SMED30035231

Overview
NameSMED30035231
Smed IDSMED30035231
Length (bp)2240
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035231 (SMED30035231) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035231 (SMED30035231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035231 (SMED30035231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035231 (SMED30035231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30035231 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 59.3066 bits (142), Expect = 9.715e-18
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = -1
Query:  258 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL--NKQEIFSKTMSVKQKELLASYKVSYRIA 542
            KYD  YLS GFTY          C+LC   L++ S+ P+KL+R LE  HA +  K   FF++ L++   NK        +  +    ASY VSY IA
Sbjct:  109 KYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIA 205          

HSP 2 Score: 51.9878 bits (123), Expect = 9.715e-18
Identity = 25/73 (34.25%), Postives = 48/73 (65.75%), Query Frame = -2
Query:   26 HSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLS-SFALQVDEATAV 241
            H+IGE L+   A D++  M  E Y+ ++  + L+++TV  RI D++ D+ ++L+ ++K+   F+LQ+DE+  V
Sbjct:  211 HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADV 283          
BLAST of SMED30035231 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 59.3066 bits (142), Expect = 9.715e-18
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = -1
Query:  258 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL--NKQEIFSKTMSVKQKELLASYKVSYRIA 542
            KYD  YLS GFTY          C+LC   L++ S+ P+KL+R LE  HA +  K   FF++ L++   NK        +  +    ASY VSY IA
Sbjct:  109 KYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIA 205          

HSP 2 Score: 51.9878 bits (123), Expect = 9.715e-18
Identity = 25/73 (34.25%), Postives = 48/73 (65.75%), Query Frame = -2
Query:   26 HSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLS-SFALQVDEATAV 241
            H+IGE L+   A D++  M  E Y+ ++  + L+++TV  RI D++ D+ ++L+ ++K+   F+LQ+DE+  V
Sbjct:  211 HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADV 283          
BLAST of SMED30035231 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 76.6406 bits (187), Expect = 1.302e-13
Identity = 43/103 (41.75%), Postives = 65/103 (63.11%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQE-RPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQ--EIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYDP Y+  GF   VI+G+  +P C++C + LA+++MKP+KLKR L   H +   + +EFF+RK   L  Q  ++F+ +  +    L ASYKV+  +AK KTP
Sbjct:  736 KYDPSYIEFGFV-AVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVS-HINISALRASYKVALPVAKSKTP 836          

HSP 2 Score: 61.6178 bits (148), Expect = 5.492e-9
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = -2
Query:   26 KFLIELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEATAV 277
            K  + +  +K P++I ETLV     ++   MLGES A ++  +PL+++T+  RI +++ D+ DQLIE++KL+  F+LQ+DE   +
Sbjct:  825 KVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDI 909          
BLAST of SMED30035231 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 76.6406 bits (187), Expect = 1.316e-13
Identity = 43/103 (41.75%), Postives = 65/103 (63.11%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQE-RPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQ--EIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYDP Y+  GF   VI+G+  +P C++C + LA+++MKP+KLKR L   H +   + +EFF+RK   L  Q  ++F+ +  +    L ASYKV+  +AK KTP
Sbjct:  585 KYDPSYIEFGFV-AVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVS-HINISALRASYKVALPVAKSKTP 685          

HSP 2 Score: 61.2326 bits (147), Expect = 6.009e-9
Identity = 32/82 (39.02%), Postives = 55/82 (67.07%), Query Frame = -2
Query:   35 KFLIELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEA 277
            K  + +  +K P++I ETLV     ++   MLGES A ++  +PL+++T+  RI +++ D+ DQLIE++KL+  F+LQ+DE 
Sbjct:  674 KVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDEC 755          
BLAST of SMED30035231 vs. Ensembl Human
Match: FAM200B (family with sequence similarity 200 member B [Source:HGNC Symbol;Acc:HGNC:27740])

HSP 1 Score: 74.3294 bits (181), Expect = 4.952e-13
Identity = 42/100 (42.00%), Postives = 65/100 (65.00%), Query Frame = -1
Query:  249 KYDPMYLSLGFTY-KVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLN-KQEIFSKTMSVKQKELLASYKVSYRIAKCK 542
            +Y+  YL  GF   +     +RP C++C N LA++S+KP+KLKR LE  HA+ + K  E+FQRK +++    +  S + +V +K LL+SY V+YR+AK K
Sbjct:   62 RYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEK 161          
BLAST of SMED30035231 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 65.4698 bits (158), Expect = 2.911e-16
Identity = 32/72 (44.44%), Postives = 51/72 (70.83%), Query Frame = -2
Query:   32 PHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEAT 244
            P SI E L+    ++M   +LG S  +++K IPL+++T+G RI  +S+D+ DQL++KV+ S  FALQVDE++
Sbjct:  677 PFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESS 748          

HSP 2 Score: 40.4318 bits (93), Expect = 2.911e-16
Identity = 30/105 (28.57%), Postives = 51/105 (48.57%), Query Frame = -1
Query:  234 YDPMYLSLGFTY--KVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRK-LENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTPPFN 539
            Y+  Y+  GF            P C++C   L S+S+ P  L   L+  H+D   K  +FF+ K LE   +     K + V++  + ASY ++++IA  +  PF+
Sbjct:  576 YNAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEESLVKASYLIAFQIAA-RNKPFS 679          
BLAST of SMED30035231 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 65.0846 bits (157), Expect = 3.423e-16
Identity = 32/72 (44.44%), Postives = 51/72 (70.83%), Query Frame = -2
Query:   32 PHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEAT 244
            P SI E L+    ++M   +LG S  +++K IPL+++T+G RI  +S+D+ DQL++KV+ S  FALQVDE++
Sbjct:  769 PFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESS 840          

HSP 2 Score: 40.4318 bits (93), Expect = 3.423e-16
Identity = 25/81 (30.86%), Postives = 44/81 (54.32%), Query Frame = -1
Query:  234 CLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRK-LENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTPPFN 473
            C++C   L S+S+ P  L   L+  H+D   K  +FF+ K LE   +     K + V++  + ASY ++++IA  +  PF+
Sbjct:  692 CVICGEVLPSESVMPVSLSNHLKAKHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEESLVKASYLIAFQIAA-RNKPFS 771          
BLAST of SMED30035231 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 72.4034 bits (176), Expect = 1.336e-12
Identity = 40/102 (39.22%), Postives = 57/102 (55.88%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEIFSKTMSVKQK--ELLASYKVSYRIAKCKTP 542
            KY+  +L  GFT  +  G ERP C++C   L+++SMKPNKLKR  E  H+   GK   +F+ K + L K    + + S KQ    +  SY V+ RIA+   P
Sbjct:  168 KYNEGFLQYGFTSTITVGIERPQCVICGVVLSAESMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSNKQNVAAVETSYLVALRIARDMKP 269          

HSP 2 Score: 55.0694 bits (131), Expect = 2.812e-7
Identity = 31/99 (31.31%), Postives = 58/99 (58.59%), Query Frame = -2
Query:   26 NKKNCLR-HIKFLIELLNAK--HPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSF---ALQVDEATAV 304
            NK+N       +L+ L  A+   PH+  E L+   A D +  M+G+ +  +L  + L+++TV  RI D+S D+ DQ+++++K +     ++Q+DE+T V
Sbjct:  246 NKQNVAAVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDESTDV 344          
BLAST of SMED30035231 vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 4.278e-17
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = -1
Query:  258 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL--NKQEIFSKTMSVKQKELLASYKVSYRIA 542
            KYD  YLS GFTY          C+LC   L++ S+ P+KL+R LE  HA +  K   FF++ L++   NK        +  +    ASY VSY IA
Sbjct:  109 KYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIA 205          

HSP 2 Score: 51.9878 bits (123), Expect = 4.278e-17
Identity = 25/73 (34.25%), Postives = 48/73 (65.75%), Query Frame = -2
Query:   26 HSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLS-SFALQVDEATAV 241
            H+IGE L+   A D++  M  E Y+ ++  + L+++TV  RI D++ D+ ++L+ ++K+   F+LQ+DE+  V
Sbjct:  211 HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADV 283          
BLAST of SMED30035231 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.384e-17
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = -1
Query:  258 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL--NKQEIFSKTMSVKQKELLASYKVSYRIA 542
            KYD  YLS GFTY          C+LC   L++ S+ P+KL+R LE  HA +  K   FF++ L++   NK        +  +    ASY VSY IA
Sbjct:  110 KYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIA 206          

HSP 2 Score: 51.9878 bits (123), Expect = 4.384e-17
Identity = 25/73 (34.25%), Postives = 48/73 (65.75%), Query Frame = -2
Query:   26 HSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLS-SFALQVDEATAV 241
            H+IGE L+   A D++  M  E Y+ ++  + L+++TV  RI D++ D+ ++L+ ++K+   F+LQ+DE+  V
Sbjct:  212 HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADV 284          
BLAST of SMED30035231 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.456e-17
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = -1
Query:  258 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL--NKQEIFSKTMSVKQKELLASYKVSYRIA 542
            KYD  YLS GFTY          C+LC   L++ S+ P+KL+R LE  HA +  K   FF++ L++   NK        +  +    ASY VSY IA
Sbjct:  110 KYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIA 206          

HSP 2 Score: 51.9878 bits (123), Expect = 4.456e-17
Identity = 25/73 (34.25%), Postives = 48/73 (65.75%), Query Frame = -2
Query:   26 HSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLS-SFALQVDEATAV 241
            H+IGE L+   A D++  M  E Y+ ++  + L+++TV  RI D++ D+ ++L+ ++K+   F+LQ+DE+  V
Sbjct:  212 HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADV 284          
BLAST of SMED30035231 vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 6.252e-13
Identity = 43/103 (41.75%), Postives = 65/103 (63.11%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQE-RPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQ--EIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYDP Y+  GF   VI+G+  +P C++C + LA+++MKP+KLKR L   H +   + +EFF+RK   L  Q  ++F+ +  +    L ASYKV+  +AK KTP
Sbjct:  736 KYDPSYIEFGFV-AVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKEISSQPKEFFERKSSELKSQPKQVFNVS-HINISALRASYKVALPVAKSKTP 836          

HSP 2 Score: 61.6178 bits (148), Expect = 2.637e-8
Identity = 32/85 (37.65%), Postives = 56/85 (65.88%), Query Frame = -2
Query:   26 KFLIELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEATAV 277
            K  + +  +K P++I ETLV     ++   MLGES A ++  +PL+++T+  RI +++ D+ DQLIE++KL+  F+LQ+DE   +
Sbjct:  825 KVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDI 909          
BLAST of SMED30035231 vs. UniProt/SwissProt
Match: sp|P0CF97|F200B_HUMAN (Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.378e-12
Identity = 42/100 (42.00%), Postives = 65/100 (65.00%), Query Frame = -1
Query:  249 KYDPMYLSLGFTY-KVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLN-KQEIFSKTMSVKQKELLASYKVSYRIAKCK 542
            +Y+  YL  GF   +     +RP C++C N LA++S+KP+KLKR LE  HA+ + K  E+FQRK +++    +  S + +V +K LL+SY V+YR+AK K
Sbjct:   62 RYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLEYFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEK 161          
BLAST of SMED30035231 vs. TrEMBL
Match: A0A2S2R4C3 (SCAN domain-containing protein 3 OS=Sipha flava OX=143950 GN=SCAND3_6 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 8.690e-40
Identity = 59/102 (57.84%), Postives = 69/102 (67.65%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQE--IFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYD  YL  GFT   ING+ERPLC+LCM  LA + M P+KLKR LE  H   +GK R++F RKL+ L KQE   F K  S+    L+ASYKVSYRIAKCK P
Sbjct:   37 KYDDSYLDFGFTSTEINGEERPLCVLCMKVLAPECMLPSKLKRHLEANHKYTIGKPRDYFIRKLKEL-KQEKSTFFKNASIPTNALIASYKVSYRIAKCKKP 137          

HSP 2 Score: 84.3445 bits (207), Expect = 8.690e-40
Identity = 41/74 (55.41%), Postives = 52/74 (70.27%), Query Frame = -2
Query:   32 AKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEAT 253
             K PH+I E L+L AAIDM+  M+GES    L  +PL++NTV  RI  ++EDL DQLIEK+K   F LQ+DEAT
Sbjct:  134 CKKPHTIAEELILPAAIDMVNIMVGESAGKLLSKVPLSNNTVSRRIHHMAEDLNDQLIEKIKEKEFGLQLDEAT 207          
BLAST of SMED30035231 vs. TrEMBL
Match: A0A2S2QWU3 (SCAN domain-containing protein 3 (Fragment) OS=Sipha flava OX=143950 GN=SCAND3_10 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.087e-35
Identity = 45/103 (43.69%), Postives = 67/103 (65.05%), Query Frame = -1
Query:  243 YNKYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQE-IFSKTMSVKQKELLASYKVSYRIAKCKTP 548
            + KYD  Y+   FTY V+  +ERP C++C   +A ++M PNK+KR LE VH     K R +F+ KL+ + +Q+  F+K   +  K LLASY+V+Y++AKCK P
Sbjct:   26 HRKYDESYMDYDFTYTVVENEERPQCVICFKVMAVETMLPNKMKRHLETVHQTLKNKPRTYFESKLKAMREQKTTFAKHAKIPSKALLASYRVAYQVAKCKKP 128          

HSP 2 Score: 85.1149 bits (209), Expect = 1.087e-35
Identity = 41/78 (52.56%), Postives = 57/78 (73.08%), Query Frame = -2
Query:   32 ELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEAT 265
            ++   K PH+I E L+L AA+DM+  MLGE+ A QL  IPL+D T+  RI D++ED+ DQLI+K+K   F+LQ+DEAT
Sbjct:  121 QVAKCKKPHTIAEQLILPAAMDMVSIMLGEAAAKQLMNIPLSDTTISRRILDLAEDINDQLIDKLKGKYFSLQLDEAT 198          
BLAST of SMED30035231 vs. TrEMBL
Match: K7FSU2 (Dimer_Tnp_hAT domain-containing protein OS=Pelodiscus sinensis OX=13735 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.206e-32
Identity = 41/78 (52.56%), Postives = 58/78 (74.36%), Query Frame = -2
Query:   32 ELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEAT 265
            ++   K PH+IGE L+L + IDM+ T LGE  A QL  IPL+++TV  RI+D++EDL +QL EK++  SFA+Q+DEAT
Sbjct:  114 KIAQCKKPHTIGENLILPSPIDMVTTTLGEFSAKQLLSIPLSNDTVCCRIADMAEDLKEQLNEKIRSKSFAIQIDEAT 191          

HSP 2 Score: 83.9593 bits (206), Expect = 5.206e-32
Identity = 43/101 (42.57%), Postives = 62/101 (61.39%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEI-FSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYD  Y+  GFT   + G E+P C++C   L+++SMKP+KLK+ LE  HA    K R+FF RK + + +Q +   K +S  Q     SY+V Y+IA+CK P
Sbjct:   25 KYDESYIYFGFTSVFVTGIEQPQCVICQKMLSAESMKPSKLKQHLETSHAHLTNKPRDFFIRKRDEMKQQNVSLVKYISALQ----TSYQVGYKIAQCKKP 121          
BLAST of SMED30035231 vs. TrEMBL
Match: X1X3Z8 (BED-type domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.231e-30
Identity = 40/76 (52.63%), Postives = 58/76 (76.32%), Query Frame = -2
Query:   26 AKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEATAV 253
             K PHSIGE+LVL AAI ++  M GE+YA+ LK IPL+DNTV  RIS+IS+D+  QL+ +++ + FA+ +DE+T +
Sbjct:  146 TKKPHSIGESLVLPAAIKIVTAMHGEAYANDLKSIPLSDNTVSRRISNISDDILKQLLNRLRSNYFAM-LDESTDI 220          

HSP 2 Score: 80.8777 bits (198), Expect = 1.231e-30
Identity = 45/102 (44.12%), Postives = 63/102 (61.76%), Query Frame = -1
Query:  243 KYDPMYL-SLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQ-EIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KY   Y+   GFT+    G+ RP C++C+  LAS+SMKP+KLKR LE  H  +  K  +FF+R    L  Q ++F+   +V QK L+A ++VSY IAK K P
Sbjct:   48 KYQYQYIIQFGFTFIEEKGKHRPKCVICLEILASESMKPSKLKRHLEMKHPQYSNKDEQFFKRYENALKVQKKVFNTFSTVSQKALVAPFEVSYLIAKTKKP 149          
BLAST of SMED30035231 vs. TrEMBL
Match: A0A224XL78 (Putative transposase (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.408e-29
Identity = 48/101 (47.52%), Postives = 65/101 (64.36%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQE-IFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYD  YL  GFT    N +E+P+CL+C   LA++SMKP+KL+R L   HA    K  E+F+R L+  NK++    K +++  K LLASY+VSY IAK K P
Sbjct:    4 KYDESYLQYGFTCSSHNNEEQPVCLICKEVLAAESMKPSKLQRHLNTKHATLSKKPIEYFERLLQTSNKEKNTLEKYVTLNDKYLLASYEVSYLIAKTKKP 104          

HSP 2 Score: 70.4774 bits (171), Expect = 8.408e-29
Identity = 38/77 (49.35%), Postives = 54/77 (70.13%), Query Frame = -2
Query:   26 AKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEATAV 253
             K P +IGE L+L AAI M E + G+ YA ++  IPL+++TV  RISDIS D   QL+ ++K SS FA+Q+DE+T +
Sbjct:  101 TKKPFTIGEQLLLPAAIRMSEIVHGKQYAAEISKIPLSNDTVSKRISDISNDQFQQLLMRLKDSSKFAIQLDESTDI 177          
BLAST of SMED30035231 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 5.751e-27
Identity = 37/77 (48.05%), Postives = 56/77 (72.73%), Query Frame = -2
Query:   26 AKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSF-ALQVDEATAV 253
            A  PH+IGE+L+L AA +M+  MLGE    QL +I L+DNTV  RI++++ D+  QLI++V+ S F A+Q+DE+T +
Sbjct:  183 AGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRFYAIQLDESTDI 259          

HSP 2 Score: 66.2402 bits (160), Expect = 5.751e-27
Identity = 38/108 (35.19%), Postives = 60/108 (55.56%), Query Frame = -1
Query:  243 YNKYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEIFSKTMSV------KQKELLASYKVSYRIAKCKTP 548
            +  Y   YL+LGFT      +  PLC++C   LA++++KP KL+R LE  H+++  K  EFF+ KL+    ++   KT+ +        K + ASY+V+  IAK   P
Sbjct:   82 WTLYCSEYLALGFTCTGTENEPLPLCVVCSEVLANEALKPTKLRRHLETKHSEYASKPVEFFENKLKEYQSRK---KTLELACSGTDNAKAVEASYRVAQLIAKAGKP 186          
BLAST of SMED30035231 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 1.259e-26
Identity = 37/78 (47.44%), Postives = 56/78 (71.79%), Query Frame = -2
Query:   26 NAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSF-ALQVDEATAV 256
             A  PH+IGE+L+L AA +M+  MLGE    QL +I L+DNTV  RI++++ D+  QLI++V+ S F A+Q+DE+T +
Sbjct:  139 KAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRFYAIQLDESTDI 216          

HSP 2 Score: 65.0846 bits (157), Expect = 1.259e-26
Identity = 38/106 (35.85%), Postives = 59/106 (55.66%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEIFSKTMSVK------QKELLASYKVSYRIAKCKTP 542
            KY   YL+LGFT      +  PLC++C   LA++++K  KL+R LE  H+++  K  EFF+ KL+    ++   KT+ +        K + ASY+V+  IAK   P
Sbjct:   41 KYSSEYLALGFTCTGTENEPLPLCVVCSEVLANEALKTTKLRRHLETKHSEYASKPVEFFENKLKEYQSRK---KTLELACSGTDHAKAVEASYRVAQLIAKAGKP 143          
BLAST of SMED30035231 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.006e-22
Identity = 35/75 (46.67%), Postives = 52/75 (69.33%), Query Frame = -2
Query:   26 KHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEATAV 250
            K PH+IGETL+  A I M E M G   A++ KI+PL++NTV  RI  ++ ++ + L+EK+K S F++Q+DE T V
Sbjct:  108 KKPHTIGETLIKPACIKMAERMCGPQVANKFKIVPLSNNTVKDRIDRMAGNVENTLVEKLKTSPFSIQLDETTTV 182          

HSP 2 Score: 51.6026 bits (122), Expect = 1.006e-22
Identity = 35/105 (33.33%), Postives = 54/105 (51.43%), Query Frame = -1
Query:  243 YDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL------NKQEIFSKTMSVKQKELLASYKVSYRIAKCKTP 539
            Y   ++  GF   +   + R  C+ C + LA++S+KP  LKR     H + VGK +EFF RK E L      N ++   +  S  ++  +AS++ S  IAK K P
Sbjct:    8 YQESFIEYGFIEAM--DKVRAECIFCRDKLANESLKPCNLKRHQTTKHPETVGKPKEFFLRKKELLVANRPQNIKDSLLRAGSDHRQATIASFECSLLIAKDKKP 110          
BLAST of SMED30035231 vs. Ensembl Cavefish
Match: ENSAMXT00000051860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8744824:8748459:-1 gene:ENSAMXG00000029953.1 transcript:ENSAMXT00000051860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 6.218e-7
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = -1
Query:  243 PLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTP 479
            P  L+C N LA  S+K +KL R L+  H+    K  EFF+RKL+ L  Q++  +  +  QK L A++ + + IAK   P
Sbjct:   74 PTVLVCGNMLAKVSLKLSKLLRHLQAKHSTLWSKPVEFFERKLQELRGQKLVLQKATANQKALKAAFVILHWIAKTGKP 152          
BLAST of SMED30035231 vs. Ensembl Cavefish
Match: ENSAMXT00000047230.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:8744824:8751336:-1 gene:ENSAMXG00000029953.1 transcript:ENSAMXT00000047230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.327e-6
Identity = 30/79 (37.97%), Postives = 45/79 (56.96%), Query Frame = -1
Query:  243 PLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTP 479
            P  L+C N LA  S+K +KL R L+  H+    K  EFF+RKL+ L  Q++  +  +  QK L A++ + + IAK   P
Sbjct:  192 PTVLVCGNMLAKVSLKLSKLLRHLQAKHSTLWSKPVEFFERKLQELRGQKLVLQKATANQKALKAAFVILHWIAKTGKP 270          
BLAST of SMED30035231 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 5.335e-26
Identity = 54/101 (53.47%), Postives = 70/101 (69.31%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRK-LENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYD  Y++LGFT   +  +ERP+CLLC+  LA+DSMKPNKL+R L+ +H +H  K  EFFQRK  E   +   F    SV Q+ LLASYKV+Y+IA+CK P
Sbjct:   31 KYDEAYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQRALLASYKVAYQIAQCKKP 131          

HSP 2 Score: 86.2705 bits (212), Expect = 4.617e-17
Identity = 42/91 (46.15%), Postives = 62/91 (68.13%), Query Frame = -2
Query:   32 NKKNCLRHIKFLIELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEAT 304
            N++  L   K   ++   K PH+I E L+L AA+DM+  ML ++ A +LK +PL+++TV  RI+DI+ DL +QL+EK+K   FALQ DEAT
Sbjct:  111 NQRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDLKEQLVEKLKDKRFALQFDEAT 201          
BLAST of SMED30035231 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 5.881e-26
Identity = 54/101 (53.47%), Postives = 70/101 (69.31%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRK-LENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KYD  Y++LGFT   +  +ERP+CLLC+  LA+DSMKPNKL+R L+ +H +H  K  EFFQRK  E   +   F    SV Q+ LLASYKV+Y+IA+CK P
Sbjct:   31 KYDEAYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADKPLEFFQRKRAEYCQQSSRFVSATSVNQRALLASYKVAYQIAQCKKP 131          

HSP 2 Score: 86.2705 bits (212), Expect = 4.617e-17
Identity = 42/91 (46.15%), Postives = 62/91 (68.13%), Query Frame = -2
Query:   32 NKKNCLRHIKFLIELLNAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEAT 304
            N++  L   K   ++   K PH+I E L+L AA+DM+  ML ++ A +LK +PL+++TV  RI+DI+ DL +QL+EK+K   FALQ DEAT
Sbjct:  111 NQRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDLKEQLVEKLKDKRFALQFDEAT 201          
BLAST of SMED30035231 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 6.798e-24
Identity = 36/77 (46.75%), Postives = 55/77 (71.43%), Query Frame = -2
Query:   26 AKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEATAV 253
            +K   +I E LVL AA+DM   M+GE+ A +LK IPL+++ V  RI+DI+ D+  QL+E+++ S  F+LQ+DE+T V
Sbjct:  111 SKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADIASDIEQQLLERIRKSPFFSLQLDESTDV 187          

HSP 2 Score: 61.2326 bits (147), Expect = 6.798e-24
Identity = 38/100 (38.00%), Postives = 57/100 (57.00%), Query Frame = -1
Query:  249 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQ--EIFSKTMSVKQKELLASYKVSYRIAKCK 542
            KY+P  ++ GF       + R  C+ C  TL+++++KP+KLKR LE  H   +GK  ++F+RK + L  Q   I S T   K   L ASY V+ R+A+ K
Sbjct:   14 KYNPDLINFGFVNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKHPKLIGKPVDYFKRKDDGLQMQRRSIVSLTGDAKCA-LKASYLVARRVAQSK 112          
BLAST of SMED30035231 vs. Ensembl Medaka
Match: ENSORLT00000040762.1 (pep primary_assembly:ASM223467v1:1:8553592:8557739:1 gene:ENSORLG00000022190.1 transcript:ENSORLT00000040762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 4.844e-23
Identity = 42/101 (41.58%), Postives = 53/101 (52.48%), Query Frame = -1
Query:  243 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENL-NKQEIFSKTMSVKQKELLASYKVSYRIAKCKTP 542
            KY+  Y+ +GFT    +   + LC  C   LA+ SMKP  L+R L   H  HVGK  EFF+RKL    + Q    K  +   K L ASY VS  +AK K P
Sbjct:   71 KYNEDYVLMGFT-SASSDPPQALCFFCGEKLANASMKPAHLQRHLTTKHRCHVGKAPEFFRRKLSEFKSSQATMRKVSTTSAKALEASYAVSLLVAKAKKP 170          

HSP 2 Score: 58.9214 bits (141), Expect = 4.844e-23
Identity = 32/77 (41.56%), Postives = 50/77 (64.94%), Query Frame = -2
Query:   26 NAKHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEATAV 256
             AK P +I E L+L A + + ETML +  AD  K +PL+++TV  RI  +  D+ +Q++ K+   SF+LQ+DE+T V
Sbjct:  166 KAKKPFTIAEDLLLPAVVVLAETMLDKKSADTFKTVPLSNDTVCRRIDTMGPDIIEQVVGKLG-DSFSLQLDESTDV 241          
BLAST of SMED30035231 vs. Ensembl Medaka
Match: ENSORLT00000028620.1 (pep primary_assembly:ASM223467v1:3:35179252:35181570:1 gene:ENSORLG00000028714.1 transcript:ENSORLT00000028620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 9.129e-22
Identity = 34/76 (44.74%), Postives = 53/76 (69.74%), Query Frame = -2
Query:   26 KHPHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSS-FALQVDEATAV 250
            K   +I E LVL AA+DM   M+GE+ A +LK IPL+++ V  RI+D++ D+  QL+ +++ S  F+LQ+DE+T V
Sbjct:  158 KKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADMASDIEQQLLGRIRKSPFFSLQLDESTDV 233          

HSP 2 Score: 58.5362 bits (140), Expect = 9.129e-22
Identity = 36/97 (37.11%), Postives = 55/97 (56.70%), Query Frame = -1
Query:  258 KYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQ--EIFSKTMSVKQKELLASYKVSYRIA 542
            KY+P ++  GF       + R  C+ C  TL+++++KP+KLKR LE  +   +GK  ++F+RK + L  Q   I S T   K   L ASY V+ R+A
Sbjct:   60 KYNPDFIKFGFVNGGSEAEPRAQCVECGLTLSNEALKPSKLKRHLETKYPKLIGKPVDYFKRKDDGLQMQRRSIVSLTGDAKCA-LKASYLVARRVA 155          
BLAST of SMED30035231 vs. Planmine SMEST
Match: SMESG000059630.1 (SMESG000059630.1)

HSP 1 Score: 131.724 bits (330), Expect = 2.424e-57
Identity = 67/74 (90.54%), Postives = 67/74 (90.54%), Query Frame = -2
Query:   23 PHSIGETLVLLAAIDMIETMLGESYADQLKIIPLADNTVGGRISDISEDLCDQLIEKVKLSSFALQVDEATAVL 244
            PHSIGETLVL AAIDMIE MLGESYADQLKIIPLADNTVG RISDISEDLCD LIEKVKLSSFALQ DEA  VL
Sbjct:  104 PHSIGETLVLPAAIDMIEMMLGESYADQLKIIPLADNTVGRRISDISEDLCDLLIEKVKLSSFALQADEAIDVL 177          

HSP 2 Score: 111.309 bits (277), Expect = 2.424e-57
Identity = 60/93 (64.52%), Postives = 60/93 (64.52%), Query Frame = -1
Query:  270 YNKYDPMYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVGKTREFFQRKLENLNKQEIFSKTMSVKQKELLASYKVS 548
            Y KYDPMYLSLGFTY VINGQERPLCLLCMNTLASDSMKPNKLKR LEK                            TMSV QK LLASYKVS
Sbjct:   39 YRKYDPMYLSLGFTYMVINGQERPLCLLCMNTLASDSMKPNKLKRHLEK----------------------------TMSVTQKALLASYKVS 103          
BLAST of SMED30035231 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 168.318 bits (425), Expect = 3.059e-56
Identity = 95/174 (54.60%), Postives = 129/174 (74.14%), Query Frame = 3
Query:  723 KQKLFKNPTQLNYPNKILLITTVMLMNVLCINAT*IGPSFAIKMIPLMEKISIYSTYTQIVWIYHCXXXXXXXXXXXXXYFDPPIKLHGN-NMYVVRRLAMN--YPWTIKQWESQNNDTKIYNLIRLNIWTKKINNLITVKPIINGINVFWRSQESIKVKVVF*NFAIDNLNVR 1235
            KQK+ KNP+ L Y NK L + T+M++NVL  NAT   P++ IK IPL EK+ IY+T TQ+VWIY C   EEIEI+NLLNYF+PP+KL  N N YV R+L +N  YPW IKQ + + N TKI NLI + IWTK +NN ++++P++NGIN++W ++ S +VK++F N+ ID LNVR
Sbjct: 2257 KQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNYTIDTLNVR 2430          

HSP 2 Score: 48.521 bits (114), Expect = 3.059e-56
Identity = 24/63 (38.10%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 1258 LKLNQTYNIVPHYYKKSLRKNGTYIDNQRIEIHFHKHSVYLINETNRVIFHYDKQTFTVARKT 1446
            LKL+ TY+I  HYY+K L+  GT  +++ ++I+  + S+ L NETNRV      Q   ++R++
Sbjct: 2439 LKLHHTYDIAVHYYEKVLQDYGTESNDRWVKIYLSRKSILLQNETNRVQLQLVNQKLNISRQS 2501          

HSP 3 Score: 43.5134 bits (101), Expect = 3.059e-56
Identity = 20/30 (66.67%), Postives = 22/30 (73.33%), Query Frame = 2
Query:  605 NNKKAGTIIVYANRC*KVPTEEGKQYSLSS 694
            NNKKAG IIV+ANRC KVP  E  +Y L S
Sbjct: 2216 NNKKAGKIIVHANRCKKVPVAEDTKYQLRS 2245          

HSP 4 Score: 49.6766 bits (117), Expect = 9.435e-6
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 2
Query: 1382 SMKLIVLFSTTTNKHLQLL--------EKHSNQKAVIYYCRNTQATFSDKNDTRALKFYQLRSK*TSKTILIKIQYYRCKTIRTNDVLPW*IAISFV 1648
            S K I+L + T    LQL+        +   N+K VIYYC    AT +     + L F Q+RSK  SK ++IKI+YY+  +I      PW   ISFV
Sbjct: 2473 SRKSILLQNETNRVQLQLVNQKLNISRQSGMNEKVVIYYCGKILATLASNFTFKMLNFQQIRSKSISKIVMIKIKYYKRMSIFN----PW--EISFV 2563          
BLAST of SMED30035231 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 167.933 bits (424), Expect = 3.487e-56
Identity = 95/174 (54.60%), Postives = 129/174 (74.14%), Query Frame = 3
Query:  723 KQKLFKNPTQLNYPNKILLITTVMLMNVLCINAT*IGPSFAIKMIPLMEKISIYSTYTQIVWIYHCXXXXXXXXXXXXXYFDPPIKLHGN-NMYVVRRLAMN--YPWTIKQWESQNNDTKIYNLIRLNIWTKKINNLITVKPIINGINVFWRSQESIKVKVVF*NFAIDNLNVR 1235
            KQK+ KNP+ L Y NK L + T+M++NVL  NAT   P++ IK IPL EK+ IY+T TQ+VWIY C   EEIEI+NLLNYF+PP+KL  N N YV R+L +N  YPW IKQ + + N TKI NLI + IWTK +NN ++++P++NGIN++W ++ S +VK++F N+ ID LNVR
Sbjct: 2365 KQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNYTIDTLNVR 2538          

HSP 2 Score: 48.521 bits (114), Expect = 3.487e-56
Identity = 24/63 (38.10%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 1258 LKLNQTYNIVPHYYKKSLRKNGTYIDNQRIEIHFHKHSVYLINETNRVIFHYDKQTFTVARKT 1446
            LKL+ TY+I  HYY+K L+  GT  +++ ++I+  + S+ L NETNRV      Q   ++R++
Sbjct: 2547 LKLHHTYDIAVHYYEKVLQDYGTESNDRWVKIYLSRKSILLQNETNRVQLQLVNQKLNISRQS 2609          

HSP 3 Score: 43.5134 bits (101), Expect = 3.487e-56
Identity = 20/30 (66.67%), Postives = 22/30 (73.33%), Query Frame = 2
Query:  605 NNKKAGTIIVYANRC*KVPTEEGKQYSLSS 694
            NNKKAG IIV+ANRC KVP  E  +Y L S
Sbjct: 2324 NNKKAGKIIVHANRCKKVPVAEDTKYQLRS 2353          

HSP 4 Score: 50.0618 bits (118), Expect = 8.918e-6
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 2
Query: 1382 SMKLIVLFSTTTNKHLQLL--------EKHSNQKAVIYYCRNTQATFSDKNDTRALKFYQLRSK*TSKTILIKIQYYRCKTIRTNDVLPW*IAISFV 1648
            S K I+L + T    LQL+        +   N+K VIYYC    AT +     + L F Q+RSK  SK ++IKI+YY+  +I      PW   ISFV
Sbjct: 2581 SRKSILLQNETNRVQLQLVNQKLNISRQSGMNEKVVIYYCGKILATLASNFTFKMLNFQQIRSKSISKIVMIKIKYYKRMSIFN----PW--EISFV 2671          
BLAST of SMED30035231 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 167.933 bits (424), Expect = 3.822e-56
Identity = 95/174 (54.60%), Postives = 129/174 (74.14%), Query Frame = 3
Query:  723 KQKLFKNPTQLNYPNKILLITTVMLMNVLCINAT*IGPSFAIKMIPLMEKISIYSTYTQIVWIYHCXXXXXXXXXXXXXYFDPPIKLHGN-NMYVVRRLAMN--YPWTIKQWESQNNDTKIYNLIRLNIWTKKINNLITVKPIINGINVFWRSQESIKVKVVF*NFAIDNLNVR 1235
            KQK+ KNP+ L Y NK L + T+M++NVL  NAT   P++ IK IPL EK+ IY+T TQ+VWIY C   EEIEI+NLLNYF+PP+KL  N N YV R+L +N  YPW IKQ + + N TKI NLI + IWTK +NN ++++P++NGIN++W ++ S +VK++F N+ ID LNVR
Sbjct: 2163 KQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNYTIDTLNVR 2336          

HSP 2 Score: 48.521 bits (114), Expect = 3.822e-56
Identity = 24/63 (38.10%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 1258 LKLNQTYNIVPHYYKKSLRKNGTYIDNQRIEIHFHKHSVYLINETNRVIFHYDKQTFTVARKT 1446
            LKL+ TY+I  HYY+K L+  GT  +++ ++I+  + S+ L NETNRV      Q   ++R++
Sbjct: 2345 LKLHHTYDIAVHYYEKVLQDYGTESNDRWVKIYLSRKSILLQNETNRVQLQLVNQKLNISRQS 2407          

HSP 3 Score: 43.5134 bits (101), Expect = 3.822e-56
Identity = 20/30 (66.67%), Postives = 22/30 (73.33%), Query Frame = 2
Query:  605 NNKKAGTIIVYANRC*KVPTEEGKQYSLSS 694
            NNKKAG IIV+ANRC KVP  E  +Y L S
Sbjct: 2122 NNKKAGKIIVHANRCKKVPVAEDTKYQLRS 2151          

HSP 4 Score: 50.0618 bits (118), Expect = 8.942e-6
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 2
Query: 1382 SMKLIVLFSTTTNKHLQLL--------EKHSNQKAVIYYCRNTQATFSDKNDTRALKFYQLRSK*TSKTILIKIQYYRCKTIRTNDVLPW*IAISFV 1648
            S K I+L + T    LQL+        +   N+K VIYYC    AT +     + L F Q+RSK  SK ++IKI+YY+  +I      PW   ISFV
Sbjct: 2379 SRKSILLQNETNRVQLQLVNQKLNISRQSGMNEKVVIYYCGKILATLASNFTFKMLNFQQIRSKSISKIVMIKIKYYKRMSIFN----PW--EISFV 2469          
BLAST of SMED30035231 vs. Planmine SMEST
Match: SMESG000056661.1 (SMESG000056661.1)

HSP 1 Score: 167.933 bits (424), Expect = 2.143e-49
Identity = 95/174 (54.60%), Postives = 129/174 (74.14%), Query Frame = 3
Query:  723 KQKLFKNPTQLNYPNKILLITTVMLMNVLCINAT*IGPSFAIKMIPLMEKISIYSTYTQIVWIYHCXXXXXXXXXXXXXYFDPPIKLHGN-NMYVVRRLAMN--YPWTIKQWESQNNDTKIYNLIRLNIWTKKINNLITVKPIINGINVFWRSQESIKVKVVF*NFAIDNLNVR 1235
            KQK+ KNP+ L Y NK L + T+M++NVL  NAT   P++ IK IPL EK+ IY+T TQ+VWIY C   EEIEI+NLLNYF+PP+KL  N N YV R+L +N  YPW IKQ + + N TKI NLI + IWTK +NN ++++P++NGIN++W ++ S +VK++F N+ ID LNVR
Sbjct: 2281 KQKVAKNPSSLGYINKTLFVATLMIINVLGSNATSSFPNYVIKKIPLKEKVDIYATCTQMVWIYRCAPTEEIEISNLLNYFEPPVKLDFNKNTYVNRQLTINYEYPWLIKQVQPKINSTKIINLINIEIWTKTLNNYVSIEPVLNGINIYWETRNSQQVKIIFQNYTIDTLNVR 2454          

HSP 2 Score: 48.1358 bits (113), Expect = 2.143e-49
Identity = 24/63 (38.10%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 1258 LKLNQTYNIVPHYYKKSLRKNGTYIDNQRIEIHFHKHSVYLINETNRVIFHYDKQTFTVARKT 1446
            LKL+ TY+I  HYY+K L+  GT  +++ ++I+  + S+ L NETNRV      Q   ++R++
Sbjct: 2463 LKLHHTYDIAVHYYEKVLQDYGTESNDRWVKIYLSRKSILLQNETNRVQLQLVNQKLNISRQS 2525          

HSP 3 Score: 49.6766 bits (117), Expect = 9.934e-6
Identity = 37/97 (38.14%), Postives = 50/97 (51.55%), Query Frame = 2
Query: 1382 SMKLIVLFSTTTNKHLQLL--------EKHSNQKAVIYYCRNTQATFSDKNDTRALKFYQLRSK*TSKTILIKIQYYRCKTIRTNDVLPW*IAISFV 1648
            S K I+L + T    LQL+        +   N+K VIYYC    AT +     + L F Q+RSK  SK ++IKI+YY+  +I      PW   ISFV
Sbjct: 2497 SRKSILLQNETNRVQLQLVNQKLNISRQSGMNEKVVIYYCGKILATLASNFTFKMLNFQQIRSKSISKIVMIKIKYYKRMSIFN----PW--EISFV 2587          
The following BLAST results are available for this feature:
BLAST of SMED30035231 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED59.715e-1838.14zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED59.715e-1838.14zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED91.302e-1341.75zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED91.316e-1341.75zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
FAM200B4.952e-1342.00family with sequence similarity 200 member B [Sour... [more]
back to top
BLAST of SMED30035231 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zmym62.911e-1644.44zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym63.423e-1644.44zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zbed51.336e-1239.22zinc finger, BED type containing 5 [Source:MGI Sym... [more]
back to top
BLAST of SMED30035231 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q49AG3|ZBED5_HUMAN4.278e-1738.14Zinc finger BED domain-containing protein 5 OS=Hom... [more]
sp|A4Z943|ZBED5_BOVIN4.384e-1738.14Zinc finger BED domain-containing protein 5 OS=Bos... [more]
sp|A4Z944|ZBED5_CANLF4.456e-1738.14Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|Q6R2W3|SCND3_HUMAN6.252e-1341.75SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
sp|P0CF97|F200B_HUMAN2.378e-1242.00Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B... [more]
back to top
BLAST of SMED30035231 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2R4C38.690e-4057.84SCAN domain-containing protein 3 OS=Sipha flava OX... [more]
A0A2S2QWU31.087e-3543.69SCAN domain-containing protein 3 (Fragment) OS=Sip... [more]
K7FSU25.206e-3252.56Dimer_Tnp_hAT domain-containing protein OS=Pelodis... [more]
X1X3Z81.231e-3052.63BED-type domain-containing protein OS=Acyrthosipho... [more]
A0A224XL788.408e-2947.52Putative transposase (Fragment) OS=Panstrongylus l... [more]
back to top
BLAST of SMED30035231 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051422.15.751e-2748.05pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.11.259e-2647.44pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000057314.11.006e-2246.67pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
ENSAMXT00000051860.16.218e-737.97pep primary_assembly:Astyanax_mexicanus-2.0:11:874... [more]
ENSAMXT00000047230.11.327e-637.97pep primary_assembly:Astyanax_mexicanus-2.0:11:874... [more]
back to top
BLAST of SMED30035231 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035231 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040389.15.335e-2653.47pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000035512.15.881e-2653.47pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000032459.16.798e-2446.75pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000040762.14.844e-2341.58pep primary_assembly:ASM223467v1:1:8553592:8557739... [more]
ENSORLT00000028620.19.129e-2244.74pep primary_assembly:ASM223467v1:3:35179252:351815... [more]
back to top
BLAST of SMED30035231 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059630.12.424e-5790.54SMESG000059630.1[more]
SMESG000056661.13.059e-5654.60SMESG000056661.1[more]
SMESG000056661.13.487e-5654.60SMESG000056661.1[more]
SMESG000056661.13.822e-5654.60SMESG000056661.1[more]
SMESG000056661.12.143e-4954.60SMESG000056661.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035231 ID=SMED30035231|Name=SMED30035231|organism=Schmidtea mediterranea sexual|type=transcript|length=2240bp
TAAATTGTGGCTCTGAGCCCAACAGAACTGCAGTAGCCTCATCTACTTGC
AACGCGAAAGAAGATAGTTTTACTTTTTCTATTAATTGATCGCAAAGATC
TTCAGATATATCGGATATTCGTCCTCCCACCGTATTATCTGCAAGTGGAA
TGATTTTAAGTTGATCAGCATATGATTCACCGAGCATCGTTTCTATCATG
TCAATAGCTGCAAGTAGCACCAAAGTTTCTCCTATTGAATGGGGGTGTTT
TGCATTTAGCAATTCTATAAGAAACTTTATATGACGCAAGCAATTCTTTT
TGTTTTACAGACATGGTCTTTGAAAAAATTTCTTGTTTATTTAAATTCTC
TAATTTTCTTTGGAAAAATTCTCTTGTCTTGCCAACGTGATCTGCATGTA
CTTTTTCAAGACGTCGTTTTAATTTATTTGGTTTCATGCTGTCTGAGGCC
AAAGTATTCATACACAGCAAACACAATGGTCGTTCTTGGCCATTAATAAC
CTTATATGTAAATCCTAATGATAAGTACATTGGATCATATTTATTGTATT
ATAGTCATATTGATGTGTGATGCTACAGAAACGAATCTAAAATTACGTCC
TTTAAATAATAAGAAAGCAGGAACAATAATAGTTTATGCAAATCGATGTT
AAAAAGTACCTACTGAAGAGGGAAAACAGTATTCATTGAGTTCAAATTAA
AATAAACGAAGGAGCTGTAACCAAACAAAAGCTTTTTAAGAATCCTACCC
AATTAAATTATCCCAACAAAATTTTATTGATAACGACAGTAATGCTCATG
AATGTCTTGTGTATAAATGCAACATGAATTGGTCCATCGTTTGCAATTAA
AATGATTCCGTTGATGGAAAAGATCAGTATTTATTCAACGTACACTCAAA
TTGTGTGGATATATCATTGTGAGAAAAATGAGGAAATAGAAATTAATAAT
TTACTAAATTATTTTGATCCGCCAATAAAGTTACATGGTAATAATATGTA
TGTAGTTCGACGATTGGCAATGAACTACCCTTGGACGATAAAACAATGGG
AATCTCAAAACAATGATACAAAAATCTATAATCTAATACGATTGAATATT
TGGACGAAGAAAATAAATAACCTTATAACAGTTAAACCGATAATAAATGG
AATCAATGTCTTTTGGAGATCCCAGGAATCCATAAAAGTCAAAGTAGTTT
TTTAAAATTTTGCAATAGACAATCTAAATGTCAGAAATCATTTATAAATT
ATATTAATTAAAATTAAATCAGACTTATAATATTGTACCTCATTATTATA
AAAAATCCCTTCGAAAAAATGGAACCTACATTGATAATCAAAGGATTGAA
ATTCATTTTCATAAACATTCTGTGTATTTAATCAATGAAACTAATCGTGT
TATTTTCCACTACGACAAACAAACATTTACAGTTGCTCGAAAAACATTCA
AACCAAAAAGCAGTTATCTACTATTGTAGAAACACCCAGGCTACCTTCAG
TGATAAAAATGATACCAGAGCTTTAAAATTCTACCAGCTACGTTCAAAGT
AAACATCAAAAACGATATTAATTAAAATTCAGTATTATCGTTGTAAAACC
ATTCGGACCAATGACGTTTTACCCTGGTAGATCGCAATTTCATTCGTGTG
TATTATGAGAACATTTACGAGGAGCACCCAAACAAAGTTAAACTAGCCAT
TTAAAACAAATATCTAAAATTCCAAAACAGTACAATAGGAACTTTTTCAG
ATAACAATACCTATGACATTATATCTTCTTAAAATCTTAAAAGGTCATTA
ATGATAAACGGAATTCTATATATATTGGATAACAATGATATCTCGAGTTT
TGCGAGATTAAAAAAGGAGATATAGTATAAAAAATGGTTATGAAACTAGT
CAGACTTGTGTCTAGGACATTTTGAAAGTTCTAGTATATCATAGATTAAA
AGGTGGAATCCTATAAGGATACCTGTGAGTGTTGATTTATTCGAAAGTGT
AGATCGTTGTGAAGTTTTTTTATCAATAAAAATTATTCCTGTGTTGAATT
AATTCAGTGGTATTTAACGAGCACGTAGAACCAGAGCTAACAGTTCCTGC
TGAACCACTTAAAATATTAACTCAACAATATGTATATTCATATGTATATT
GATTGGAGGGCAATATATTGCCGGGTAAATGTACTAGACCCGTTTAAAAA
TATATCAATGTAAACAAACTTAAAATTATTTAAAAATTAC
back to top

protein sequence of SMED30035231-orf-1

>SMED30035231-orf-1 ID=SMED30035231-orf-1|Name=SMED30035231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MIPLMEKISIYSTYTQIVWIYHCEKNEEIEINNLLNYFDPPIKLHGNNMY
VVRRLAMNYPWTIKQWESQNNDTKIYNLIRLNIWTKKINNLITVKPIING
INVFWRSQESIKVKVVF*
back to top

protein sequence of SMED30035231-orf-2

>SMED30035231-orf-2 ID=SMED30035231-orf-2|Name=SMED30035231-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MYLSLGFTYKVINGQERPLCLLCMNTLASDSMKPNKLKRRLEKVHADHVG
KTREFFQRKLENLNKQEIFSKTMSVKQKELLASYKVSYRIAKCKTPPFNR
RNFGATCSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell