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            ++ LKQ +  R+      ++  L+L+    D  ++  N+ +  +       V+ I+++ + ELT LNLSNN I  + +L   VS V  +  L++S+N +    EL  L+   ++EL ++ N        +      VR+  P L  L+G  L   +   G  +++  ++PP       SD        F+  Y+S +D   R  L + Y+  + L++              GE   YYK  S NL   KD   R   +K  +  ++      P T+H   +  +D+ + T + + F + G F E+            FSR    +  G     S     ND  L+ +  +T + I+          S   +  L++ + E++  F   S MN+    + L+    D   A+  F +L+A G+IP  AF
Sbjct:  253 LEYLKQCMAKRFD----GSQQALDLNNIRTDPDLVSQNIEVILNRKTSMEAVIKIIEENIPELTCLNLSNNRIHKLDELAELVSKVPNLKTLNLSHNELKTDRELDKLKGLKLVELWLNRNPLCALFKDQAAYISAVRQRFPRLLKLDGQDLPPPI---GFDVETPTAIPPCKGSCFGSDEIKVIILRFLQQYYSIYDSGNRQPLLDAYHDGASLSITTPYSTQNPSRSSLGE---YYKD-SRNLKRIKDTTMRFRLLKHTRLNVVAFLNELPKTQHDIASFVIDVNTCTNTLLSFTIGGVFKEVVVDGKSRESTMAFSRVFITVPAG----NSGLCIVNDQ-LFIRM-ATTEEIRRAFVAPAPTPSSSPVPTLTAPQQEMLTAFSQESGMNLEWSQKCLQDNEWDFNRAAHIFTQLKAEGKIPDVAF 663          
BLAST of Nuclear RNA export factor 1 vs. Planmine SMEST
Match: SMESG000044253.1 (SMESG000044253.1)

HSP 1 Score: 1076.23 bits (2782), Expect = 0.000e+0
Identity = 537/541 (99.26%), Postives = 539/541 (99.63%), Query Frame = 1
Query:  103 FNKRNDYNYNKPRFNNSYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLGSASEEFKKLQANGEIPPEAFRDE 1725
            + +RNDYNYNKPRFNNSYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQELNELTNLNLSNNNIASIYKLKAFVSSVKITKLDISNNRMSNLNELYSLQ SSIIELNISGNQFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLGSASEEFKKLQANGEIPPEAFRDE
Sbjct:  202 YARRNDYNYNKPRFNNSYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQELNELTNLNLSNNNIASIYKLKAFVSSVKITKLDISNNRMSNLNELYSLQESSIIELNISGNQFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLGSASEEFKKLQANGEIPPEAFRDE 742          
BLAST of Nuclear RNA export factor 1 vs. Planmine SMEST
Match: SMESG000055230.1 (SMESG000055230.1)

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 502/531 (94.54%), Postives = 511/531 (96.23%), Query Frame = 1
Query:  112 RNDYNYNKPRFNNSYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQEXXXXXXXXXXXXXIASIYKLKAFVSSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLGSASEEFKKLQANGEIP 1704
            RNDYNYNKPRFNNSYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQELNELT+LNLSNNNI SI KLKAFVSSVKITKLDISNNRMSNLNELYSLQ SSIIELNISGNQFRK GTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIY  KDSD+F F+LNYFSKFDGKTRDELCEFYNSES L V+ FGESLPYYKSISCN YT+KDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFM+ +VTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLK  SDLGSASEEFK  +   + P
Sbjct:   67 RNDYNYNKPRFNNSYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDLCTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLKCYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQELNELTSLNLSNNNITSINKLKAFVSSVKITKLDISNNRMSNLNELYSLQGSSIIELNISGNQFRKRGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYAPKDSDAFKFVLNYFSKFDGKTRDELCEFYNSESILIVSTFGESLPYYKSISCNFYTDKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMILIVTGTFVELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKSLSDLGSASEEFKNFKPMEKFP 597          
BLAST of Nuclear RNA export factor 1 vs. Planmine SMEST
Match: SMESG000067001.1 (SMESG000067001.1)

HSP 1 Score: 127.487 bits (319), Expect = 1.824e-30
Identity = 144/463 (31.10%), Postives = 207/463 (44.71%), Query Frame = 1
Query:  463 EEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKIVIENNLVLQFSSPRVFGCVLNILKQ-EXXXXXXXXXXXXXIASIYKLKAFVSSVKITKLDISNNRMSNLNELYSLQSSSIIE----LN---ISGNQFRKSGTQELKRDVRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFNFMLNYFSKFDGK---TRDELCEFYNSESFLTVAIFGESLP--------YYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVE-------------------------LPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFS-DLGSASEEFKKLQANGEIPPEAF 1716
            E+   P  LP  W++ LK AL  RY     N    LNLS F ED  +    L +    P +   + N+L   +   L NL+LS+NNI+    L     +V I  +DIS N +   N   SLQS+S +     LN   + G + R     E   ++ +  P ++  N   L+ T  + G +L+       +I     SDS   +LN+F +   K    RD+L  +Y+S+S  T++     +          Y   S NL   KD  RR   IKRG AQILG  +  P  KH+ E+  +D I + +   MFVV G FVE                         + SS    + VR FSR+M +I  G ILQE+  +      L++KFR   D IK      K  K  E  S+ ++ I+ QF  FS MN     + L+    ++  A E F+    NG+IP EAF
Sbjct:  142 EQPETPSILPESWINNLKNALSLRYI----NETKTLNLSKFAEDSHLNHLGLWMPLCRPAIVKAISNLLLTIDNLVLNNLDLSDNNISFTSHLIPLFEAVPILHIDISGNCLIAKNLFKSLQSASYLNSLTILNDNGVCGQKIRYRS--EFITELLENCPSIEKFNNENLK-TGIVGGASLQRLPVTKKII-----SDSDQLLLNFFIEHCQKLETNRDDLLNYYSSDSVWTLSACYHDMSSNNRRLSEVYLRNSRNLERLKDESRRNQLIKRGSAQILGLLSELPKIKHIPESFVLDAIVNNDHSKMFVVCGLFVECIKIHKRSNNNNIISNSNNKNSDETIGSSTHNIFNVRMFSRSMLVIAPGKILQENWTISNPTDFLFRKFREKFDAIKITFNKDKLLKIEETKSNTDL-IIEQFCQFSNMNSVYSQQCLQESDWNVEKAKEVFQMAFNNGKIPREAF 591          
BLAST of Nuclear RNA export factor 1 vs. Planmine SMEST
Match: SMESG000055147.1 (SMESG000055147.1)

HSP 1 Score: 112.849 bits (281), Expect = 2.207e-27
Identity = 72/243 (29.63%), Postives = 122/243 (50.21%), Query Frame = 1
Query:  991 KSLPPVIYGQKDSDSFNFMLNYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSY-RVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLGSASEEFKKLQANGEIPPEAF 1716
            KSLP  IY         F+L++F   D K ++ L E+YN +S  T+A  G     + S SCN  T +D  +R  N K G  QI+    +FP TKHL ++L + +++S   F +  V G F+E    K+  + ++ +FSRT+ II  GIIL++ + + P     +              E+ K  +  E+ S    +I+  F+ ++++ +  C  FL+ F  L ++  EF  +++ G +P   F
Sbjct:    8 KSLPDGIY--------EFLLDFFGCMDSKMKENLNEYYNEQSVFTMAFCGPQSSSHVSNSCNFMTLRDPSKRVANAKVGANQIVEYLIDFPVTKHLRKSLKIHLVASNSKFTIITVHGHFIE----KSIEFCKITQFSRTL-IISAGIILEDFLQILPIKFAYFD-------------EYVKKAELYESYSLAGAQILNTFQRYTKLKIKYCAEFLQKFLTLEASIAEFNSMKSKGSLPNHVF 224          
BLAST of Nuclear RNA export factor 1 vs. Planmine SMEST
Match: SMESG000055148.1 (SMESG000055148.1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.845e-15
Identity = 48/179 (26.82%), Postives = 89/179 (49.72%), Query Frame = 1
Query: 1183 TNKDALRRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTFVELPSSKTGSY-RVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTIDTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSDLGSASEEFKKLQANGEIPPEAF 1716
            T +D  +R  N K G  QI+    +FP TKHL ++L + +++S   F +  V G F+E    K+  + ++ +FSRT+ II  GIIL++ + + P     +              E+ K  +  E+ S    +I+  F+ ++++ +  C  FL+ F  L ++  EF  +++ G +    F
Sbjct:    2 TLRDPSKRVANAKVGANQIVEYLIDFPVTKHLRKSLKIHLVASNSKFTIITVHGHFIE----KSIEFCKITQFSRTL-IISAGIILEDFLQILPIKFAYFD-------------EYVKKAELYESYSLAGAQILNTFQRYTKLKIKYCAEFLQKFLTLEASIAEFNSMKSKGSLSNHVF 162          
The following BLAST results are available for this feature:
BLAST of Nuclear RNA export factor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NXF2B1.531e-1325.29nuclear RNA export factor 2B [Source:HGNC Symbol;A... [more]
NXF2B1.531e-1325.29nuclear RNA export factor 2B [Source:HGNC Symbol;A... [more]
NXF21.531e-1325.29nuclear RNA export factor 2 [Source:HGNC Symbol;Ac... [more]
NXF21.531e-1325.29nuclear RNA export factor 2 [Source:HGNC Symbol;Ac... [more]
NXF12.729e-1224.60nuclear RNA export factor 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nxf-12.600e-1123.20Nuclear RNA export factor 1 [Source:UniProtKB/TrE... [more]
nxf-24.286e-924.57Nuclear RNA export factor 2 [Source:UniProtKB/Swi... [more]
nxf-24.286e-924.57Nuclear RNA export factor 2 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sbr3.615e-1325.89gene:FBgn0003321 transcript:FBtr0473368[more]
sbr3.615e-1325.89gene:FBgn0003321 transcript:FBtr0473367[more]
sbr5.895e-1325.75gene:FBgn0003321 transcript:FBtr0073411[more]
Nxf34.335e-626.36gene:FBgn0263232 transcript:FBtr0333073[more]
Nxf34.335e-626.36gene:FBgn0263232 transcript:FBtr0345389[more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nxf13.198e-1023.29nuclear RNA export factor 1 [Source:ZFIN;Acc:ZDB-G... [more]
zgc:1536814.847e-622.98zgc:153681 [Source:ZFIN;Acc:ZDB-GENE-060825-299][more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nxph12.371e-1023.90neurexophilin 1 [Source:Xenbase;Acc:XB-GENE-580839... [more]
selenoi1.554e-822.67selenoprotein I [Source:Xenbase;Acc:XB-GENE-991194... [more]
selenoi2.059e-822.67selenoprotein I [Source:Xenbase;Acc:XB-GENE-991194... [more]
nxph13.585e-824.07neurexophilin 1 [Source:Xenbase;Acc:XB-GENE-580839... [more]
nxph14.282e-824.07neurexophilin 1 [Source:Xenbase;Acc:XB-GENE-580839... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nxf14.242e-922.76nuclear RNA export factor 1 [Source:MGI Symbol;Acc... [more]
Nxf21.375e-625.10nuclear RNA export factor 2 [Source:MGI Symbol;Acc... [more]
Nxf29.352e-626.86nuclear RNA export factor 2 [Source:MGI Symbol;Acc... [more]
Nxf29.684e-626.86nuclear RNA export factor 2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GZY0|NXF2_HUMAN7.352e-1325.29Nuclear RNA export factor 2 OS=Homo sapiens OX=960... [more]
sp|Q9U1H9|NXF1_DROME5.909e-1225.75Nuclear RNA export factor 1 OS=Drosophila melanoga... [more]
sp|Q9UBU9|NXF1_HUMAN1.310e-1124.60Nuclear RNA export factor 1 OS=Homo sapiens OX=960... [more]
sp|Q1RMS5|NXF1_BOVIN1.937e-1125.00Nuclear RNA export factor 1 OS=Bos taurus OX=9913 ... [more]
sp|P58797|NXF1_COTJA3.590e-1123.24Nuclear RNA export factor 1 OS=Coturnix japonica O... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N0BG261.046e-2027.40Nuclear RNA export factor 1 OS=Melipona quadrifasc... [more]
A0A3S3P2L81.512e-2023.87Nuclear RNA export factor 1-like protein OS=Dinoth... [more]
E9IDJ41.050e-1928.46Uncharacterized protein (Fragment) OS=Solenopsis i... [more]
A0A4Z2DKG71.567e-1924.32Nuclear RNA export factor 1 OS=Schistosoma japonic... [more]
A0A0K8TNF81.168e-1825.33Putative mrna export factor tap/mex67 (Fragment) O... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1536812.440e-1223.51nuclear RNA export factor 1-like [Source:NCBI gene... [more]
zgc:1536813.264e-1223.51nuclear RNA export factor 1-like [Source:NCBI gene... [more]
nxf11.002e-1123.88nuclear RNA export factor 1-like [Source:NCBI gene... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO391142.008e-1224.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1536818.523e-1123.83nuclear RNA export factor 1 [Source:NCBI gene;Acc:... [more]
zgc:1536811.181e-1023.83nuclear RNA export factor 1 [Source:NCBI gene;Acc:... [more]
zgc:1536811.269e-1023.83nuclear RNA export factor 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Nuclear RNA export factor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044253.10.000e+099.26SMESG000044253.1[more]
SMESG000055230.10.000e+094.54SMESG000055230.1[more]
SMESG000067001.11.824e-3031.10SMESG000067001.1[more]
SMESG000055147.12.207e-2729.63SMESG000055147.1[more]
SMESG000055148.11.845e-1526.82SMESG000055148.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035246 ID=SMED30035246|Name=Nuclear RNA export factor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2152bp
TTTTGTATAATAATTCATACTAAAATATTTTTTTTAATAATCATTTGTAA
TATTTGTTTATATAATTTATTAATTTATCTTTTCAAATTTGTTATGCCTA
AATTTAATAAAAGAAACGATTATAACTATAATAAACCAAGATTTAATAAT
TCCTACAAAAAGAATAGTGGCATACATATTAATGTAAAAGGATTTAATGA
CATTAATGATACGGCACCTTCATTTAAATGGCTTAAAGTTACTTGTTTGA
CACATTCTCCAGGTTGTTGCAATGATATAGTATCTCTTATCGATGATTTA
TGTACCAGAAATAGTGGTAGAACTTCACAGCATAAGGCTTGTAATGTATT
ATTTGATAAAGGAATGCTCGAATTTTATATAAAAATGAAAAAGTCCGAAA
TAGAATATGTCATTAACAATTCGTATAAAATCGAGCATTATAGATTGAAA
TGCTATAAGAATGAAGAAGTACGTGTCCCAGATGAGCTTCCAGCTCCTTG
GGTAGATGTTTTAAAACAAGCTCTTAAAACTCGTTATAGTATTAATCCAC
AAAATAATGAAGCAGAATTAAATTTATCTTATTTTTACGAAGATAAAATT
GTAATTGAAAACAATCTTGTTCTCCAGTTTTCATCGCCTCGGGTTTTTGG
ATGTGTTTTGAATATTCTGAAGCAAGAATTAAACGAGTTGACAAATTTAA
ATCTTAGTAATAACAATATTGCAAGCATATACAAATTGAAAGCATTTGTT
AGTTCTGTGAAAATTACAAAACTCGATATTAGTAATAACAGAATGAGTAA
TTTGAATGAATTATATAGCCTCCAAAGTAGCTCGATAATAGAATTAAACA
TTTCTGGCAATCAGTTTAGAAAAAGTGGTACTCAAGAATTAAAAAGAGAT
GTCAGAAAAATACTGCCACATCTGAAATGTTTGAATGGGATGAAATTGGA
GGAGACTGTCGCGATTGCTGGAGATACATTAAAGTCATCGAAATCATTGC
CACCGGTTATTTATGGACAAAAAGATAGTGATTCTTTCAACTTCATGCTG
AATTATTTCTCTAAATTTGATGGGAAAACAAGAGATGAGTTATGCGAGTT
TTATAATTCCGAATCATTTTTAACTGTTGCTATATTTGGAGAGTCTTTAC
CTTATTATAAATCGATTAGCTGTAATTTATATACTAATAAAGACGCGTTA
AGAAGACCAGATAATATCAAACGAGGAAAAGCCCAAATTCTTGGAACCTT
TGCCAATTTTCCACCAACGAAACATTTGGAAGAAACTCTAAATGTTGACA
TTATCAGCTCAACTGAATCATTCATGATGTTTGTTGTAACAGGAACATTT
GTTGAATTGCCTTCAAGCAAAACTGGTTCGTATAGAGTTCGAGAATTCAG
TCGAACTATGACAATTATCCAAGGGGGGATTATACTCCAGGAATCCATAC
ATTTATTTCCAAATGATTCCGGCCTTTATCAAAAGTTTCGATCGACTATT
GATACGATTAAAGAGCAAATGGAATTTAGAAAATCTCACAAAGACCTAGA
AAACCTATCAAGTGAAGAAATTGAAATTGTGCGACAATTCAAAACATTTA
GCCGTATGAATGTGCCGACTTGCTTGAGGTTTCTCAAATTGTTCAGTGAT
CTTGGATCAGCTTCCGAGGAGTTCAAAAAACTTCAAGCCAATGGAGAAAT
TCCCCCTGAAGCATTTAGAGATGAATGATTTGAGTAAATACATTTATGAG
TGTCGATTTCTGTATATTTTTCGCTAATTTTGTATTTGAAATTTTCCCTA
TCAATGTTATAAAATTAAGGTTAGTATGTTGGATGTCTATTTTTAATTAT
GAGCTATTATTTCATTCTCTTTTCTGATTGGTCGGTTATGAGTGCATTGT
GTATGAATTCATTAAATTTTGTTTAGTTTGTATTTATTGACATACATCTG
ATTTTTAATTGCGTATTTAAGGAGTTTCTCAGACTTAATTTTTTCATGAA
AATTATAACTTTTAAAACTATTAGCATAAGTTATGCATTTCTAGGCTTTT
AAATAAACAATGATAACATTGAAGTGTTTTCGGTTGCTTTTGGGCCGAGT
AATTTTCCACATACATTTAAAGTGTATTATTTTATTTTAGACATAAGTGA
GA
back to top

protein sequence of SMED30035246-orf-1

>SMED30035246-orf-1 ID=SMED30035246-orf-1|Name=SMED30035246-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
FCIIIHTKIFFLIIICNICLYNLLIYLFKFVMPKFNKRNDYNYNKPRFNN
SYKKNSGIHINVKGFNDINDTAPSFKWLKVTCLTHSPGCCNDIVSLIDDL
CTRNSGRTSQHKACNVLFDKGMLEFYIKMKKSEIEYVINNSYKIEHYRLK
CYKNEEVRVPDELPAPWVDVLKQALKTRYSINPQNNEAELNLSYFYEDKI
VIENNLVLQFSSPRVFGCVLNILKQELNELTNLNLSNNNIASIYKLKAFV
SSVKITKLDISNNRMSNLNELYSLQSSSIIELNISGNQFRKSGTQELKRD
VRKILPHLKCLNGMKLEETVAIAGDTLKSSKSLPPVIYGQKDSDSFNFML
NYFSKFDGKTRDELCEFYNSESFLTVAIFGESLPYYKSISCNLYTNKDAL
RRPDNIKRGKAQILGTFANFPPTKHLEETLNVDIISSTESFMMFVVTGTF
VELPSSKTGSYRVREFSRTMTIIQGGIILQESIHLFPNDSGLYQKFRSTI
DTIKEQMEFRKSHKDLENLSSEEIEIVRQFKTFSRMNVPTCLRFLKLFSD
LGSASEEFKKLQANGEIPPEAFRDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
GO:0005622intracellular
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR032710NTF2-like_dom_sf
IPR005637TAP_C_dom
IPR018222Nuclear_transport_factor_2_euk
IPR001611Leu-rich_rpt
Vocabulary: biological process
TermDefinition
GO:0051028mRNA transport
GO:0006406mRNA export from nucleus
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0003723RNA binding