Annexin

Overview
NameAnnexin
Smed IDSMED30035226
Length (bp)2313
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Annexin (SMED30035226) t-SNE clustered cells

Violin plots show distribution of expression levels for Annexin (SMED30035226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Annexin (SMED30035226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Annexin (SMED30035226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035226SMESG000023108.1 SmedASXL_000655SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035226SMESG000023108.1 dd_Smed_v6_5798_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30035226SMESG000023108.1 dd_Smed_v4_5798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Annexin vs. Ensembl Human
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 313.538 bits (802), Expect = 3.879e-98
Identity = 159/316 (50.32%), Postives = 211/316 (66.77%), Query Frame = 3
Query: 1275 VQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            V + T+ P  NF+A  D E LRKAMKG GTDE AI+DV+  RS  QR +I   FKT  G+DLI D  SELSGN  ++  AL + P  YDA  LR AM+G GT E  LIEI+CTRTN +I+     Y+  +  RDLEKDI S+TS +F+RLL+S+ Q +RDE+Q+ +  +A +DA+ LY+AGE + GTDES F+ I+  RS P LRA  E Y +++   L  ++  E SG + +GL T ++C  N+P +FA  L  +MKG GTDD TL+RIV+TR EID+VQIK+ F   Y K LG  I  DTSGDY ++LL + G+
Sbjct:  152 VTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFG-RDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ 466          
BLAST of Annexin vs. Ensembl Human
Match: ANXA4 (annexin A4 [Source:HGNC Symbol;Acc:HGNC:542])

HSP 1 Score: 308.531 bits (789), Expect = 3.937e-98
Identity = 160/315 (50.79%), Postives = 211/315 (66.98%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+     FNA ED + LRKAMKGLGTDE AII V+  R+  QR EI   +K+ +GRDLI D  SELSGNF ++   +      YD  ELR AMKG GTDE  LIEI+ +RT  +I+   + Y+Q Y  R LE DI S+TS  F+R+L+SL    RDE    D  L  QDA++LYEAGEKK+GTDE KF  ++ +R+  HL  +F+EY+++S+  +EQ+IKSE SG   + L+  V+C++NK  YFA  L KSMKGLGTDD TL+R++++R EIDM+ I+  F+  Y K L  +IK DTSGDY K+LL L G +D
Sbjct:    8 GTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYG-RSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD 321          
BLAST of Annexin vs. Ensembl Human
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 313.538 bits (802), Expect = 8.083e-98
Identity = 159/316 (50.32%), Postives = 211/316 (66.77%), Query Frame = 3
Query: 1275 VQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            V + T+ P  NF+A  D E LRKAMKG GTDE AI+DV+  RS  QR +I   FKT  G+DLI D  SELSGN  ++  AL + P  YDA  LR AM+G GT E  LIEI+CTRTN +I+     Y+  +  RDLEKDI S+TS +F+RLL+S+ Q +RDE+Q+ +  +A +DA+ LY+AGE + GTDES F+ I+  RS P LRA  E Y +++   L  ++  E SG + +GL T ++C  N+P +FA  L  +MKG GTDD TL+RIV+TR EID+VQIK+ F   Y K LG  I  DTSGDY ++LL + G+
Sbjct:  174 VTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFG-RDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ 488          
BLAST of Annexin vs. Ensembl Human
Match: ANXA11 (annexin A11 [Source:HGNC Symbol;Acc:HGNC:535])

HSP 1 Score: 307.76 bits (787), Expect = 7.477e-96
Identity = 156/320 (48.75%), Postives = 215/320 (67.19%), Query Frame = 3
Query: 1269 EYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            ++    T+   P F+   D E LRKAMKG GTDE AIID +G RS KQR +I+  FKT  G+DLI D  SELSGNF K   AL   P  +D  E++ A+KG+GTDE  LIEI+ +R+N  I+     YK  +  + LE+ I S+TS +F+RLLISL Q +RDES   D +LA +DA+ELY AGE + GTDESKF+ ++ +RS  HL A+F EY++++   +E++I  EMSGD+  G++  V+C++N P +FA  LNK+M+G GT DRTL+RI+++R E D++ I+  ++  Y K L   I  DTSGDY KILL + G ND
Sbjct:  154 QFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEF-KKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND 472          
BLAST of Annexin vs. Ensembl Human
Match: ANXA11 (annexin A11 [Source:HGNC Symbol;Acc:HGNC:535])

HSP 1 Score: 307.76 bits (787), Expect = 1.988e-95
Identity = 156/320 (48.75%), Postives = 215/320 (67.19%), Query Frame = 3
Query: 1269 EYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            ++    T+   P F+   D E LRKAMKG GTDE AIID +G RS KQR +I+  FKT  G+DLI D  SELSGNF K   AL   P  +D  E++ A+KG+GTDE  LIEI+ +R+N  I+     YK  +  + LE+ I S+TS +F+RLLISL Q +RDES   D +LA +DA+ELY AGE + GTDESKF+ ++ +RS  HL A+F EY++++   +E++I  EMSGD+  G++  V+C++N P +FA  LNK+M+G GT DRTL+RI+++R E D++ I+  ++  Y K L   I  DTSGDY KILL + G ND
Sbjct:  187 QFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEF-KKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND 505          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-2 (Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5])

HSP 1 Score: 288.115 bits (736), Expect = 5.367e-89
Identity = 152/329 (46.20%), Postives = 210/329 (63.83%), Query Frame = 3
Query: 1254 YFETEEYVQEA-----TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            +F  + Y Q       ++FP   FN+N D E LRKAMKGLG + + +I ++ +R+  QR EI + FK + G+DLI +   EL G+F  +  AL   P  YDA +L  AM+GLGT E  LIEI+ +RTNAQI+  ++ YK L+  +DLE+D+I ETS +FKRLL+SL    RDES   D   A QDA+ L +AGEK+ GTDES F+ I+ +++   LR +FEEY+K S  ++E+AI+ E SGDI +GL+  +  I+N+P YFA  L+ SMKGLGT D  L+R+ +TR E DM  I+  FQ+ Y   L   IK D SG Y + L+ L   N
Sbjct:  126 FFPNQGYGQPVMIGTPSVFPVQGFNSNADAEVLRKAMKGLGCNNSKVISILCQRTNWQRQEISKAFKVMYGKDLIKELKGELHGDFEDLILALMDAPAIYDAKQLHRAMEGLGTKESVLIEIMTSRTNAQIQQVRDAYKMLF-KKDLERDLIGETSGHFKRLLVSLCAGGRDESSQTDGLRANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGN 453          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-2 (Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5])

HSP 1 Score: 288.115 bits (736), Expect = 5.367e-89
Identity = 152/329 (46.20%), Postives = 210/329 (63.83%), Query Frame = 3
Query: 1254 YFETEEYVQEA-----TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            +F  + Y Q       ++FP   FN+N D E LRKAMKGLG + + +I ++ +R+  QR EI + FK + G+DLI +   EL G+F  +  AL   P  YDA +L  AM+GLGT E  LIEI+ +RTNAQI+  ++ YK L+  +DLE+D+I ETS +FKRLL+SL    RDES   D   A QDA+ L +AGEK+ GTDES F+ I+ +++   LR +FEEY+K S  ++E+AI+ E SGDI +GL+  +  I+N+P YFA  L+ SMKGLGT D  L+R+ +TR E DM  I+  FQ+ Y   L   IK D SG Y + L+ L   N
Sbjct:  126 FFPNQGYGQPVMIGTPSVFPVQGFNSNADAEVLRKAMKGLGCNNSKVISILCQRTNWQRQEISKAFKVMYGKDLIKELKGELHGDFEDLILALMDAPAIYDAKQLHRAMEGLGTKESVLIEIMTSRTNAQIQQVRDAYKMLF-KKDLERDLIGETSGHFKRLLVSLCAGGRDESSQTDGLRANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGN 453          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-2 (Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5])

HSP 1 Score: 288.5 bits (737), Expect = 1.319e-88
Identity = 152/329 (46.20%), Postives = 210/329 (63.83%), Query Frame = 3
Query: 1254 YFETEEYVQEA-----TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            +F  + Y Q       ++FP   FN+N D E LRKAMKGLG + + +I ++ +R+  QR EI + FK + G+DLI +   EL G+F  +  AL   P  YDA +L  AM+GLGT E  LIEI+ +RTNAQI+  ++ YK L+  +DLE+D+I ETS +FKRLL+SL    RDES   D   A QDA+ L +AGEK+ GTDES F+ I+ +++   LR +FEEY+K S  ++E+AI+ E SGDI +GL+  +  I+N+P YFA  L+ SMKGLGT D  L+R+ +TR E DM  I+  FQ+ Y   L   IK D SG Y + L+ L   N
Sbjct:  168 FFPNQGYGQPVMIGTPSVFPVQGFNSNADAEVLRKAMKGLGCNNSKVISILCQRTNWQRQEISKAFKVMYGKDLIKELKGELHGDFEDLILALMDAPAIYDAKQLHRAMEGLGTKESVLIEIMTSRTNAQIQQVRDAYKMLF-KKDLERDLIGETSGHFKRLLVSLCAGGRDESSQTDGLRANQDARRLLQAGEKRLGTDESTFNAILASQNFSQLRLVFEEYQKASNHSIEKAIEFEFSGDIRDGLLAVIAVIRNRPAYFAKLLHDSMKGLGTRDNDLIRLCVTRAEYDMGDIRNMFQSLYRTSLENMIKGDCSGAYKEGLIALVNGN 495          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-1 (Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8])

HSP 1 Score: 208.379 bits (529), Expect = 7.658e-61
Identity = 119/315 (37.78%), Postives = 185/315 (58.73%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGT-DESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            AT+     FNA    EK+ +A++    D  A+++V+   S  QR ++ + +K   G+D+I   D + SG+  K   AL   P +YD  +L+AAMKGLGTDE  LIEI+C+RT  Q+++ +  Y++ Y  + LE DI  +TS  F+ LL+SL+  S+D S   +   A  DA  L+  G+ K    D + F  I+  ++   LR +F  +++L+  ++E++I+ E SGD+    +T VR   +K ++FA  L+ SMKGLGT D  L+R+++TR E+D+  IK  FQ  YSK L + +K DTSG Y   LL +   N
Sbjct:    6 ATIVDAREFNAPMFAEKIDRALRAGEKD--AVVNVITSISNAQRQQLREPYKLKYGKDIIQALDKKFSGDLEKAIFALMETPLDYDVKQLKAAMKGLGTDEAVLIEILCSRTVDQLRAIRVTYEKEYG-KALEADIAGDTSGEFRDLLVSLVTGSKDGSHDTNDAQAKDDAVRLFADGKAKLAKKDGTHFLHILATQNQYQLRKVFAYFQELAGGSIEKSIEKEFSGDLQKSYLTIVRAASDKQKFFAQQLHASMKGLGTRDNDLIRVIVTRSEVDLELIKAEFQELYSKSLADTVKGDTSGAYRDALLSIINGN 317          

HSP 2 Score: 76.6406 bits (187), Expect = 7.187e-15
Identity = 62/250 (24.80%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEY-----------DASELRAAMKGLGTDEDA--LIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFV 1991
            E  +F       + D ++L+ AMKGLGTDEA +I+++  R+  Q   I   ++   G+ L AD   + SG F  +  +L  G  +            DA  L A  K     +D    + I+ T+   Q++     +++L A   +EK I  E S + ++  +++++A+ D+ + F + L          A  K  GT ++   ++I+ RS   L  +  E+++L   +L   +K + SG   + L++ +
Sbjct:   75 EKAIFALMETPLDYDVKQLKAAMKGLGTDEAVLIEILCSRTVDQLRAIRVTYEKEYGKALEADIAGDTSGEFRDLLVSLVTGSKDGSHDTNDAQAKDDAVRLFADGKAKLAKKDGTHFLHILATQNQYQLRKVFAYFQEL-AGGSIEKSIEKEFSGDLQKSYLTIVRAASDKQKFFAQQL---------HASMKGLGTRDNDLIRVIVTRSEVDLELIKAEFQELYSKSLADTVKGDTSGAYRDALLSII 314          
BLAST of Annexin vs. Ensembl Celegans
Match: nex-1 (Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8])

HSP 1 Score: 208.379 bits (529), Expect = 7.658e-61
Identity = 119/315 (37.78%), Postives = 185/315 (58.73%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGT-DESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            AT+     FNA    EK+ +A++    D  A+++V+   S  QR ++ + +K   G+D+I   D + SG+  K   AL   P +YD  +L+AAMKGLGTDE  LIEI+C+RT  Q+++ +  Y++ Y  + LE DI  +TS  F+ LL+SL+  S+D S   +   A  DA  L+  G+ K    D + F  I+  ++   LR +F  +++L+  ++E++I+ E SGD+    +T VR   +K ++FA  L+ SMKGLGT D  L+R+++TR E+D+  IK  FQ  YSK L + +K DTSG Y   LL +   N
Sbjct:    6 ATIVDAREFNAPMFAEKIDRALRAGEKD--AVVNVITSISNAQRQQLREPYKLKYGKDIIQALDKKFSGDLEKAIFALMETPLDYDVKQLKAAMKGLGTDEAVLIEILCSRTVDQLRAIRVTYEKEYG-KALEADIAGDTSGEFRDLLVSLVTGSKDGSHDTNDAQAKDDAVRLFADGKAKLAKKDGTHFLHILATQNQYQLRKVFAYFQELAGGSIEKSIEKEFSGDLQKSYLTIVRAASDKQKFFAQQLHASMKGLGTRDNDLIRVIVTRSEVDLELIKAEFQELYSKSLADTVKGDTSGAYRDALLSIINGN 317          

HSP 2 Score: 76.6406 bits (187), Expect = 7.187e-15
Identity = 62/250 (24.80%), Postives = 117/250 (46.80%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEY-----------DASELRAAMKGLGTDEDA--LIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFV 1991
            E  +F       + D ++L+ AMKGLGTDEA +I+++  R+  Q   I   ++   G+ L AD   + SG F  +  +L  G  +            DA  L A  K     +D    + I+ T+   Q++     +++L A   +EK I  E S + ++  +++++A+ D+ + F + L          A  K  GT ++   ++I+ RS   L  +  E+++L   +L   +K + SG   + L++ +
Sbjct:   75 EKAIFALMETPLDYDVKQLKAAMKGLGTDEAVLIEILCSRTVDQLRAIRVTYEKEYGKALEADIAGDTSGEFRDLLVSLVTGSKDGSHDTNDAQAKDDAVRLFADGKAKLAKKDGTHFLHILATQNQYQLRKVFAYFQEL-AGGSIEKSIEKEFSGDLQKSYLTIVRAASDKQKFFAQQL---------HASMKGLGTRDNDLIRVIVTRSEVDLELIKAEFQELYSKSLADTVKGDTSGAYRDALLSII 314          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0334038)

HSP 1 Score: 306.605 bits (784), Expect = 1.044e-97
Identity = 159/312 (50.96%), Postives = 208/312 (66.67%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            T+ P  NF+A +D   LRKAMKG GTDE A+I+++ +RS +QR EI ++FKT  G+DLI D  SE SGNF K+   L     +Y  +EL  AM GLGTDE+ LIEI+CT +N +I + K +Y +LY    LE ++ SETS NFKRLL SL  A+RDES   D   A  DA+EL +AGE + GTDES F+ I+  R+   L+ +F+EYE ++  +LE+AIK E SGD+M GL+   RC+ NK  YFA  L+K+M G+GT+D  L+R++ITR EIDM  IK AF+  Y K L  WIK DTSG Y   L  L GE
Sbjct:    8 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAH-LESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVGE 318          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0074302)

HSP 1 Score: 306.605 bits (784), Expect = 1.044e-97
Identity = 159/312 (50.96%), Postives = 208/312 (66.67%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            T+ P  NF+A +D   LRKAMKG GTDE A+I+++ +RS +QR EI ++FKT  G+DLI D  SE SGNF K+   L     +Y  +EL  AM GLGTDE+ LIEI+CT +N +I + K +Y +LY    LE ++ SETS NFKRLL SL  A+RDES   D   A  DA+EL +AGE + GTDES F+ I+  R+   L+ +F+EYE ++  +LE+AIK E SGD+M GL+   RC+ NK  YFA  L+K+M G+GT+D  L+R++ITR EIDM  IK AF+  Y K L  WIK DTSG Y   L  L GE
Sbjct:    8 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAH-LESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVGE 318          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0334041)

HSP 1 Score: 306.605 bits (784), Expect = 1.044e-97
Identity = 159/312 (50.96%), Postives = 208/312 (66.67%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            T+ P  NF+A +D   LRKAMKG GTDE A+I+++ +RS +QR EI ++FKT  G+DLI D  SE SGNF K+   L     +Y  +EL  AM GLGTDE+ LIEI+CT +N +I + K +Y +LY    LE ++ SETS NFKRLL SL  A+RDES   D   A  DA+EL +AGE + GTDES F+ I+  R+   L+ +F+EYE ++  +LE+AIK E SGD+M GL+   RC+ NK  YFA  L+K+M G+GT+D  L+R++ITR EIDM  IK AF+  Y K L  WIK DTSG Y   L  L GE
Sbjct:    8 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAH-LESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVGE 318          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0334040)

HSP 1 Score: 309.686 bits (792), Expect = 2.276e-96
Identity = 159/312 (50.96%), Postives = 208/312 (66.67%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            T+ P  NF+A +D   LRKAMKG GTDE A+I+++ +RS +QR EI ++FKT  G+DLI D  SE SGNF K+   L     +Y  +EL  AM GLGTDE+ LIEI+CT +N +I + K +Y +LY    LE ++ SETS NFKRLL SL  A+RDES   D   A  DA+EL +AGE + GTDES F+ I+  R+   L+ +F+EYE ++  +LE+AIK E SGD+M GL+   RC+ NK  YFA  L+K+M G+GT+D  L+R++ITR EIDM  IK AF+  Y K L  WIK DTSG Y   L  L GE
Sbjct:  197 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAH-LESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVGE 507          
BLAST of Annexin vs. Ensembl Fly
Match: AnxB11 (gene:FBgn0030749 transcript:FBtr0074303)

HSP 1 Score: 309.686 bits (792), Expect = 2.276e-96
Identity = 159/312 (50.96%), Postives = 208/312 (66.67%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            T+ P  NF+A +D   LRKAMKG GTDE A+I+++ +RS +QR EI ++FKT  G+DLI D  SE SGNF K+   L     +Y  +EL  AM GLGTDE+ LIEI+CT +N +I + K +Y +LY    LE ++ SETS NFKRLL SL  A+RDES   D   A  DA+EL +AGE + GTDES F+ I+  R+   L+ +F+EYE ++  +LE+AIK E SGD+M GL+   RC+ NK  YFA  L+K+M G+GT+D  L+R++ITR EIDM  IK AF+  Y K L  WIK DTSG Y   L  L GE
Sbjct:  197 TVVPAANFDAVKDAHDLRKAMKGFGTDEDALINIICRRSNEQRQEIQRQFKTHFGKDLIEDIKSETSGNFEKLLVGLLRPIVDYYCAELNDAMAGLGTDEEVLIEILCTLSNMEINTIKNQYLRLYGAH-LESELKSETSGNFKRLLTSLCTAARDESGRVDPVAAKNDARELLKAGELRVGTDESMFNMILCQRNYQQLKLIFQEYEGMTGHSLEKAIKKEFSGDVMEGLIAIYRCVTNKAEYFASRLHKAMAGIGTNDTQLIRVIITRSEIDMTDIKVAFERLYGKSLKSWIKGDTSGHYKHALYALVGE 507          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa11a (annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4])

HSP 1 Score: 315.849 bits (808), Expect = 4.622e-99
Identity = 156/310 (50.32%), Postives = 215/310 (69.35%), Query Frame = 3
Query: 1299 FPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            FP  +   D E LRKAMKG GTDE AII+++G RS KQR+ ++  +KT  G+DLI D  SELSGNF K+  A+   P +YDA EL+ A+KG GTDE  LIEI+ +R+NA+I+   + +K     + LE  I  +TS +F+RLL+SL Q +RDES+  D ++A  DA+ LY+AGE K GTDESKF+ I+  RS  HLRA+F EY+ +    +E++I+ EMSGD+ +G++  V+CI+N P YFA  L+K+MKG GT DRTL+RI++TR E+DM+ I++ +   Y K L   I  DTSGDY K+LL L G +D
Sbjct:  175 FPGADPLRDAEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLVSYKTAYGKDLIKDLKSELSGNFEKLVLAMLKTPSQYDAYELKEAIKGAGTDEACLIEILASRSNAEIREINQVFKAE-NKKSLEDAISGDTSGHFRRLLVSLAQGNRDESENVDISIAKTDAQALYQAGENKLGTDESKFNAILCARSKAHLRAVFNEYQHMCGRDIEKSIEREMSGDLESGMLAVVKCIKNTPAYFAERLHKAMKGAGTKDRTLIRIMVTRSEVDMLDIRQEYAKNYGKSLYTAISGDTSGDYKKLLLKLCGGSD 483          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa11a (annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4])

HSP 1 Score: 316.235 bits (809), Expect = 1.286e-98
Identity = 156/310 (50.32%), Postives = 215/310 (69.35%), Query Frame = 3
Query: 1299 FPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            FP  +   D E LRKAMKG GTDE AII+++G RS KQR+ ++  +KT  G+DLI D  SELSGNF K+  A+   P +YDA EL+ A+KG GTDE  LIEI+ +R+NA+I+   + +K     + LE  I  +TS +F+RLL+SL Q +RDES+  D ++A  DA+ LY+AGE K GTDESKF+ I+  RS  HLRA+F EY+ +    +E++I+ EMSGD+ +G++  V+CI+N P YFA  L+K+MKG GT DRTL+RI++TR E+DM+ I++ +   Y K L   I  DTSGDY K+LL L G +D
Sbjct:  218 FPGADPLRDAEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLVSYKTAYGKDLIKDLKSELSGNFEKLVLAMLKTPSQYDAYELKEAIKGAGTDEACLIEILASRSNAEIREINQVFKAE-NKKSLEDAISGDTSGHFRRLLVSLAQGNRDESENVDISIAKTDAQALYQAGENKLGTDESKFNAILCARSKAHLRAVFNEYQHMCGRDIEKSIEREMSGDLESGMLAVVKCIKNTPAYFAERLHKAMKGAGTKDRTLIRIMVTRSEVDMLDIRQEYAKNYGKSLYTAISGDTSGDYKKLLLKLCGGSD 526          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa11b (annexin A11b [Source:ZFIN;Acc:ZDB-GENE-030707-5])

HSP 1 Score: 309.301 bits (791), Expect = 1.554e-96
Identity = 151/310 (48.71%), Postives = 217/310 (70.00%), Query Frame = 3
Query: 1299 FPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            FP  +   D E LRKAMKG GTDE AII+++G RS KQR+ ++  +KT  G+DL+ D  SEL+G+F ++  A+   P ++DASE + A+ G GTDE  LIEI+ +R+NA+I+     YK  Y  + LE  I ++TS +F+RLL+SL Q +RDE +T D +LA QDA++LY AGE K GTDES+F+ I+  RS PHLR +F+EY+++    +E++I  EMSGD+ +G+V  V+CI+N P YFA  L+K+M+G GT DRTL+RI+++R E+DM+ I++ +   + K L   I  DTSGDY K+LL L G +D
Sbjct:  177 FPGADPLRDVEVLRKAMKGFGTDENAIIELLGSRSNKQRVPLLAAYKTTYGKDLVRDLKSELTGHFEELVLAMLKSPAQFDASECKEAISGAGTDEACLIEILSSRSNAEIQEINRIYKAEYG-KSLEDAISNDTSGHFRRLLVSLCQGNRDERETVDISLAKQDAQKLYSAGENKVGTDESQFNAILCARSKPHLRQVFQEYQQMCGRDIEKSICREMSGDLESGMVAVVKCIKNTPAYFAERLHKAMQGAGTKDRTLIRIMVSRSELDMLDIRQEYLRLFGKSLYTHISGDTSGDYKKLLLKLCGGSD 485          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa5b (annexin A5b [Source:ZFIN;Acc:ZDB-GENE-030131-9076])

HSP 1 Score: 281.952 bits (720), Expect = 2.278e-88
Identity = 147/315 (46.67%), Postives = 207/315 (65.71%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+ P   FNAN D E L KAMKGLGTDE +I+ ++ KRS  QR EI   +KTL G+DL+ D  SEL G F  +  AL   P  Y+ + LR A+KG GTDE  LIEI+ +R+  ++   K  YK+ +  +DLE+D+  +T  +F+R+L+ LLQASR   Q    +L   DA+ L+ AGE+K+GTDE +F  I+ NRSN HLR +FEEY KLS   +E++I+ E SG +   L+  V+C ++ P YFA +L  +MKG GTDD+TL+RI++TR E+D++ I+  F+  ++  L + I+ DTSGDY K LL L G +D
Sbjct:    5 GTVKPQSGFNANSDAEVLYKAMKGLGTDEDSILQLLTKRSNGQRQEIKAAYKTLHGKDLVNDLKSELGGKFEDLIVALMTPPIIYEVTCLRNAIKGAGTDEKVLIEILASRSPNEVNEIKSSYKREH-DKDLEEDVTGDTGGHFERMLVVLLQASR--QQGIQESLIQSDAQALFAAGEQKYGTDEGQFITILGNRSNAHLRRVFEEYRKLSGFEIEESIQRETSGSLQEILLAVVKCARSVPGYFADSLYAAMKGAGTDDQTLIRIMVTRSEVDLLDIRAEFRKRFATSLHKMIQSDTSGDYRKTLLLLCGGDD 316          
BLAST of Annexin vs. Ensembl Zebrafish
Match: anxa4 (annexin A4 [Source:ZFIN;Acc:ZDB-GENE-030707-1])

HSP 1 Score: 280.411 bits (716), Expect = 1.262e-87
Identity = 147/312 (47.12%), Postives = 203/312 (65.06%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTG 2219
             T+     F   +D +K+  AMKG GT+EA II+++  R+  QR +I + FK  +G++L+    SEL+GNF K+   L +    YDA ELR A+KG GT+E  LI+I+ +R+NA+IK     YK+ +  + LE DI  +TS  F+R+L+SLL A RDES   D   A+QDAK++YEAGE ++GTDE KF  ++  R+  HL  +F+EY+K S   +E +IK EMSG + +  +  V+CI+NKP +FA  L KSMKGLGT D  L+RI++ R EIDM+ IK  F   Y K L  +IK DTSGDY KILL L G
Sbjct:    8 GTVTEASGFKPEDDAQKIYNAMKGAGTNEATIIEILAHRTIAQRQKIKEAFKLSVGKELMDCLKSELTGNFEKVVVGLMMPAAVYDAHELRNAIKGAGTEEACLIDILASRSNAEIKEIVAAYKKEH-DKSLEDDICGDTSGMFQRVLVSLLTAGRDESTKVDEAQAVQDAKDIYEAGEARWGTDEVKFLTVLCVRNRNHLLRVFQEYQKKSGRDIEDSIKREMSGSLEDVFLAIVKCIKNKPAFFAERLYKSMKGLGTTDSVLIRIMVARAEIDMLDIKAEFLKMYGKTLHSFIKGDTSGDYRKILLELCG 318          
BLAST of Annexin vs. Ensembl Xenopus
Match: mllt10 (MLLT10, histone lysine methyltransferase DOT1L cofactor [Source:Xenbase;Acc:XB-GENE-6408100])

HSP 1 Score: 318.161 bits (814), Expect = 5.212e-102
Identity = 162/316 (51.27%), Postives = 217/316 (68.67%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            + T+ P+ NFNA +D +KLRKAMKG GTDE AIIDV+  R+  QR EI   +KT +G+DL  D  SEL+GNF K+   L      YD  EL+ AMKG GTDE  LIEI+ +R+  +IK+    Y+  Y  + LE DI S+TS  F+R+L+SL    RD+S   +  LA QDA ELYEAGEKK+GTDE KF  I+ +R+  HL  +F+EY+K++K  LE +IKSEMSG   + L+  V+C++++P YFA  L KSMKGLGTDD+TL+R++++RCEIDM++I+  F+  Y K L  +IK D SGDY K+LL L G  D
Sbjct:    5 KGTIKPYANFNAADDVQKLRKAMKGAGTDEDAIIDVIANRTLSQRQEIKTAYKTTIGKDLEDDLKSELTGNFEKVIVGLITPSTLYDVEELKKAMKGAGTDEGCLIEILASRSAEEIKNINITYRIKYG-KSLEDDICSDTSFMFQRVLVSLAAGGRDQSTNVNEALAKQDANELYEAGEKKWGTDEVKFLTILCSRNRNHLLKVFDEYKKIAKKDLEASIKSEMSGHFEDALLAVVKCLRSRPGYFAERLYKSMKGLGTDDKTLIRVMVSRCEIDMLEIRSEFKKMYGKSLHSFIKGDCSGDYRKVLLKLCGGED 319          
BLAST of Annexin vs. Ensembl Xenopus
Match: mllt10 (MLLT10, histone lysine methyltransferase DOT1L cofactor [Source:Xenbase;Acc:XB-GENE-6408100])

HSP 1 Score: 318.161 bits (814), Expect = 5.511e-102
Identity = 162/316 (51.27%), Postives = 217/316 (68.67%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            + T+ P+ NFNA +D +KLRKAMKG GTDE AIIDV+  R+  QR EI   +KT +G+DL  D  SEL+GNF K+   L      YD  EL+ AMKG GTDE  LIEI+ +R+  +IK+    Y+  Y  + LE DI S+TS  F+R+L+SL    RD+S   +  LA QDA ELYEAGEKK+GTDE KF  I+ +R+  HL  +F+EY+K++K  LE +IKSEMSG   + L+  V+C++++P YFA  L KSMKGLGTDD+TL+R++++RCEIDM++I+  F+  Y K L  +IK D SGDY K+LL L G  D
Sbjct:    7 KGTIKPYANFNAADDVQKLRKAMKGAGTDEDAIIDVIANRTLSQRQEIKTAYKTTIGKDLEDDLKSELTGNFEKVIVGLITPSTLYDVEELKKAMKGAGTDEGCLIEILASRSAEEIKNINITYRIKYG-KSLEDDICSDTSFMFQRVLVSLAAGGRDQSTNVNEALAKQDANELYEAGEKKWGTDEVKFLTILCSRNRNHLLKVFDEYKKIAKKDLEASIKSEMSGHFEDALLAVVKCLRSRPGYFAERLYKSMKGLGTDDKTLIRVMVSRCEIDMLEIRSEFKKMYGKSLHSFIKGDCSGDYRKVLLKLCGGED 321          
BLAST of Annexin vs. Ensembl Xenopus
Match: mllt10 (MLLT10, histone lysine methyltransferase DOT1L cofactor [Source:Xenbase;Acc:XB-GENE-6408100])

HSP 1 Score: 317.775 bits (813), Expect = 1.686e-101
Identity = 162/319 (50.78%), Postives = 218/319 (68.34%), Query Frame = 3
Query: 1272 YVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            +  + T+ P+ NFNA +D +KLRKAMKG GTDE AIIDV+  R+  QR EI   +KT +G+DL  D  SEL+GNF K+   L      YD  EL+ AMKG GTDE  LIEI+ +R+  +IK+    Y+  Y  + LE DI S+TS  F+R+L+SL    RD+S   +  LA QDA ELYEAGEKK+GTDE KF  I+ +R+  HL  +F+EY+K++K  LE +IKSEMSG   + L+  V+C++++P YFA  L KSMKGLGTDD+TL+R++++RCEIDM++I+  F+  Y K L  +IK D SGDY K+LL L G  D
Sbjct:   24 WGTKGTIKPYANFNAADDVQKLRKAMKGAGTDEDAIIDVIANRTLSQRQEIKTAYKTTIGKDLEDDLKSELTGNFEKVIVGLITPSTLYDVEELKKAMKGAGTDEGCLIEILASRSAEEIKNINITYRIKYG-KSLEDDICSDTSFMFQRVLVSLAAGGRDQSTNVNEALAKQDANELYEAGEKKWGTDEVKFLTILCSRNRNHLLKVFDEYKKIAKKDLEASIKSEMSGHFEDALLAVVKCLRSRPGYFAERLYKSMKGLGTDDKTLIRVMVSRCEIDMLEIRSEFKKMYGKSLHSFIKGDCSGDYRKVLLKLCGGED 341          
BLAST of Annexin vs. Ensembl Xenopus
Match: mllt10 (MLLT10, histone lysine methyltransferase DOT1L cofactor [Source:Xenbase;Acc:XB-GENE-6408100])

HSP 1 Score: 318.161 bits (814), Expect = 2.405e-101
Identity = 162/316 (51.27%), Postives = 217/316 (68.67%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            + T+ P+ NFNA +D +KLRKAMKG GTDE AIIDV+  R+  QR EI   +KT +G+DL  D  SEL+GNF K+   L      YD  EL+ AMKG GTDE  LIEI+ +R+  +IK+    Y+  Y  + LE DI S+TS  F+R+L+SL    RD+S   +  LA QDA ELYEAGEKK+GTDE KF  I+ +R+  HL  +F+EY+K++K  LE +IKSEMSG   + L+  V+C++++P YFA  L KSMKGLGTDD+TL+R++++RCEIDM++I+  F+  Y K L  +IK D SGDY K+LL L G  D
Sbjct:   50 KGTIKPYANFNAADDVQKLRKAMKGAGTDEDAIIDVIANRTLSQRQEIKTAYKTTIGKDLEDDLKSELTGNFEKVIVGLITPSTLYDVEELKKAMKGAGTDEGCLIEILASRSAEEIKNINITYRIKYG-KSLEDDICSDTSFMFQRVLVSLAAGGRDQSTNVNEALAKQDANELYEAGEKKWGTDEVKFLTILCSRNRNHLLKVFDEYKKIAKKDLEASIKSEMSGHFEDALLAVVKCLRSRPGYFAERLYKSMKGLGTDDKTLIRVMVSRCEIDMLEIRSEFKKMYGKSLHSFIKGDCSGDYRKVLLKLCGGED 364          
BLAST of Annexin vs. Ensembl Xenopus
Match: trpv3 (transient receptor potential cation channel, subfamily V, member 3 [Source:Xenbase;Acc:XB-GENE-1013149])

HSP 1 Score: 306.99 bits (785), Expect = 1.009e-97
Identity = 161/314 (51.27%), Postives = 211/314 (67.20%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            + T+   PNF+A  D EKLRKAMKG GTDE AI+DV+  RS  QR +I   FKT  G+DLI D  SELSGN  ++  AL +    YDA  L  AMKG GT E  LIEI+CTRTN++IK+    YK  +  RD+EKDI S+TS +F+RLLIS+ Q +RDE+Q  +   A QDA+ LY+AGE K GTDES F+ ++ +RS P LRA+ E Y ++SK  L   I  E SG I +GL   ++C  N+P +FA  L +SMKG GTDD TL+RI++TR EID+VQIK+A+   + K L   I  DTSGDY ++L+ + G+
Sbjct:    7 QGTIKAAPNFDALSDAEKLRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTAYGKDLIKDLKSELSGNVEELIIALFMPATYYDAWSLYHAMKGAGTQERVLIEILCTRTNSEIKNIVSCYKHEFG-RDIEKDIRSDTSGHFERLLISMCQGNRDENQNVNLQQAEQDAQRLYQAGEGKLGTDESSFNLVLASRSFPQLRAVAEAYARISKRDLISVIGREFSGYIEDGLKAVLQCAINRPAFFAERLYRSMKGAGTDDSTLIRIIVTRSEIDLVQIKQAYVQMHQKSLSAAISSDTSGDYRRLLIAIAGQ 319          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa4 (annexin A4 [Source:MGI Symbol;Acc:MGI:88030])

HSP 1 Score: 311.612 bits (797), Expect = 1.346e-99
Identity = 161/315 (51.11%), Postives = 214/315 (67.94%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+     FNA ED + LRKAMKGLGTDE AII ++  R+  QR EI   +K+ +GRDLI D  SELS NF ++   L      YD  ELR AMKG GTDE  LIEI+ +RT  +I+   + Y+Q Y  R LE+DI S+TS  F+R+L+SL  A RDE    D  L  QDA+ELYEAGEK++GTDE KF  I+ +R+  HL  +F+EY+++S+  +EQ+IKSE SG   + L+  V+C+++KP YFA  L KSMKGLGTDD TL+R++++R EIDM+ I+ +F+  Y K L  +IK DTSGDY K+LL L G +D
Sbjct:    6 GTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYG-RSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD 319          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa4 (annexin A4 [Source:MGI Symbol;Acc:MGI:88030])

HSP 1 Score: 311.612 bits (797), Expect = 1.346e-99
Identity = 161/315 (51.11%), Postives = 214/315 (67.94%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+     FNA ED + LRKAMKGLGTDE AII ++  R+  QR EI   +K+ +GRDLI D  SELS NF ++   L      YD  ELR AMKG GTDE  LIEI+ +RT  +I+   + Y+Q Y  R LE+DI S+TS  F+R+L+SL  A RDE    D  L  QDA+ELYEAGEK++GTDE KF  I+ +R+  HL  +F+EY+++S+  +EQ+IKSE SG   + L+  V+C+++KP YFA  L KSMKGLGTDD TL+R++++R EIDM+ I+ +F+  Y K L  +IK DTSGDY K+LL L G +D
Sbjct:    6 GTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYG-RSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD 319          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa7 (annexin A7 [Source:MGI Symbol;Acc:MGI:88031])

HSP 1 Score: 310.071 bits (793), Expect = 4.510e-97
Identity = 159/314 (50.64%), Postives = 208/314 (66.24%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            + T+ P  NF+A  D E LRKAMKG GTDE AI+DV+  RS  QR +I   FKT+ G+DLI D  SELSGN  ++  AL +    YDA  LR AM+G GT E  LIEI+CTRTN +I+     Y QL   RDLEKDI S+TS +F+RLL+S+ Q +RDE Q+ +  +A +DA+ LY+AGE + GTDES F+ I+  RS P L+A  E Y +++   L  ++  E SG + +GL T ++C  N+P +FA  L  SMKG GTDD TL+RIV+TR EID+VQIK+ F   Y K L   I  DTSGDY K+LL + G+
Sbjct:  151 QGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCY-QLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDERQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIVGQ 463          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa7 (annexin A7 [Source:MGI Symbol;Acc:MGI:88031])

HSP 1 Score: 310.071 bits (793), Expect = 4.510e-97
Identity = 159/314 (50.64%), Postives = 208/314 (66.24%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            + T+ P  NF+A  D E LRKAMKG GTDE AI+DV+  RS  QR +I   FKT+ G+DLI D  SELSGN  ++  AL +    YDA  LR AM+G GT E  LIEI+CTRTN +I+     Y QL   RDLEKDI S+TS +F+RLL+S+ Q +RDE Q+ +  +A +DA+ LY+AGE + GTDES F+ I+  RS P L+A  E Y +++   L  ++  E SG + +GL T ++C  N+P +FA  L  SMKG GTDD TL+RIV+TR EID+VQIK+ F   Y K L   I  DTSGDY K+LL + G+
Sbjct:  151 QGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCY-QLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDERQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIVGQ 463          
BLAST of Annexin vs. Ensembl Mouse
Match: Anxa7 (annexin A7 [Source:MGI Symbol;Acc:MGI:88031])

HSP 1 Score: 310.842 bits (795), Expect = 4.927e-97
Identity = 170/373 (45.58%), Postives = 227/373 (60.86%), Query Frame = 3
Query: 1128 PKPEEIPKGHSVEEKVRQAKGEKAAPIELKTEEK------PPEKVENAYFETEEYVQ--EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            P P   P G    +      G+   P ++ TE        PP  ++ +  +     Q  + T+ P  NF+A  D E LRKAMKG GTDE AI+DV+  RS  QR +I   FKT+ G+DLI D  SELSGN  ++  AL +    YDA  LR AM+G GT E  LIEI+CTRTN +I+     Y QL   RDLEKDI S+TS +F+RLL+S+ Q +RDE Q+ +  +A +DA+ LY+AGE + GTDES F+ I+  RS P L+A  E Y +++   L  ++  E SG + +GL T ++C  N+P +FA  L  SMKG GTDD TL+RIV+TR EID+VQIK+ F   Y K L   I  DTSGDY K+LL + G+
Sbjct:  118 PVPGGFPGGQMPSQY---PGGQAPYPSQINTESSSSYPAFPPVSLDYSS-DPASMTQGTQGTILPASNFDAMRDAEILRKAMKGFGTDEQAIVDVVSNRSNDQRQQIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIRDIVRCY-QLEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDERQSVNHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFTQMYQKTLSTMIASDTSGDYRKLLLAIVGQ 485          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P26256|ANX12_HYDVU (Annexin-B12 OS=Hydra vulgaris OX=6087 GN=ANXB12 PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 6.727e-101
Identity = 161/315 (51.11%), Postives = 219/315 (69.52%), Query Frame = 3
Query: 1275 VQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTG 2219
            V + T+ P  +FN+ ED E LRKAMKG+GTDE +I  ++  RS  QR +I   + TL G+ L  +  SELSGN+     AL   PDE+ A +L AAMKGLGTDE+ALI+I+CT++NAQI + K  +K LY   DLEK+IISETS NF+RLL+S+LQ  R E +  +   A +DA  +Y+AGE + GTDES+F+ ++  RS P L  +F EY K+S  T+ QAI++E SGDI NGL+  V+ ++N+  YFA  L+ +MKGLGT D+TL+RI+++R EID+  IK+ FQA Y K L E+I DD SGDY  +LL +TG
Sbjct:    2 VVQGTVKPHASFNSREDAETLRKAMKGIGTDEKSITHILATRSNAQRQQIKTDYTTLFGKHLEDELKSELSGNYEAAALALLRKPDEFLAEQLHAAMKGLGTDENALIDILCTQSNAQIHAIKAAFKLLY-KEDLEKEIISETSGNFQRLLVSMLQGGRKEDEPVNAAHAAEDAAAIYQAGEGQIGTDESRFNAVLATRSYPQLHQIFHEYSKISNKTILQAIENEFSGDIKNGLLAIVKSVENRFAYFAERLHHAMKGLGTSDKTLIRILVSRSEIDLANIKETFQAMYGKSLYEFIADDCSGDYKDLLLQITG 315          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P97429|ANXA4_MOUSE (Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4)

HSP 1 Score: 311.612 bits (797), Expect = 9.414e-99
Identity = 161/315 (51.11%), Postives = 214/315 (67.94%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+     FNA ED + LRKAMKGLGTDE AII ++  R+  QR EI   +K+ +GRDLI D  SELS NF ++   L      YD  ELR AMKG GTDE  LIEI+ +RT  +I+   + Y+Q Y  R LE+DI S+TS  F+R+L+SL  A RDE    D  L  QDA+ELYEAGEK++GTDE KF  I+ +R+  HL  +F+EY+++S+  +EQ+IKSE SG   + L+  V+C+++KP YFA  L KSMKGLGTDD TL+R++++R EIDM+ I+ +F+  Y K L  +IK DTSGDY K+LL L G +D
Sbjct:    6 GTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTIGRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRINQTYQQQYG-RSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQELYEAGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD 319          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P20072|ANXA7_BOVIN (Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 1.214e-97
Identity = 161/314 (51.27%), Postives = 209/314 (66.56%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
              T+ P  NF+A  D E LRKAMKG GTDE AIIDV+  RS  QR +I   FKT+ G+DLI D  SELSGN  ++  AL +    YDA  LR AMKG GT E  LIEI+CTRTN +I+     Y+  +  RDLEKDI S+TS +F+RLL+S+ Q +RDE+Q  +  LA +DA+ LY+AGE + GTDES F+ I+  RS P L+A  E Y +++   L  ++  E SG++ +GL T ++C  N+P +FA  L  SMKG GTDD TL+RIV+TR EID+VQIK+ F   Y K LG  I  DTSGDY K+LL + G+
Sbjct:  151 HGTIRPAANFDAMRDAEVLRKAMKGFGTDEQAIIDVVANRSNDQRQKIKAAFKTMYGKDLIKDLKSELSGNMEELILALFMPSTYYDAWSLRNAMKGAGTQERVLIEILCTRTNQEIREIVRCYQSEFG-RDLEKDIRSDTSGHFERLLVSMCQGNRDENQNVNHQLAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLKATMEAYSRMANRDLLNSVSREFSGNVESGLKTILQCALNRPAFFAERLYYSMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFSQMYQKTLGTMIASDTSGDYRKLLLAIVGQ 463          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P09525|ANXA4_HUMAN (Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4)

HSP 1 Score: 308.145 bits (788), Expect = 2.409e-97
Identity = 160/315 (50.79%), Postives = 211/315 (66.98%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+     FNA ED + LRKAMKGLGTDE AII V+  R+  QR EI   +K+ +GRDLI D  SELSGNF ++   +      YD  ELR AMKG GTDE  LIEI+ +RT  +I+   + Y+Q Y  R LE DI S+TS  F+R+L+SL    RDE    D  L  QDA++LYEAGEKK+GTDE KF  ++ +R+  HL  +F+EY+++S+  +EQ+IKSE SG   + L+  V+C++NK  YFA  L KSMKGLGTDD TL+R++++R EIDM+ I+  F+  Y K L  +IK DTSGDY K+LL L G +D
Sbjct:    6 GTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYG-RSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD 319          
BLAST of Annexin vs. UniProt/SwissProt
Match: sp|P20073|ANXA7_HUMAN (Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 SV=3)

HSP 1 Score: 313.538 bits (802), Expect = 3.882e-97
Identity = 159/316 (50.32%), Postives = 211/316 (66.77%), Query Frame = 3
Query: 1275 VQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            V + T+ P  NF+A  D E LRKAMKG GTDE AI+DV+  RS  QR +I   FKT  G+DLI D  SELSGN  ++  AL + P  YDA  LR AM+G GT E  LIEI+CTRTN +I+     Y+  +  RDLEKDI S+TS +F+RLL+S+ Q +RDE+Q+ +  +A +DA+ LY+AGE + GTDES F+ I+  RS P LRA  E Y +++   L  ++  E SG + +GL T ++C  N+P +FA  L  +MKG GTDD TL+RIV+TR EID+VQIK+ F   Y K LG  I  DTSGDY ++LL + G+
Sbjct:  174 VTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFG-RDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ 488          
BLAST of Annexin vs. TrEMBL
Match: A0A0R3SU08 (Annexin OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8941 PE=3 SV=2)

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 369/743 (49.66%), Postives = 500/743 (67.29%), Query Frame = 3
Query:   48 MPLAGGVAAPSVAXXXXXXXXXXXXHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYXXXXXXXXXXXXXXYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESAVDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVXXXXXXXXXXXXXXXDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEI-------FPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLANXXXXXXXXXXXXXXXSQKSLRPKPEE------IPKGHSVEEKVRQAKGEKAAPIELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLIK 2237
            MPLAGG++AP++ PL+LN  GK  N IDTGT+IEL  E+PNC++YFTT+G  PNP  R+  G+E+T+RY  PF LK G+RT+KAIA+HKV + ESHV++KTF         +  E  +   S      D      P +N     +  + ++D+F+ + +DQGF+ATN SGTQIN++G  PG+GWD++TP    FS  ++P  Q         QP+  + QQ QL A+ N L Q ID  RQ TV EVR +L +   + +KA+P           P+        +P       LK  L  I      +A  + +    +  + +GK++  ++D  ++ +++TI L                  +K  + KPE+      IP+GH VE +VRQ++ +KAAPIELK EEKPPEK+EN+YFETEEY  E TL P PNF+ N DC+ LRKAMKGLGTDE AIIDV+ +RS  QR++IV++FKTL G DLIA+ DSE+SGNF K+C+ALC+ P+ +DA ELR A++G+GTDED LIEIIC RTN QI   KE Y+++Y  RDLEKD+  +TS +F+RLL++LLQ +RDE  TFDR  A QDA+EL  AGEKK GTDESKF++I+++RSN HLRA+F+EYEKLSK ++E+A+KSEMSGDI+   ++ VR +QNKP +FA  L++SMKGLGTDD +L+R+V++RCEIDMVQIK AF+AEY + LGE+IKDDTSGDY   LL L G+  L+K
Sbjct:    1 MPLAGGISAPTITPLRLNVSGKASNTIDTGTFIELGNESPNCIIYFTTNGETPNPSHRIFAGREVTFRYRAPFQLKAGRRTVKAIAVHKVNRSESHVVSKTF---------NVTEITHSGSSGSVSGDDYPTSIVPVHNDAA--SSMDDSLDSFMRKGTDQGFAATNHSGTQINVYGSVPGVGWDMKTPDGNNFSSNFLPPLQPQQVYAPLMQPEPGVTQQ-QLTAVVNHLNQYIDQMRQRTVMEVRESLSQAITHILKAIPKPQPIPAPAPIPQPAPKPAVEYP-----SYLKGPLGQIMQQFSSYATTSSNIFNELCGSDVGKVIGGDWDDADDRYVLTIELEKK--------------GRKPSKSKPEKRNPKLAIPEGHEVETEVRQSRNQKAAPIELKKEEKPPEKIENSYFETEEYKCEGTLKPAPNFDCNADCQSLRKAMKGLGTDEKAIIDVLARRSISQRLDIVKQFKTLYGLDLIAELDSEISGNFFKVCRALCLEPEVFDAEELREAVEGIGTDEDCLIEIICCRTNEQILKIKEAYRKIY-NRDLEKDVRDDTSGHFQRLLVALLQGNRDECPTFDRKKAKQDAEELLAAGEKKMGTDESKFNEILISRSNAHLRAVFQEYEKLSKKSIEEALKSEMSGDILRAFLSVVRSVQNKPNFFAKTLHRSMKGLGTDDESLIRVVVSRCEIDMVQIKDAFKAEYKQTLGEFIKDDTSGDYRLTLLTLIGDESLVK 711          
BLAST of Annexin vs. TrEMBL
Match: A0A068Y0U8 (Annexin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001169900 PE=3 SV=1)

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 372/730 (50.96%), Postives = 498/730 (68.22%), Query Frame = 3
Query:   48 MPLAGGVAAPSVAXXXXXXXXXXXXHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYXXXXXXXXXXXXXXYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESAVDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVXXXXXXXXXXXXXXXDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEI-FPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLANXXXXXXXXXXXXXXXSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAAPIELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLI 2234
            MPLAGGV AP++ PL+LN PGKP N IDTGT+IEL  E P+C++YFTT+G  PNP  R+  G+E+TYRY  PF LK G+RT+KAIA+H+VTK ESH+++KTF V ++    S      E  S   Y   I    +  ++S       +  +D+FL +++DQGF+ATN SGTQIN++G  PG+GWD++TP    FS  ++P  Q P        P    + Q QL A+ + LTQ ID  RQ TV EVR +L +   + +KA+P    P +   +P + FPIS G       L  I+     +A  N +    +  A +GK++  + D  ++ +++ I L     K    P       +   R      P+GH VE +VRQA+ +KAA IELK EEKP EKVENA+FETEEY  E TL P  NF+ N DC++LRKAMKGLGTDE AIIDV+ +RS  QR++IV++FKTL G DLI + DSE+SG   K+C+ALC+ P+ YDA ELR A++G+GTDED LIEIIC RTNAQI   KE Y++++ +RDLEKD+  +TS +F+RL+ISLLQ +R+ES TFDRN A +DA+EL  AGE+K GTDESKF++I+++RSN HLRA+FEEYEK+ K T+E+A+KSEMSGD++   ++ VR IQNKP +FA  L++SMKG+GTDD +L+R+++TRCEIDMVQIK AF+AEY   LGE+IKDDTSGDY   LL L GE  L+
Sbjct:    1 MPLAGGVPAPTITPLRLNVPGKPSNTIDTGTFIELGREGPDCLIYFTTNGETPNPSHRIFAGREVTYRYRAPFQLKSGRRTVKAIAVHRVTKAESHIVSKTFTVIELAHSGSS-----ESISGDEYPKSIVPAHSDTHSSM------DDTLDSFLKKSTDQGFAATNHSGTQINVYGSVPGVGWDMKTPDGNNFSSNFLPPLQAPQMYASPLIPPEPGVTQQQLTAVVSHLTQYIDQMRQRTVMEVRESLTQAIGHILKAIPKPQPPPQPIQQPAVDFPISKG------PLSQIFQQFSSYATNNSNIAYELSGADVGKVIGGDLDDADDRYVLAIELEKKGRKPSARPSAASNKHKSDKRNPKVTAPEGHEVETQVRQARNQKAAAIELKKEEKPLEKVENAFFETEEYKSEGTLKPAANFDCNADCQRLRKAMKGLGTDENAIIDVLARRSISQRLDIVKQFKTLFGLDLIDELDSEISGKLFKVCRALCLEPEVYDAEELREAVEGIGTDEDCLIEIICCRTNAQIAKIKEAYRRVF-SRDLEKDVKDDTSGHFQRLMISLLQGNRNESPTFDRNKARKDAEELLAAGEEKSGTDESKFNEILISRSNAHLRAVFEEYEKVGKRTVEEALKSEMSGDLLRAFLSIVRSIQNKPAFFAKTLHRSMKGMGTDDESLIRVIVTRCEIDMVQIKDAFKAEYEATLGEFIKDDTSGDYRLALLTLIGEESLV 712          
BLAST of Annexin vs. TrEMBL
Match: U6JES0 (Annexin OS=Echinococcus granulosus OX=6210 GN=EGR_06120 PE=3 SV=1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 373/730 (51.10%), Postives = 496/730 (67.95%), Query Frame = 3
Query:   48 MPLAGGVAAPSVAXXXXXXXXXXXXHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYXXXXXXXXXXXXXXYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESAVDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVXXXXXXXXXXXXXXXDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEI-FPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLANXXXXXXXXXXXXXXXSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAAPIELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLI 2234
            MPLAGGV AP++ PL+LN PGKP N IDTGT+IEL  E P+C++YFTT+G  PNP  R+  G+E+TYRY  PF LK G+RT+KAIA+H+VTK ESH+++KTF V +I    S      E  S   Y   I    +  ++S       +  +D+FL +++DQGF+ATN SGTQIN++G  PG+GWD++TP    FS  ++P  Q P        P    + Q QL A+ + LTQ ID  RQ TV EVR +L +   + +KA+P    P +   +P + FP+      LK  L  I+     +A  N +    +  A +GK++  + D  ++ +++ I L     K    P       +   R      P+GH VE +VRQA+ +KAA IELK EEKP EKVENA+FETEEY  E TL P  NF+ N DC++LRKAMKGLGTDE AIIDV+ +RS  QR++I ++FKTL G DLI + DSE+SG   K+C+ALC+ P+ YDA ELR A++G+GTDED LIEIIC RTNAQI   KE YK+++ +RDLEKD+  +TS +F+RL+ISLLQ +R+ES TFDRN A +DA+EL  AGEK  GTDESKF++I+++RSN HLRA+FEEYEK+ K T+E+A+KSEMSGD++   ++ VR IQNKP +FA  L++SMKG+GTDD +L+R++ITRCEIDMVQIK AF+AEY   LGE+IKDDTSGDY   LL L GE  L+
Sbjct:    1 MPLAGGVPAPTITPLRLNVPGKPSNTIDTGTFIELGKEGPDCLIYFTTNGETPNPSHRIFAGREVTYRYRAPFQLKSGRRTVKAIAVHRVTKAESHIVSKTFTVIEIAHSGSS-----ESISGDEYPKSIVPAHSDTHSSM------DDTLDSFLKKSTDQGFAATNHSGTQINVYGSVPGVGWDMKTPDGNNFSSNFLPPLQAPQMYASPLIPPEPGVTQQQLTAVVSHLTQYIDQMRQRTVMEVRESLTQAIGHILKAIPKPQPPPQPIQQPAVDFPM------LKGPLSQIFQQFSSYATNNSNIAYELSGADVGKVIGGDLDDADDRYVLAIELEKKGRKPSARPSAASNKHKSDKRNPKVTAPEGHEVETQVRQARNQKAAAIELKKEEKPLEKVENAFFETEEYKSEGTLKPAANFDCNADCQRLRKAMKGLGTDEKAIIDVLARRSISQRLDIAKQFKTLFGLDLIDELDSEISGKLFKVCRALCLEPEVYDAEELREAVEGIGTDEDCLIEIICCRTNAQIAKIKEAYKKVF-SRDLEKDVQDDTSGHFQRLMISLLQGNRNESPTFDRNKARKDAEELLAAGEKS-GTDESKFNEILISRSNAHLRAVFEEYEKMGKRTVEEALKSEMSGDLLRAFLSIVRSIQNKPAFFAKTLHRSMKGMGTDDESLIRVIITRCEIDMVQIKDAFKAEYEATLGEFIKDDTSGDYRLALLTLIGEESLV 711          
BLAST of Annexin vs. TrEMBL
Match: A0A267FPW2 (Annexin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005283g1 PE=3 SV=1)

HSP 1 Score: 665.226 bits (1715), Expect = 0.000e+0
Identity = 377/770 (48.96%), Postives = 509/770 (66.10%), Query Frame = 3
Query:   48 MPLAGGVAAPSVAXXXXXXXXXXXXHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYXXXXXXXXXXXXXXYEME---SNHSYNSDIEE----KKTPKYNSKPIDAWKESAVD--------NFLHRTSDQGFSATNVSGTQINLWGGNPG----------------MGWDVRTPGNTTFSGGYVXXXXXXXXXXXXXXXDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEIFPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLAN------------XXXXXXXXXXXXXXXSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAAPIELKT-EEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            MP AGG+AAP +  LK    GKP + ID+ TYIE+  ++ NC ++FTTDGT+PNP +R +NG+E+T++Y  PF LKPGKR +KA+A+H+VT+  S V T+T++ +DI      D+   +      + +++SD+E+    +K          AW ++A          + L    DQGF+A N SGTQINL+GG P                 MGW+VRTP N  F GG+ PQ Q   PQ   P PD  +  Q QLN IA QL+Q++D  RQ+T+ ++R  +++ +  +             + +P   P+S G+GD K QL+H+Y HLL++AR + DF+AA+G  K GK++SAE D++ +S+L+T+ +                  KP  PP KK P+    R +    P  H +E +V+Q   EKA  I+LK  EE+PP+ V+ AYF+ EEYVQE TL P+ +FNAN D E+LRKAMKGLGT+E +II+V+G R+  QR EIV+ FK   G+DL AD DSELSGNF KIC+ LC+G  EYDA ELRAAMKGLGTDED LIE+ICTRT AQ++  K+ Y  +Y  RDLE+D++SETS +FKR+L+SLL  +R E  +FD   A +DA+ L EAG  K+GTDESKF++I+   +N HLRA+F EYE L+  TLE ++KSEMSGD++  ++T +RC+QNKP YFA AL KSMKGLGTDDRTLLRI+I+RCE+DMVQIK AFQ E+ + L +WIKDDTSGDY KILL L GEN
Sbjct:    1 MPPAGGIAAPVLTALKGPVSGKPAHCIDSATYIEMACDSSNCHIFFTTDGTRPNPEQRKVNGREVTFKYRAPFCLKPGKRVVKAVAMHRVTRQLSAVTTRTYHCEDIHGWNETDDCYDDCSVTTDSTAWDSDLEDGLRTRKGASGGGSRRRAWDKAAPPKPAEPSPLDELGIPPDQGFAAVNHSGTQINLYGGGPPGAGTGGGGFGGPAGGLMGWEVRTPNNVNFRGGFAPQVQQQQPQPALPAPDQGVTPQ-QLNLIAAQLSQRMDETRQSTLQDIRRLVEDKKKQQPS----QPPQQPVSADPACLPVSKGDGDFKKQLQHVYAHLLQYARSDGDFQAAVGGPKFGKVISAELDESTDSYLLTVQIGKPGYKKPLSEPKVQPPPKPKQPPAKKAPTPPPPRRRNPTPPPNHKMETEVKQTSHEKADAIKLKAPEEQPPKPVDEAYFQQEEYVQEGTLKPYDSFNANADAEQLRKAMKGLGTNEESIINVLGHRTVSQRQEIVRAFKMKYGKDLKADLDSELSGNFNKICQNLCLGAAEYDAMELRAAMKGLGTDEDCLIEVICTRTQAQVQEVKKIYHNMY-NRDLEEDVMSETSGHFKRILVSLLTGARPEGSSFDPVQAKKDAQALQEAGIGKWGTDESKFNEILCGNNNAHLRAVFAEYESLTGKTLEDSLKSEMSGDLLKAMLTLIRCVQNKPAYFAKALQKSMKGLGTDDRTLLRIIISRCEVDMVQIKDAFQKEFGQSLAQWIKDDTSGDYCKILLALIGEN 764          
BLAST of Annexin vs. TrEMBL
Match: A0A267EJ83 (Annexin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011209g4 PE=3 SV=1)

HSP 1 Score: 664.84 bits (1714), Expect = 0.000e+0
Identity = 377/770 (48.96%), Postives = 508/770 (65.97%), Query Frame = 3
Query:   48 MPLAGGVAAPSVAXXXXXXXXXXXXHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYXXXXXXXXXXXXXXYEME---SNHSYNSDIEE----KKTPKYNSKPIDAWKESAVD--------NFLHRTSDQGFSATNVSGTQINLWGGNPG----------------MGWDVRTPGNTTFSGGYVXXXXXXXXXXXXXXXDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEIFPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLAN------------XXXXXXXXXXXXXXXSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAAPIELKT-EEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            MP AGG+AAP +  LK    GKP + ID+ TYIE+  ++ NC ++F TDGT+PNP +R +NG+E+T++Y  PF LKPGKR +KA+A+H+VT+  S V T+T++ +DI      D+   +      + +++SD+E+    +K          AW ++A          + L    DQGF+A N SGTQINL+GG P                 MGW+VRTP N  F GG+ PQ Q   PQ   P PD  +  Q QLN IA QL+Q++D  RQ+T+ ++R  +++ +  +             + +P   P+S G+GD K QL+H+Y HLL++AR + DF+AA+G  K GK++SAE D++ +S+L+T+ +                  KP  PP KK P+    R +    P  H +E +V+Q   EKA  I+LK  EE+PPE V+ AYF+ EEYVQE TL P+ +FNAN D E+LRKAMKGLGT+E +II+V+G R+  QR EIV+ FK   G+DL AD DSELSGNF KIC+ LC+G  EYDA ELRAAMKGLGTDED LIE+ICTRT AQ++  K+ Y  +Y  RDLE+D++SETS +FKR+L+SLL  +R E  +FD   A +DA+ L EAG  K+GTDESKF++I+   +N HLRA+F EYE L+  TLE ++KSEMSGD++  ++T +RC+QNKP YFA AL KSMKGLGTDDRTLLRI+I+RCE+DMVQIK AFQ E+ + L +WIKDDTSGDY KILL L GEN
Sbjct:    1 MPPAGGIAAPVLTALKGPVSGKPAHCIDSATYIEMACDSSNCHIFFNTDGTRPNPEQRKVNGREVTFKYRAPFCLKPGKRVVKAVAMHRVTRQLSAVTTRTYHCEDIHGWNETDDCYDDCSVTTDSTAWDSDLEDGLRTRKGASGGGSRRRAWDKAAPPKPAEPSPLDELGIPPDQGFAAVNHSGTQINLYGGGPPGAGTGGGGFGGPAGGLMGWEVRTPNNVNFRGGFAPQVQQQQPQPALPAPDQGVTPQ-QLNLIAAQLSQRMDETRQSTLQDIRRLVEDKKKQQPP----QPPQQPVSADPACLPVSKGDGDFKKQLQHVYAHLLQYARSDGDFQAAVGGPKFGKVISAELDESTDSYLLTVQIGKPGYKKPLSEPKVQPPPKPKQPPAKKAPTPPPPRRRNPTPPPNHKMETEVKQTSHEKADAIKLKAPEEQPPEPVDEAYFQQEEYVQEGTLKPYDSFNANADAEQLRKAMKGLGTNEESIINVLGHRTVSQRQEIVRAFKMKYGKDLKADLDSELSGNFNKICQNLCLGAAEYDAMELRAAMKGLGTDEDCLIEVICTRTQAQVQEVKKIYHNMY-NRDLEEDVMSETSGHFKRILVSLLTGARPEGSSFDPVQAKKDAQALQEAGIGKWGTDESKFNEILCGNNNAHLRAVFAEYESLTGKTLEDSLKSEMSGDLLKAMLTLIRCVQNKPAYFAKALQKSMKGLGTDDRTLLRIIISRCEVDMVQIKDAFQKEFGQSLAQWIKDDTSGDYCKILLALIGEN 764          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa11a (annexin A11 [Source:NCBI gene;Acc:103039162])

HSP 1 Score: 323.939 bits (829), Expect = 1.358e-101
Identity = 160/309 (51.78%), Postives = 219/309 (70.87%), Query Frame = 3
Query: 1302 PNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            P  +  +D E LRKAMKG GTDE AII+++G RS KQR+ ++  +KT  G+DL+ D  SELSGNF K+  A+   P +YDASELR A+KG GTDE  LIEI+ +R+NA+I+   + +K  Y  + LE  I  +TS +F+RLL+SL Q +RDE +  D  LA QDA+ LY+AGE K GTDESKF+ I+  RS PHLRA+F EY+ +    +E++I+ EMSGD+ NG++  V+CI++ P YFA  L K+MKGLGT DRTL+RI+++R E+DM+ I++A+  +Y K L   I  DTSGDY K+LL L G +D
Sbjct:  219 PGADPLKDAEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLISYKTAYGKDLVKDLKSELSGNFEKLVLAMLKTPAQYDASELREAIKGAGTDEACLIEILSSRSNAEIREINQIFKAEY-KKSLEDSISGDTSGHFRRLLVSLAQGNRDERENVDIALAKQDAQTLYQAGENKLGTDESKFNAILCARSKPHLRAVFNEYQHMCGRDIEKSIEREMSGDLENGMLAVVKCIKDTPTYFAERLYKAMKGLGTKDRTLIRIMVSRSEVDMLDIRQAYVKKYGKSLYTDISGDTSGDYKKLLLKLCGGSD 526          
BLAST of Annexin vs. Ensembl Cavefish
Match: ENSAMXT00000004530.2 (annexin A11-like [Source:NCBI gene;Acc:103040502])

HSP 1 Score: 317.005 bits (811), Expect = 1.395e-99
Identity = 158/315 (50.16%), Postives = 218/315 (69.21%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+  +P  +   D E LRKAMKG GTDE AII+++G RS KQR  +V+ +KT  G+DLI+D  SEL+GNF  +  A+  GP EYDA EL +++ G GTDE  LIEI+ +R+NA+I+   + YK  Y  + LE  I  +TS +F+RLL+SL Q +RDE +T D  LA QDA++LY AGE K GTDES+F+ I+  RS PHLR +F+EY+++    +E++I  EMSGD+  GL+  V+C++N P YFA  LNK+MKG GT DRTL+RI++TR E+DM+ I++ +   + K L   I  DTSGDY K+LL L G +D
Sbjct:  168 GTIKDYPGADPLRDVEVLRKAMKGFGTDENAIIELLGNRSGKQRAPLVRAYKTTYGKDLISDLKSELTGNFEALVLAMVKGPAEYDAYELHSSIAGAGTDEACLIEILSSRSNAEIREINQIYKTEY-KKTLEDAIQHDTSGHFRRLLVSLCQGNRDERETVDVALAKQDAQKLYAAGENKLGTDESQFNAILCARSKPHLRQVFQEYQQMCGKDIEKSICREMSGDLERGLLAVVKCLKNTPGYFAERLNKAMKGAGTKDRTLIRIMVTRSEVDMLDIRQEYIRNFGKSLYTDISSDTSGDYKKLLLKLCGGSD 481          

HSP 2 Score: 81.6481 bits (200), Expect = 7.874e-16
Identity = 69/240 (28.75%), Postives = 118/240 (49.17%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIG-PDE----------YDASELRAAMKG-LGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGD 1964
            EA +       A  D  +L  ++ G GTDEA +I+++  RS  +  EI Q +KT   + L      + SG+F ++  +LC G  DE           DA +L AA +  LGTDE     I+C R+   ++   ++Y+Q+   +D+EK I  E S + +R L+++++  ++    F        A+ L +A  K  GT +    +I++ RS   +  + +EY +    +L   I S+ SGD
Sbjct:  239 EALVLAMVKGPAEYDAYELHSSIAGAGTDEACLIEILSSRSNAEIREINQIYKTEYKKTLEDAIQHDTSGHFRRLLVSLCQGNRDERETVDVALAKQDAQKLYAAGENKLGTDESQFNAILCARSKPHLRQVFQEYQQM-CGKDIEKSICREMSGDLERGLLAVVKCLKNTPGYF--------AERLNKA-MKGAGTKDRTLIRIMVTRSEVDMLDIRQEYIRNFGKSLYTDISSDTSGD 468          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa4 (annexin A4 [Source:NCBI gene;Acc:103027730])

HSP 1 Score: 295.049 bits (754), Expect = 2.383e-93
Identity = 154/313 (49.20%), Postives = 207/313 (66.13%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
             T+     FN ++D E LRKAMKG GTDEAAII ++  R+  QR  I + +K  +G++L  D  SEL+GNF K+   L +    YDA ELR A+KG GTDE  LIEI+ +RT +++++    Y + Y  + LE D+  +TS  FKR+L+SLL A RDES T D+ LA QDAKE+YEAGE  +GTDE KF  ++  R+  HL  +FEEY+++S   +E +IK EMSG +    +  VRCI++KP +FA  L+KSMKGLGT D  L+R++++R EIDM  IK  F   Y K L  +IK DTSGDY KILL L G+
Sbjct:    8 GTVTEAAGFNPDQDAEALRKAMKGAGTDEAAIISILPHRTIAQRQLIKESYKRAVGKELADDLKSELTGNFEKVVIGLLMTAPVYDAYELRNAIKGAGTDEACLIEILASRTISEMRTLVATYNKEYG-KSLEDDVCGDTSGMFKRVLVSLLTAGRDESNTVDQALAAQDAKEIYEAGEAHWGTDEVKFLTVLCVRNRNHLLKVFEEYKRISGRDIEDSIKREMSGCLEEVFLAIVRCIKSKPGFFAERLHKSMKGLGTTDSILIRVMVSRSEIDMQDIKAEFLKTYGKSLHSFIKGDTSGDYRKILLELCGK 319          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa6 (annexin A6 [Source:NCBI gene;Acc:103026042])

HSP 1 Score: 289.656 bits (740), Expect = 1.004e-88
Identity = 147/317 (46.37%), Postives = 215/317 (67.82%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLI 2234
             T+  FP+F+AN D E L  AMKG G+D+ AI+D++  RS  QR EI   +K+L G+DLI D   EL+G F ++  +L   P  +DA E++ A+KG GTDE  LIEI+ +RTN QI      Y   Y  RD+E+DII +TS +FK++L+ LLQ +R++       +  +DA+ LY AGE+++GTDES F  ++ NRS  HL+ +F+EY+K+++ ++E +IKSE+SGD    ++  V+CI+++P +FA  L KSMKGLGT D TL+RI+I+R EIDM+ I++ F+  Y K L   I+DDTSG+Y + LL L G +D I
Sbjct:   11 GTVADFPDFDANGDAEALYNAMKGFGSDKEAILDLVTSRSNGQRQEIRSAYKSLYGKDLIEDLKYELTGKFERLIVSLMRPPAYHDAKEIKDAIKGAGTDEKCLIEILASRTNQQIHDLVAAYNDAYG-RDIEQDIIGDTSGHFKKMLVVLLQGTREDDGVVHEEVIEEDAQALYAAGEEQWGTDESIFIMLLGNRSVTHLQLVFDEYQKIAEKSIEDSIKSELSGDFERLMLAVVQCIRSRPMFFAKRLYKSMKGLGTADNTLIRIMISRSEIDMLDIRECFRLRYEKSLHNMIQDDTSGEYKRTLLKLCGGDDDI 326          

HSP 2 Score: 142.895 bits (359), Expect = 1.044e-35
Identity = 73/154 (47.40%), Postives = 103/154 (66.88%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQA 1745
             T+ P  +F+   D + LRKAMKG GTDE  II+++ KRS +QR EI   FK++LGRDL+AD  SELS N  ++   L + P E+DA  ++ AM+G GTDE ALIEI+ TR+N +I+     YK+ +  ++LE  I S+TS +F R+L+SL Q 
Sbjct:  354 GTVHPISDFDPGSDAQDLRKAMKGFGTDEDTIIEIVAKRSNEQRQEIRHVFKSILGRDLMADLKSELSKNLCRLIMGLMMTPAEFDAKMMKKAMEGAGTDEHALIEILVTRSNQEIQDMCAAYKKAF-KKNLEDAIRSDTSGHFCRILVSLAQV 506          

HSP 3 Score: 98.9821 bits (245), Expect = 2.601e-21
Identity = 80/264 (30.30%), Postives = 119/264 (45.08%), Query Frame = 3
Query: 1329 EKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEY----------------------------------------DASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCI 2000
            ++L K+MKGLGT +  +I +M  RS    ++I + F+    + L      + SG + +    LC G D+                                         DA +LR AMKG GTDED +IEI+  R+N Q +  +  +K +   RDL  D+ SE S N  RL++ L+              A  DAK + +A E   GTDE    +I++ RSN  ++ M   Y+K  K  LE AI+S+ SG     LV+  + I
Sbjct:  257 KRLYKSMKGLGTADNTLIRIMISRSEIDMLDIRECFRLRYEKSLHNMIQDDTSGEYKRTLLKLCGGDDDIAGEFFPEAAQIAYKMWEISAMTKVQLRGTVHPISDFDPGSDAQDLRKAMKGFGTDEDTIIEIVAKRSNEQRQEIRHVFKSILG-RDLMADLKSELSKNLCRLIMGLMMTP-----------AEFDAKMMKKAMEGA-GTDEHALIEILVTRSNQEIQDMCAAYKKAFKKNLEDAIRSDTSGHFCRILVSLAQVI 507          

HSP 4 Score: 98.9821 bits (245), Expect = 3.221e-21
Identity = 87/319 (27.27%), Postives = 150/319 (47.02%), Query Frame = 3
Query: 1359 GTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKAL--CI-GPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLA--------------IQ---------------DAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYF-AMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLT 2216
            GTDE+  I ++G RS      +  +++ +  + +     SELSG+F ++  A+  CI     + A  L  +MKGLGT ++ LI I+ +R+   +   +E ++  Y  + L   I  +TS  +KR L+ L     D +  F    A              +Q               DA++L +A  K FGTDE    +I+  RSN   + +   ++ +    L   +KSE+S      L   +  +   P  F A  + K+M+G GTD+  L+ I++TR   ++  +  A++  + K L + I+ DTSG + +IL+ L 
Sbjct:  192 GTDESIFIMLLGNRSVTHLQLVFDEYQKIAEKSIEDSIKSELSGDFERLMLAVVQCIRSRPMFFAKRLYKSMKGLGTADNTLIRIMISRSEIDMLDIRECFRLRY-EKSLHNMIQDDTSGEYKRTLLKLCGGDDDIAGEFFPEAAQIAYKMWEISAMTKVQLRGTVHPISDFDPGSDAQDLRKA-MKGFGTDEDTIIEIVAKRSNEQRQEIRHVFKSILGRDLMADLKSELS----KNLCRLIMGLMMTPAEFDAKMMKKAMEGAGTDEHALIEILVTRSNQEIQDMCAAYKKAFKKNLEDAIRSDTSGHFCRILVSLA 504          
BLAST of Annexin vs. Ensembl Cavefish
Match: anxa6 (annexin A6 [Source:NCBI gene;Acc:103026042])

HSP 1 Score: 289.271 bits (739), Expect = 5.716e-87
Identity = 147/317 (46.37%), Postives = 215/317 (67.82%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLI 2234
             T+  FP+F+AN D E L  AMKG G+D+ AI+D++  RS  QR EI   +K+L G+DLI D   EL+G F ++  +L   P  +DA E++ A+KG GTDE  LIEI+ +RTN QI      Y   Y  RD+E+DII +TS +FK++L+ LLQ +R++       +  +DA+ LY AGE+++GTDES F  ++ NRS  HL+ +F+EY+K+++ ++E +IKSE+SGD    ++  V+CI+++P +FA  L KSMKGLGT D TL+RI+I+R EIDM+ I++ F+  Y K L   I+DDTSG+Y + LL L G +D I
Sbjct:    7 GTVADFPDFDANGDAEALYNAMKGFGSDKEAILDLVTSRSNGQRQEIRSAYKSLYGKDLIEDLKYELTGKFERLIVSLMRPPAYHDAKEIKDAIKGAGTDEKCLIEILASRTNQQIHDLVAAYNDAYG-RDIEQDIIGDTSGHFKKMLVVLLQGTREDDGVVHEEVIEEDAQALYAAGEEQWGTDESIFIMLLGNRSVTHLQLVFDEYQKIAEKSIEDSIKSELSGDFERLMLAVVQCIRSRPMFFAKRLYKSMKGLGTADNTLIRIMISRSEIDMLDIRECFRLRYEKSLHNMIQDDTSGEYKRTLLKLCGGDDDI 322          

HSP 2 Score: 268.855 bits (686), Expect = 2.607e-79
Identity = 146/320 (45.62%), Postives = 203/320 (63.44%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIK-----DDTSGDYLKILLWLTGEND 2228
             T+ P  +F+   D + LRKAMKG GTDE  II+++ KRS +QR EI   FK++LGRDL+AD  SELS N  ++   L + P E+DA  ++ AM+G GTDE ALIEI+ TR+N +I+     YK+ +  ++LE  I S+TS +F R+L+SL Q +RDE    D   A +DA+ L +A   +      KF  I+  RS PHLR +F+E+ + S   +EQ IK EMSGDI N +   VR ++N+P Y A  L K+MKGLGTDDR L+RI+++R EID+  I+K F+  +   L ++I+      DTSGDY K LL L G  D
Sbjct:  350 GTVHPISDFDPGSDAQDLRKAMKGFGTDEDTIIEIVAKRSNEQRQEIRHVFKSILGRDLMADLKSELSKNLCRLIMGLMMTPAEFDAKMMKKAMEGAGTDEHALIEILVTRSNQEIQDMCAAYKKAF-KKNLEDAIRSDTSGHFCRILVSLAQGARDEGPA-DMGRAEEDAQALADACNAESDEMMDKFMSILCTRSFPHLRRVFQEFVRCSNKDIEQIIKKEMSGDIKNAMYAIVRSVKNQPSYLADRLYKAMKGLGTDDRALIRIMVSRSEIDLFNIRKEFKDTHDTSLHDFIQVEALVGDTSGDYRKTLLILCGGED 667          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ANXA11 (annexin A11 [Source:HGNC Symbol;Acc:HGNC:535])

HSP 1 Score: 322.398 bits (825), Expect = 3.735e-102
Identity = 160/308 (51.95%), Postives = 215/308 (69.81%), Query Frame = 3
Query: 1305 NFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             FNA +D E LRKAMKG GTDE AIIDV+  RS KQR EI   FKT  G+DL+ +  SELSGNF  +  AL   P +YD S+++AA+KG GTDE+ LIEI+ +R+N +I    + YK +   R LE+DI+S+TS+NFKRLL++L Q  RDES T D     +DA++L  AGE + GTDES+F+ I+  RS  HL  +FEEY ++SK  +E++IK EMSG + +G+V  V+C++N   +FA  L KSMKGLGT D TL+RI+++RCE+D+  I++ F+  Y K L  +I  DTSGDY KILL L G +D
Sbjct:  184 GFNALKDAETLRKAMKGFGTDEKAIIDVLTARSNKQRQEIALSFKTAYGKDLVKELKSELSGNFELVVVALLETPTQYDVSQIQAAIKGAGTDEECLIEILASRSNKEIHEINKHYKSV-TKRSLEQDIMSDTSANFKRLLVALCQGGRDESTTVDMARVQKDAQDLLAAGENRIGTDESRFNSILCGRSQAHLLRVFEEYGRISKHDIEKSIKREMSGSLEDGMVAVVKCLRNTQGFFAERLYKSMKGLGTKDSTLIRIMVSRCEVDLFDIRREFKQLYGKSLHSFIAGDTSGDYKKILLSLCGGDD 490          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 315.079 bits (806), Expect = 1.065e-98
Identity = 168/351 (47.86%), Postives = 223/351 (63.53%), Query Frame = 3
Query: 1173 VRQAKGEKAAPIELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
             +Q  G   A    +     P +V    + +   V   T+    NFNA +D E LR+AMKGLGTDE A+ID++  RS  QR +I   FKT+ G+DLI D  SELSGNF +I  AL +    YDA  L  A+KG GTDE  LIEI+CTRTN +IK     Y++ +  R LEKDI S+TS +FKRLLIS+ Q +RDESQT D + A  DA+ LY AGE K GTDES F+ I+  RS P L+A F EY ++++  +   I  E SGDI +G+   V+C++++P YFA  L  SMKGLGTDD  L+R++++R EID+  IK+AF  +Y K L   I+ DTSGDY +IL+ + G N
Sbjct:  198 TQQPSGASYAQPAYQQSHSTPAQVS---YPSAGGVARGTIHTASNFNAQDDAEVLRRAMKGLGTDERALIDIIVNRSNDQRQKIKLAFKTMYGKDLIRDLRSELSGNFEEIILALFMPTTYYDAWSLMKAIKGAGTDEKVLIEIMCTRTNQEIKEIVRVYREEF-NRTLEKDIRSDTSGHFKRLLISMCQGNRDESQTVDMSKAQSDAQRLYTAGEGKLGTDESTFNMILACRSFPQLQATFNEYTRMAQRDIVNTIDREFSGDIRDGMRAIVQCVRSRPAYFAERLFHSMKGLGTDDSGLIRVIVSRSEIDLQDIKQAFLQQYQKTLYTMIQGDTSGDYKRILVAIVGMN 544          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ANXA7 (annexin A7 [Source:HGNC Symbol;Acc:HGNC:545])

HSP 1 Score: 304.679 bits (779), Expect = 9.724e-96
Identity = 158/315 (50.16%), Postives = 216/315 (68.57%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            + T+ P  NFN  +DCE LRKAMKGLGT+E  ++D++  RS  QR +I   FKT+ G+DLI D  SELSGNF +I  AL +    YDA  L+ A++G GT+E  L+EI+C+RTN +I+     YK  +  RDLEKDI S+TS +FKRLLIS+ Q +RDES + D  LA+ DA++L  AGE K GTDES F+ I+  RS P L+A F+EY KLS+  +   I  E SG++ +GL   V+C +N+P +FA  L ++MKG GTDD TL+RIV +R EID+V +K AF  +Y+K L + I+ DTSGDY ++L  + G+N
Sbjct:  147 QGTVKPIGNFNVQDDCEMLRKAMKGLGTNEQVLMDLVVNRSNAQRQKIKLTFKTMYGKDLIRDLRSELSGNFEEIMLALFMPTTYYDAWSLQKAIQGAGTNEKVLVEILCSRTNQEIRDIVSCYKDEFG-RDLEKDIKSDTSGHFKRLLISMCQGNRDESLSVDLALALSDAQKLQSAGEGKLGTDESAFNMILAVRSFPQLQATFQEYIKLSQRDIINTIDREFSGNVKDGLKAIVQCAKNRPVFFAERLYEAMKGGGTDDSTLIRIVTSRSEIDLVNVKHAFLEKYNKTLYKMIEGDTSGDYKRMLQAIVGQN 460          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001517.1 (pep scaffold:Pmarinus_7.0:GL476341:319620:335761:1 gene:ENSPMAG00000001365.1 transcript:ENSPMAT00000001517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.944 bits (707), Expect = 3.288e-87
Identity = 143/307 (46.58%), Postives = 200/307 (65.15%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILL 2207
            T+ P+ +F+A +D + LRKA KGLGTDE  II+++  R+ KQR +I +++K   G DL+     EL G+F K+  AL   P  YDA ELR AMKG GTDED L+EI+CTRTN QI+  +  Y +L+  RDLE D+ SETS   ++LLI+L+Q +RDE+   + +LA  DAKEL+EAG+  +GTDE  F+ ++  R+   LRA F+ Y+      +E  +KSE SG + +  +  V C  +   YFA  L KSMKG GTDD TL+R +++R +ID+  IK+ FQ +Y K L  ++  D SGDY KILL
Sbjct:    7 TIHPYADFDAAKDAKDLRKACKGLGTDEDKIIEILANRTAKQRHQIKEEYKRSYGDDLVEVLKGELKGDFEKVVLALMDLPAVYDAKELRKAMKGAGTDEDVLVEILCTRTNKQIQKMRFVYNELF-DRDLESDLKSETSGAVEKLLIALVQGNRDETTDVNMSLANSDAKELHEAGKGHWGTDELAFNSVLATRNMMQLRATFKAYKTNYGEDIEDVVKSETSGMLQDAYLAIVHCAMDAQEYFAKKLYKSMKGTGTDDDTLIRCIVSRSQIDLGTIKETFQQKYEKTLASFVAGDCSGDYKKILL 312          

HSP 2 Score: 62.3882 bits (150), Expect = 9.466e-11
Identity = 48/149 (32.21%), Postives = 77/149 (51.68%), Query Frame = 3
Query: 1782 AIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPR-YFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            A +DAK+L +A  K  GTDE K  +I+ NR+      + EEY++     L + +K E+ GD        V  + + P  Y A  L K+MKG GTD+  L+ I+ TR    + +++  +   + + L   +K +TSG   K+L+ L   N
Sbjct:   16 AAKDAKDLRKAC-KGLGTDEDKIIEILANRTAKQRHQIKEEYKRSYGDDLVEVLKGELKGDFEK----VVLALMDLPAVYDAKELRKAMKGAGTDEDVLVEILCTRTNKQIQKMRFVYNELFDRDLESDLKSETSGAVEKLLIALVQGN 159          
BLAST of Annexin vs. Ensembl Sea Lamprey
Match: anxa2a (annexin A2a [Source:ZFIN;Acc:ZDB-GENE-030131-4282])

HSP 1 Score: 222.631 bits (566), Expect = 2.232e-66
Identity = 125/320 (39.06%), Postives = 193/320 (60.31%), Query Frame = 3
Query: 1272 YVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDL 2231
            YV   T+ P+PNFNAN D   L+KA+   G DE  II ++  R+  QR EI++ +K    +DL  D    LSG+   +   L + P  YDA  +R  ++GLGTDE+ LIE++ TR N +++S    YK  + + D+ +DI  +TS +F++L+++L + +R E  T D +L  +DA+EL+EAG K+ GTD  KF  I+  RS  HL+ +FE Y+      +  + + E+ GD+ N  V+  + I   P +FA  L+ SMKGLGT D  L+ I+++RCE+D++ I+  F+ +Y K L   I  DT+GDY   L  L G++D+
Sbjct:   22 YVYGPTVKPYPNFNANNDAAALQKAITTKGVDEKTIISILTNRTNTQRQEIIKSYKNATSKDLATDLKGALSGHLETVILGLLMTPAIYDAHIIRQTLQGLGTDEECLIEMLVTRDNLRLRSMAVAYKSEFKS-DMMQDIAKDTSGDFQKLVLALAKGARIEDSTKDHDLVDEDARELFEAGVKRKGTDVGKFITIMSQRSFSHLKKVFEAYKSYYPAGIVDSFEKEVGGDLRNAFVSLAKAINYTPGFFAEKLHDSMKGLGTKDHMLIHIMVSRCELDLLHIRTEFKKKYKKSLYSAIASDTNGDYEVALCNLCGQDDV 340          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO32043 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7SW86])

HSP 1 Score: 308.916 bits (790), Expect = 5.874e-99
Identity = 157/308 (50.97%), Postives = 210/308 (68.18%), Query Frame = 3
Query: 1299 FPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            + +F+  +D + LRKAMKGLG D  A++ ++  R+  QR  I  ++KT+ GRDLI D  SE+ G F     AL   P EYDA+ LR A+KGLGTDE  LIE++ TRTN +I + +  Y  L++ RDLEKDI  +TS  FK+ LISL  A+R E+   D + A QDA+ LY+AGE ++GTDESKF+ I+ +RS   LRA F EY K+ K  +E++IK EMSGD+ +G+VT VR ++N P +FA  L KSMKGLGTDD+TL+RIV+TR E+DM+ I+  F   Y   L  +I DDT G+Y KILL L GE
Sbjct:   22 YTSFDGRKDADTLRKAMKGLGCDNKALMYLLCSRTNSQRQRISLEYKTMFGRDLIKDLKSEVGGYFEDTVIALMTPPAEYDATLLRKAIKGLGTDEAVLIEVLTTRTNDEIIAIRNAYNTLFS-RDLEKDIAGDTSGKFKKFLISLCNANRIETAPVDYSKAQQDAQALYKAGEGRWGTDESKFNSILASRSFDQLRATFNEYSKICKYDIEESIKREMSGDLRDGMVTIVRVVKNAPAFFAEKLYKSMKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLARYISDDTKGNYKKILLQLIGE 328          

HSP 2 Score: 62.7734 bits (151), Expect = 1.376e-10
Identity = 43/146 (29.45%), Postives = 75/146 (51.37%), Query Frame = 3
Query: 1788 QDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            +DA  L +A  K  G D      ++ +R+N   + +  EY+ +    L + +KSE+ G   +   T +  +     Y A  L K++KGLGTD+  L+ ++ TR   +++ I+ A+   +S+ L + I  DTSG + K L+ L   N
Sbjct:   29 KDADTLRKA-MKGLGCDNKALMYLLCSRTNSQRQRISLEYKTMFGRDLIKDLKSEVGGYFED---TVIALMTPPAEYDATLLRKAIKGLGTDEAVLIEVLTTRTNDEIIAIRNAYNTLFSRDLEKDIAGDTSGKFKKFLISLCNAN 170          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO28444 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7T6G0])

HSP 1 Score: 282.337 bits (721), Expect = 2.327e-89
Identity = 141/293 (48.12%), Postives = 206/293 (70.31%), Query Frame = 3
Query: 1347 MKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            M+G+GT+EA +I ++  RS  QR+EI +++KT+ G+DL+ D  SELSGN  +   A+      YDA  LR  M+G GTDE+ LI+I+CTR+N +I++ K +YK+ Y  RDLEKD +SETS +FKRLL+S+ Q +RD + T D   A ++A++LY+AGEKK+GTDES+F+ ++ +RS P L+A F EY K+S+  +  +I  EMSGD+  G    V+C +N   YFA  L KSMKG GTDD  L+R+V++R E+D+V+IK +F  +Y K + + I+ D SGDY K+L+ L G+N
Sbjct:    1 MRGMGTNEAELIGILANRSNAQRVEIRKRYKTMYGKDLMNDLKSELSGNLEECLLAMMEPSVLYDAKCLRRGMRGAGTDEETLIDILCTRSNQEIEAIKREYKEYY-KRDLEKDCVSETSGHFKRLLVSMCQGNRDTNMTVDMAKATKEAQDLYKAGEKKWGTDESRFNVVLASRSFPQLQATFNEYIKISQRDIMNSIDREMSGDLKAGFRCIVQCARNPAEYFADRLWKSMKGAGTDDSLLIRVVVSRSEVDLVEIKASFLQKYHKTVYKMIEGDCSGDYKKLLMALVGKN 292          

HSP 2 Score: 75.485 bits (184), Expect = 6.121e-15
Identity = 63/235 (26.81%), Postives = 119/235 (50.64%), Query Frame = 3
Query: 1323 DCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYD-----------ASEL-RAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFV 1991
            D + LR+ M+G GTDE  +ID++  RS ++   I +++K    RDL  D  SE SG+F ++  ++C G  + +           A +L +A  K  GTDE     ++ +R+  Q+++   +Y ++ + RD+   I  E S + K     ++Q +R+ ++ F        A  L+++  K  GTD+S   +++++RS   L  +   + +    T+ + I+ + SGD    L+  V
Sbjct:   65 DAKCLRRGMRGAGTDEETLIDILCTRSNQEIEAIKREYKEYYKRDLEKDCVSETSGHFKRLLVSMCQGNRDTNMTVDMAKATKEAQDLYKAGEKKWGTDESRFNVVLASRSFPQLQATFNEYIKI-SQRDIMNSIDREMSGDLKAGFRCIVQCARNPAEYF--------ADRLWKS-MKGAGTDDSLLIRVVVSRSEVDLVEIKASFLQKYHKTVYKMIEGDCSGDYKKLLMALV 289          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO44051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWX3])

HSP 1 Score: 243.047 bits (619), Expect = 4.362e-74
Identity = 126/309 (40.78%), Postives = 194/309 (62.78%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASR-DESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILL 2207
             T+    NF+A +  EKL+KAMKG G DE AII+V+   + +QR+ I Q FK    +DL+ +  SELSG F     AL + P++ DA+ L  AM+GLGT++  LIEI+C+R+  +++S K+ Y   +  +DL   + SETS +F+ LL++LL A R    +  + + A +DAK LYEAGEKK+GTDES F +I+  RS+  LRA+++ Y+ ++K  + + I  E++GD  + +   VRC +  P YFA +LN ++ GL TD   + RI+I+R E+D+  IK  ++  Y K L   +K+   GD+  +LL
Sbjct:    4 GTVVAAENFDAGDCAEKLKKAMKGFGDDEEAIIEVLQSCNLEQRLAIAQSFKQQYDKDLVNELKSELSGKFEDAIVALLLPPEQLDANALHGAMQGLGTNDSVLIEILCSRSAEELQSIKKAYNTAHG-KDLVAAVKSETSGDFQALLVALLDAKRVSADEIVNEDQAYEDAKNLYEAGEKKWGTDESVFTKILTCRSDLQLRALYQAYQHVAKCDILETIDDELTGDYHDAVKAIVRCTRRPPLYFAESLNSALNGLRTDSSLVTRIIISRSEVDLADIKAVYKDTYGKTLATEVKELLKGDHETLLL 311          

HSP 2 Score: 63.929 bits (154), Expect = 6.650e-11
Identity = 47/170 (27.65%), Postives = 83/170 (48.82%), Query Frame = 3
Query: 1776 NLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYF-AMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLIK*NILNDSKTYEK*NN 2282
            N    D  E  +   K FG DE    +++ + +     A+ + +++     L   +KSE+SG   + +V  +      P    A AL+ +M+GLGT+D  L+ I+ +R   ++  IKKA+   + K L   +K +TSGD+  +L+ L     +    I+N+ + YE   N
Sbjct:   11 NFDAGDCAEKLKKAMKGFGDDEEAIIEVLQSCNLEQRLAIAQSFKQQYDKDLVNELKSELSGKFEDAIVALLL----PPEQLDANALHGAMQGLGTNDSVLIEILCSRSAEELQSIKKAYNTAHGKDLVAAVKSETSGDFQALLVALLDAKRVSADEIVNEDQAYEDAKN 176          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO29757 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7T2R2])

HSP 1 Score: 173.711 bits (439), Expect = 3.754e-50
Identity = 94/186 (50.54%), Postives = 124/186 (66.67%), Query Frame = 3
Query: 1668 TRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRA-MFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGE 2222
            +RDLEKDI  +TS  FK+ LISL  A+R E+   D   A QDA+ LY+AGE ++GTDES  H      S+   RA M     ++ K  +E++IK EMSGD+ +G+VT VR ++N P +FA  L KSMKGLGTDD+TL+RIV+TR E+DM+ I+  F   Y   L ++I DDT G+Y KILL L GE
Sbjct:    3 SRDLEKDIAGDTSGKFKKFLISLCNANRIETAPVDYLKAQQDAQALYKAGEGRWGTDESN-HVTETQESSFGERARMLTPSVRICKYDIEESIKREMSGDLRDGMVTIVRVVKNAPAFFAEKLYKSMKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLAKYISDDTKGNYKKILLQLIGE 187          

HSP 2 Score: 64.3142 bits (155), Expect = 8.466e-12
Identity = 44/153 (28.76%), Postives = 79/153 (51.63%), Query Frame = 3
Query: 1296 PFPNFNANEDCEKLRKAMKG-LGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNF----LKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLL 1739
            P     A +D + L KA +G  GTDE+  +    + SF +R  ++     +   D+      E+SG+     + I + +   P  + A +L  +MKGLGTD+  LI I+ TR+   +   ++++ ++Y T  L K I  +T  N+K++L+ L+
Sbjct:   35 PVDYLKAQQDAQALYKAGEGRWGTDESNHVTETQESSFGERARMLTPSVRICKYDIEESIKREMSGDLRDGMVTIVRVVKNAP-AFFAEKLYKSMKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTT-LAKYISDDTKGNYKKILLQLI 185          

HSP 3 Score: 50.0618 bits (118), Expect = 6.576e-7
Identity = 50/200 (25.00%), Postives = 89/200 (44.50%), Query Frame = 3
Query: 1443 LLGRDLIADFDSELSGNFLKICKALC------IGPDEY-----DASELRAAMKG-LGTDEDALIEIICTRTNAQIKSFKEKYKQLYAT-----RDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFV 1991
            +  RDL  D   + SG F K   +LC        P +Y     DA  L  A +G  GTDE   +      T  Q  SF E+ + L  +      D+E+ I  E S + +  ++++++  ++    F        A++LY++  K  GTD+    +I++ RS   +  + +E+ K+   TL + I  +  G+    L+  +
Sbjct:    1 MFSRDLEKDIAGDTSGKFKKFLISLCNANRIETAPVDYLKAQQDAQALYKAGEGRWGTDESNHV------TETQESSFGERARMLTPSVRICKYDIEESIKREMSGDLRDGMVTIVRVVKNAPAFF--------AEKLYKS-MKGLGTDDKTLIRIVVTRSEVDMLDIRDEFHKMYGTTLAKYISDDTKGNYKKILLQLI 185          
BLAST of Annexin vs. Ensembl Nematostella
Match: EDO44049 (Annexin [Source:UniProtKB/TrEMBL;Acc:A7RWX1])

HSP 1 Score: 147.902 bits (372), Expect = 3.078e-41
Identity = 76/162 (46.91%), Postives = 106/162 (65.43%), Query Frame = 3
Query: 1563 MKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMK 2048
            ++G GTDEDALI I+CTR+N +I   KE YK+ Y T  LE D+  +TS +F+ LL+ LLQ  RDES   + +LA +DA+ L EAG KK+GTDE  F +I   RS P L+AMF EY K +K  +E  I SEM GD+ + L+  V+ IQ+  +  A  L+ +++
Sbjct:    2 LQGFGTDEDALISILCTRSNKEINDIKEVYKKNYDTT-LEDDVKGDTSGDFEDLLVKLLQGKRDESDEINEDLAHKDAEALIEAGIKKWGTDEDCFIEIFTTRSYPQLQAMFPEYSKWAKCDIEDTISSEMDGDLKDALLVLVKAIQSPTQMTADKLHSALQ 162          

HSP 2 Score: 60.8474 bits (146), Expect = 8.327e-11
Identity = 47/151 (31.13%), Postives = 76/151 (50.33%), Query Frame = 3
Query: 1347 MKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGP-DEYD-----------ASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQ 1763
            ++G GTDE A+I ++  RS K+  +I + +K      L  D   + SG+F  +   L  G  DE D            + + A +K  GTDED  IEI  TR+  Q+++   +Y + +A  D+E  I SE   + K  L+ L++A +  +Q
Sbjct:    2 LQGFGTDEDALISILCTRSNKEINDIKEVYKKNYDTTLEDDVKGDTSGDFEDLLVKLLQGKRDESDEINEDLAHKDAEALIEAGIKKWGTDEDCFIEIFTTRSYPQLQAMFPEYSK-WAKCDIEDTISSEMDGDLKDALLVLVKAIQSPTQ 151          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa11a (annexin A5 [Source:NCBI gene;Acc:101174691])

HSP 1 Score: 327.791 bits (839), Expect = 2.739e-103
Identity = 161/315 (51.11%), Postives = 218/315 (69.21%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
             T+  FP  +  +D E LRKAMKG GTDE AII+++G RS KQR+ +++ +KT  G+DL+ D  SELSG+F K+  A    P E+DASEL +A+KG GTDE  LIEI+ +R+NA+IK     YKQ Y  + LE  I  +TS +F+RLLISL Q +RDE +T D +LA QDA+ LY AGE K GTDESKF+ I+  RS PHLRA+F EY+++    +E++I  EMSGD+ +G++  V+CI+N P YFA  L K+MKG GT D TL+RI+++R E+D++ I+K +   Y K L   I  DTSGDY K+LL   G +D
Sbjct:  194 GTITDFPGADPLKDVEVLRKAMKGFGTDEQAIINLLGSRSNKQRVPLLRAYKTSYGKDLVKDLHSELSGDFRKLVLATLKTPAEFDASELHSAIKGAGTDEACLIEILSSRSNAEIKEINRIYKQEY-KKSLEDSISGDTSGHFRRLLISLAQGNRDERETVDASLAAQDAQALYAAGENKLGTDESKFNAILCARSKPHLRAVFHEYQRMCGRDIEKSISREMSGDLESGMLAVVKCIKNTPAYFAERLYKAMKGAGTKDTTLIRIMVSRSEVDLLDIRKEYVKNYGKSLYTAISGDTSGDYKKLLLKFCGGSD 507          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa11 (annexin max4 [Source:NCBI gene;Acc:100049456])

HSP 1 Score: 314.309 bits (804), Expect = 1.233e-98
Identity = 155/310 (50.00%), Postives = 214/310 (69.03%), Query Frame = 3
Query: 1299 FPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            FP  +   D E LRKAMKG GTDE AII+++G R+ KQR+ +V  +KT  G+DL  D  SEL+GNF  +  A+   P ++DASELR A+KG GTDE  LIEI+ +R+NA+I    + YK  Y  + LE  I S+TS +F+RLL+SL Q +RDE +T D +LA QDA++LY AGE K GTDES+F+ I+  RS PHLRA+F EY+++    +E++I  E SG++ +G+V  V+CI+N P YFA  L K+MKG GT DRTL+R++++R E+DM+ I++ +   Y K L   I  DTSGDY  +LL L G +D
Sbjct:  160 FPGADPLRDVEVLRKAMKGFGTDEKAIIELLGNRTNKQRVPLVAAYKTTYGKDLFRDLKSELTGNFEDLVVAMLKTPTQFDASELREAIKGAGTDEACLIEILSSRSNAEIIEINKVYKAEYG-KTLEDSISSDTSGHFRRLLVSLCQGNRDERETVDISLAKQDAQKLYAAGENKVGTDESQFNAILCARSKPHLRAVFHEYQQMCGKEIEKSICRETSGNLEDGMVAVVKCIKNTPAYFAERLRKAMKGAGTKDRTLIRVMVSRSEVDMLDIRQEYLKAYGKSLYTDISGDTSGDYKNLLLKLCGSSD 468          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa11 (annexin max4 [Source:NCBI gene;Acc:100049456])

HSP 1 Score: 314.694 bits (805), Expect = 2.748e-98
Identity = 155/310 (50.00%), Postives = 214/310 (69.03%), Query Frame = 3
Query: 1299 FPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            FP  +   D E LRKAMKG GTDE AII+++G R+ KQR+ +V  +KT  G+DL  D  SEL+GNF  +  A+   P ++DASELR A+KG GTDE  LIEI+ +R+NA+I    + YK  Y  + LE  I S+TS +F+RLL+SL Q +RDE +T D +LA QDA++LY AGE K GTDES+F+ I+  RS PHLRA+F EY+++    +E++I  E SG++ +G+V  V+CI+N P YFA  L K+MKG GT DRTL+R++++R E+DM+ I++ +   Y K L   I  DTSGDY  +LL L G +D
Sbjct:  200 FPGADPLRDVEVLRKAMKGFGTDEKAIIELLGNRTNKQRVPLVAAYKTTYGKDLFRDLKSELTGNFEDLVVAMLKTPTQFDASELREAIKGAGTDEACLIEILSSRSNAEIIEINKVYKAEYG-KTLEDSISSDTSGHFRRLLVSLCQGNRDERETVDISLAKQDAQKLYAAGENKVGTDESQFNAILCARSKPHLRAVFHEYQQMCGKEIEKSICRETSGNLEDGMVAVVKCIKNTPAYFAERLRKAMKGAGTKDRTLIRVMVSRSEVDMLDIRQEYLKAYGKSLYTDISGDTSGDYKNLLLKLCGSSD 508          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa4 (annexin A4 [Source:NCBI gene;Acc:100049454])

HSP 1 Score: 289.271 bits (739), Expect = 3.767e-91
Identity = 148/312 (47.44%), Postives = 209/312 (66.99%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTG 2219
             T+     FN ++D +KLR+AMKG GTDEAAII V+  R+  QR  I   +K  +G+DL  D  SELSG+F  +   L +    YDA EL+AAMKG GT+E  LI+I+ +R+N+++ +  E YK+ Y  + LE  +  +TS  F+R+L+SLL A RDES   D   A++DAK+++EAGE ++GTDE KF  ++  R+  HL  +F+EY+K+SK  +E +IK EMSG + +  +  V+C+++KP +FA  L KSMKGLGT D  L+RI+++R EIDM+ IK+ F   Y K L  +IK DTSGDY KILL L G
Sbjct:    8 GTVTEASGFNPDDDAQKLREAMKGAGTDEAAIIKVLAHRTIAQRQRIKLAYKQSVGKDLAEDLSSELSGHFQSVVLGLLMPAPVYDAYELKAAMKGAGTEEACLIDILASRSNSEMNAINEVYKKEYG-KTLEDAVCGDTSGMFQRVLVSLLTAGRDESDKVDEAQAVKDAKDIFEAGEARWGTDEVKFLTVLCVRNRNHLLRVFDEYKKISKRDIEDSIKREMSGSLEDVFLAIVKCLRSKPAFFAERLYKSMKGLGTTDSVLIRIMVSRAEIDMLDIKEHFLKTYGKSLHSFIKGDTSGDYRKILLELCG 318          
BLAST of Annexin vs. Ensembl Medaka
Match: anxa6 (annexin A6 [Source:NCBI gene;Acc:101156586])

HSP 1 Score: 295.049 bits (754), Expect = 3.518e-89
Identity = 150/318 (47.17%), Postives = 216/318 (67.92%), Query Frame = 3
Query: 1275 VQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            V   T+    +F+   D E L  AMKG+G+D+ AI+D++  RS  QR EI+  +K   G+DLI D   EL+G F ++  +L   P   DA E+  A+KG+GT+E  LIEI+ +R N Q +     YK  Y  RD+E+DII++TS +FK++L+ L+Q +RDES   D +L  QDA++LYEAGE ++GTDE+KF  I+ NRS  HLR +F+EYEK+++M++E +IK+E+SGD    ++  V+CI++ P +FA  L K+MKGLGT D TL+RI+I+R EIDM+ I++ F+  Y K L   IKDDTSGDY + LL L G +D
Sbjct:    2 VFRGTISDAADFDPTADAETLYNAMKGIGSDKEAILDLVTARSNAQRQEIIGAYKCSFGKDLIEDLKYELTGKFERLIVSLMRTPAYLDAKEIHDAVKGVGTNERCLIEILASRNNKQTQDMVAAYKDAYG-RDMEEDIITDTSGHFKKMLVVLIQGTRDESGVVDADLVQQDAQDLYEAGEAQWGTDEAKFIMILGNRSVTHLRMVFDEYEKVAEMSIEDSIKNELSGDFERLMLAVVQCIRSVPMFFAKRLYKAMKGLGTADNTLIRIMISRSEIDMLDIREFFRLRYEKSLYNMIKDDTSGDYKRTLLNLCGGDD 318          

HSP 2 Score: 276.174 bits (705), Expect = 3.963e-82
Identity = 148/314 (47.13%), Postives = 205/314 (65.29%), Query Frame = 3
Query: 1287 TLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEND 2228
            T+ P  +F+   D + LRKAMKG GTDE  IID++ +RS  QR EI Q FK+LLGR+L+ D  SELS N  ++   L + P E+DA  ++ A++G GTDE ALIEI+ TR+N +I++    Y+  Y T  LE+DI S+TS +F R+L+SL+Q +R+E Q  D   A  DA+EL  A   +    E KF  I+  RS PHLR +F+E+ + +   +EQ IK EMSGD+ +     VR ++N+P YFA  L K+MKGLGTDDR L+RI+++R EID+  I+K F+  +   L E+I+ DTSGDY K LL L G  D
Sbjct:  349 TIRPASDFDPAADAQALRKAMKGFGTDEDTIIDIVTQRSNAQRQEIRQTFKSLLGRNLMKDLKSELSKNLERLIIGLMMTPAEFDAKMMKKAIEGAGTDEHALIEILVTRSNEEIQAMNSAYQSAYNT-SLEEDIQSDTSGHFCRILVSLVQGAREEGQA-DLERADADAQELANACNGESDDMEMKFMSILCTRSFPHLRRVFQEFVRHTNKDIEQIIKKEMSGDVKHAFYAIVRSVKNQPSYFADRLYKAMKGLGTDDRALIRIMVSRSEIDLFNIRKEFKEAHDVSLHEFIQGDTSGDYRKTLLILCGGED 660          

HSP 3 Score: 104.76 bits (260), Expect = 7.807e-23
Identity = 95/336 (28.27%), Postives = 151/336 (44.94%), Query Frame = 3
Query: 1326 CEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEY----------------------------------------DASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQ-------NKPRYFAMALNKSMKGLGTD-DRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGD 2189
             ++L KAMKGLGT +  +I +M  RS    ++I + F+    + L      + SG++ +    LC G D+                                         DA  LR AMKG GTDED +I+I+  R+NAQ +  ++ +K L   R+L KD+ SE S N +RL+I L+              A  DAK + +A E   GTDE    +I++ RSN  ++AM   Y+     +LE+ I+S+ SG     LV+ V+  +        +    A  L  +  G   D +   + I+ TR    + ++ + F    +K + + IK + SGD
Sbjct:  250 AKRLYKAMKGLGTADNTLIRIMISRSEIDMLDIREFFRLRYEKSLYNMIKDDTSGDYKRTLLNLCGGDDDLAGEFFPEAAQIAYKMWELSAMTKVQLRPTIRPASDFDPAADAQALRKAMKGFGTDEDTIIDIVTQRSNAQRQEIRQTFKSLLG-RNLMKDLKSELSKNLERLIIGLMMTP-----------AEFDAKMMKKAIEGA-GTDEHALIEILVTRSNEEIQAMNSAYQSAYNTSLEEDIQSDTSGHFCRILVSLVQGAREEGQADLERADADAQELANACNGESDDMEMKFMSILCTRSFPHLRRVFQEFVRHTNKDIEQIIKKEMSGD 572          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000023108.1 (SMESG000023108.1)

HSP 1 Score: 1374.38 bits (3556), Expect = 0.000e+0
Identity = 728/730 (99.73%), Postives = 729/730 (99.86%), Query Frame = 3
Query:   48 MPLAGGVAAPSVAXXXXXXXXXXXXHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYXXXXXXXXXXXXXXYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESAVDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVXXXXXXXXXXXXXXXDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEIFPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLANXXXXXXXXXXXXXXXSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAAPIELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLIK 2237
            MPLAGGVAAPSVAPLKLNKPGKPKNHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYVDDIVDVESDDENVYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESAVDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVPQNQFPPPQMQFPQPDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEIFPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFL+TIHLANPDYKKPVNPPPKKEPSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAA IELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLIK
Sbjct:    1 MPLAGGVAAPSVAPLKLNKPGKPKNHIDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTFYVDDIVDVESDDENVYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESAVDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVPQNQFPPPQMQFPQPDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNALKELENNKIKALPPTAGPVKKNNEPEIFPISPGNGDLKSQLEHIYGHLLEFARGNPDFKAAIGPAKMGKILSAEFDKNEESFLVTIHLANPDYKKPVNPPPKKEPSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAASIELKTEEKPPEKVENAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGENDLIK 730          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000042839.1 (SMESG000042839.1)

HSP 1 Score: 294.278 bits (752), Expect = 7.460e-93
Identity = 160/328 (48.78%), Postives = 210/328 (64.02%), Query Frame = 3
Query: 1284 ATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQA-----SRDESQTFDR---------NLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
             T+ PFPNF+A +DCE L+KAMKG+GTDE AI++ +G+RS  QR+EI + +KT+ G+DLIAD  SELSGNF +  +     PD YDA  L  AMKG GT E+ L EI+ +RTN QI++ K  YK+LY+  +LE++I+SETS  FKR+L+S LQA     S D+ Q             N A Q+A+ELY AGEKK GTDE+ F +I   R+   LRA F+EYEK+S   + ++I +EMSGD  + +        N P YFA  L  +MKG GT D TL RI+I+R EID+  IK  F  EY + L  ++KDDTSGDY   LL     N
Sbjct:   13 GTIKPFPNFHAEQDCEVLKKAMKGIGTDEKAIVECLGRRSISQRLEIKKTYKTMFGKDLIADLKSELSGNFCQAVEESLFEPDYYDAHSLFHAMKGAGTRENVLTEILTSRTNKQIENIKVLYKKLYSV-ELEENIVSETSGFFKRVLVSCLQANKPELSHDDIQKLHEHGPKAVVSINQAKQEAQELYNAGEKKLGTDEAVFIKIFCMRNKYQLRATFDEYEKISGKDIFESIDNEMSGDFRSSIKAIAFQAVNTPFYFATRLYNAMKGAGTTDTTLRRILISRSEIDLENIKAEFSREYKQTLESFVKDDTSGDYQAFLLRFVQGN 339          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000030132.1 (SMESG000030132.1)

HSP 1 Score: 289.271 bits (739), Expect = 5.465e-91
Identity = 158/329 (48.02%), Postives = 208/329 (63.22%), Query Frame = 3
Query: 1281 EATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGKRSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDASELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIISETSSNFKRLLISLLQASRDE--------------SQTFDRNLAIQDAKELYEAGEKKFGTDESKFHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRCIQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYSKRLGEWIKDDTSGDYLKILLWLTGEN 2225
            + T+ PFPNFN   DCE LRKAMKG+GTDE AII+ +G+R   QR+EI + +KT+ G+DLI    SE+SGNF K         D YDA  L  AMKG GT E+ L EI+ +R+N QI++ K  YK+ +   DLE+DII ETS  FKR+L+S LQ+++ E              S   + N A Q+A ELY AGEKK GTDE+ F +I   R+   LRA F+EYEK++   +  +I SEMSGD+ + L        NKP YFA  L KSMKG GT+D TL+R+++TR EID++ IKK FQ E++  L  ++KDDTSGDY   L+     N
Sbjct:   12 KGTIKPFPNFNVEHDCEVLRKAMKGIGTDEKAIIECLGRRCLAQRLEIKKTYKTMFGKDLIEALKSEISGNFKKAVIESLYDLDYYDAFSLHEAMKGAGTRENVLTEILTSRSNHQIENIKILYKKFF-NHDLEQDIIKETSGFFKRVLVSCLQSNKPELTNEQIREVQERGISAVVNINQARQEATELYNAGEKKIGTDEAMFIKIFCMRNKYQLRATFDEYEKIAGKDIFDSIDSEMSGDLQSVLKAIAFQAVNKPFYFATKLYKSMKGAGTNDTTLVRVLLTRSEIDLLNIKKEFQREFNDTLENFVKDDTSGDYRAYLMRFVEGN 339          
BLAST of Annexin vs. Planmine SMEST
Match: SMESG000018144.1 (SMESG000018144.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.215e-9
Identity = 30/76 (39.47%), Postives = 51/76 (67.11%), Query Frame = 3
Query:  126 IDTGTYIELDTETPNCVVYFTTDGTKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITKTF 353
            ++  T IE+ +E+ +  +YFT +G KP P+K +  G + T++++ PF L  GKRT+KA+A+ K    ES+++TK F
Sbjct:   25 LNNDTKIEIASESNDTDIYFTVNGFKPEPFKVI--GDKHTFKFSVPFCLPAGKRTVKAMAVSKDGSRESNIVTKVF 98          
The following BLAST results are available for this feature:
BLAST of Annexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANXA73.879e-9850.32annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA43.937e-9850.79annexin A4 [Source:HGNC Symbol;Acc:HGNC:542][more]
ANXA78.083e-9850.32annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA117.477e-9648.75annexin A11 [Source:HGNC Symbol;Acc:HGNC:535][more]
ANXA111.988e-9548.75annexin A11 [Source:HGNC Symbol;Acc:HGNC:535][more]
back to top
BLAST of Annexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nex-25.367e-8946.20Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5][more]
nex-25.367e-8946.20Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5][more]
nex-21.319e-8846.20Annexin [Source:UniProtKB/TrEMBL;Acc:Q7JMT5][more]
nex-17.658e-6137.78Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8][more]
nex-17.658e-6137.78Annexin [Source:UniProtKB/TrEMBL;Acc:G5EEA8][more]
back to top
BLAST of Annexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AnxB111.044e-9750.96gene:FBgn0030749 transcript:FBtr0334038[more]
AnxB111.044e-9750.96gene:FBgn0030749 transcript:FBtr0074302[more]
AnxB111.044e-9750.96gene:FBgn0030749 transcript:FBtr0334041[more]
AnxB112.276e-9650.96gene:FBgn0030749 transcript:FBtr0334040[more]
AnxB112.276e-9650.96gene:FBgn0030749 transcript:FBtr0074303[more]
back to top
BLAST of Annexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa11a4.622e-9950.32annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4][more]
anxa11a1.286e-9850.32annexin A11a [Source:ZFIN;Acc:ZDB-GENE-030707-4][more]
anxa11b1.554e-9648.71annexin A11b [Source:ZFIN;Acc:ZDB-GENE-030707-5][more]
anxa5b2.278e-8846.67annexin A5b [Source:ZFIN;Acc:ZDB-GENE-030131-9076][more]
anxa41.262e-8747.12annexin A4 [Source:ZFIN;Acc:ZDB-GENE-030707-1][more]
back to top
BLAST of Annexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mllt105.212e-10251.27MLLT10, histone lysine methyltransferase DOT1L cof... [more]
mllt105.511e-10251.27MLLT10, histone lysine methyltransferase DOT1L cof... [more]
mllt101.686e-10150.78MLLT10, histone lysine methyltransferase DOT1L cof... [more]
mllt102.405e-10151.27MLLT10, histone lysine methyltransferase DOT1L cof... [more]
trpv31.009e-9751.27transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Annexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Anxa41.346e-9951.11annexin A4 [Source:MGI Symbol;Acc:MGI:88030][more]
Anxa41.346e-9951.11annexin A4 [Source:MGI Symbol;Acc:MGI:88030][more]
Anxa74.510e-9750.64annexin A7 [Source:MGI Symbol;Acc:MGI:88031][more]
Anxa74.510e-9750.64annexin A7 [Source:MGI Symbol;Acc:MGI:88031][more]
Anxa74.927e-9745.58annexin A7 [Source:MGI Symbol;Acc:MGI:88031][more]
back to top
BLAST of Annexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26256|ANX12_HYDVU6.727e-10151.11Annexin-B12 OS=Hydra vulgaris OX=6087 GN=ANXB12 PE... [more]
sp|P97429|ANXA4_MOUSE9.414e-9951.11Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 ... [more]
sp|P20072|ANXA7_BOVIN1.214e-9751.27Annexin A7 OS=Bos taurus OX=9913 GN=ANXA7 PE=1 SV=... [more]
sp|P09525|ANXA4_HUMAN2.409e-9750.79Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 S... [more]
sp|P20073|ANXA7_HUMAN3.882e-9750.32Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7 PE=1 S... [more]
back to top
BLAST of Annexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SU080.000e+049.66Annexin OS=Hymenolepis diminuta OX=6216 GN=HDID_LO... [more]
A0A068Y0U80.000e+050.96Annexin OS=Echinococcus multilocularis OX=6211 GN=... [more]
U6JES00.000e+051.10Annexin OS=Echinococcus granulosus OX=6210 GN=EGR_... [more]
A0A267FPW20.000e+048.96Annexin OS=Macrostomum lignano OX=282301 GN=BOX15_... [more]
A0A267EJ830.000e+048.96Annexin OS=Macrostomum lignano OX=282301 GN=BOX15_... [more]
back to top
BLAST of Annexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa11a1.358e-10151.78annexin A11 [Source:NCBI gene;Acc:103039162][more]
ENSAMXT00000004530.21.395e-9950.16annexin A11-like [Source:NCBI gene;Acc:103040502][more]
anxa42.383e-9349.20annexin A4 [Source:NCBI gene;Acc:103027730][more]
anxa61.004e-8846.37annexin A6 [Source:NCBI gene;Acc:103026042][more]
anxa65.716e-8746.37annexin A6 [Source:NCBI gene;Acc:103026042][more]
back to top
BLAST of Annexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANXA113.735e-10251.95annexin A11 [Source:HGNC Symbol;Acc:HGNC:535][more]
ANXA71.065e-9847.86annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ANXA79.724e-9650.16annexin A7 [Source:HGNC Symbol;Acc:HGNC:545][more]
ENSPMAT00000001517.13.288e-8746.58pep scaffold:Pmarinus_7.0:GL476341:319620:335761:1... [more]
anxa2a2.232e-6639.06annexin A2a [Source:ZFIN;Acc:ZDB-GENE-030131-4282][more]
back to top
BLAST of Annexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Annexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320435.874e-9950.97Annexin [Source:UniProtKB/TrEMBL;Acc:A7SW86][more]
EDO284442.327e-8948.12Annexin [Source:UniProtKB/TrEMBL;Acc:A7T6G0][more]
EDO440514.362e-7440.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297573.754e-5050.54Annexin [Source:UniProtKB/TrEMBL;Acc:A7T2R2][more]
EDO440493.078e-4146.91Annexin [Source:UniProtKB/TrEMBL;Acc:A7RWX1][more]
back to top
BLAST of Annexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa11a2.739e-10351.11annexin A5 [Source:NCBI gene;Acc:101174691][more]
anxa111.233e-9850.00annexin max4 [Source:NCBI gene;Acc:100049456][more]
anxa112.748e-9850.00annexin max4 [Source:NCBI gene;Acc:100049456][more]
anxa43.767e-9147.44annexin A4 [Source:NCBI gene;Acc:100049454][more]
anxa63.518e-8947.17annexin A6 [Source:NCBI gene;Acc:101156586][more]
back to top
BLAST of Annexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000023108.10.000e+099.73SMESG000023108.1[more]
SMESG000042839.17.460e-9348.78SMESG000042839.1[more]
SMESG000030132.15.465e-9148.02SMESG000030132.1[more]
SMESG000018144.11.215e-939.47SMESG000018144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035226 ID=SMED30035226|Name=Annexin|organism=Schmidtea mediterranea sexual|type=transcript|length=2313bp
AGCGGTTACCACTTTAATTTCAATATTAATATTGAATTAGTATAAACATG
CCATTAGCAGGAGGAGTCGCTGCACCGAGTGTGGCCCCTTTAAAGTTAAA
TAAACCTGGCAAGCCTAAAAATCACATTGACACTGGTACATACATTGAAT
TGGATACAGAAACTCCAAATTGTGTTGTTTATTTTACCACTGATGGAACC
AAACCGAATCCATGGAAGCGAGTCATAAATGGGAAAGAATTAACATATCG
ATACAATGGACCGTTTACTTTGAAGCCCGGTAAAAGAACTTTGAAAGCAA
TCGCTCTTCACAAAGTCACAAAGGTTGAGAGTCACGTGATCACGAAAACG
TTTTACGTCGACGACATTGTCGATGTTGAGAGCGACGACGAGAACGTTTA
CGAAATGGAATCGAATCACTCATATAATTCTGACATTGAGGAAAAGAAAA
CTCCTAAATACAATTCTAAACCAATAGATGCATGGAAAGAAAGTGCTGTG
GATAATTTTCTTCATAGAACCTCAGATCAGGGATTTTCTGCGACCAATGT
ATCGGGAACACAGATCAATCTATGGGGTGGAAATCCTGGCATGGGGTGGG
ATGTCCGAACTCCTGGAAATACAACATTTTCTGGTGGTTACGTACCACAA
AATCAATTTCCACCGCCTCAAATGCAATTTCCACAACCAGACATCTCTAT
GATGCAGCAACATCAACTAAACGCCATTGCTAATCAACTGACACAACAAA
TAGACCATAATCGACAAGCTACTGTAGCAGAAGTACGAAATGCTTTAAAG
GAGCTTGAAAATAATAAAATTAAAGCATTACCACCCACAGCGGGACCTGT
TAAAAAGAACAATGAACCTGAAATATTTCCAATAAGCCCGGGCAATGGAG
ATTTAAAATCTCAATTGGAACACATATACGGACATTTGCTCGAGTTTGCT
AGAGGTAACCCCGATTTCAAAGCAGCAATTGGACCTGCAAAGATGGGAAA
GATATTATCAGCTGAATTCGACAAAAATGAGGAATCATTTTTAATAACGA
TTCATTTGGCTAATCCTGACTACAAAAAACCAGTTAATCCTCCACCGAAG
AAAGAACCGTCGCAGAAGTCGCTACGTCCTAAACCAGAAGAAATACCAAA
AGGCCATTCTGTTGAAGAAAAGGTAAGACAGGCAAAGGGAGAAAAGGCTG
CACCCATTGAACTGAAAACAGAGGAAAAACCCCCTGAAAAAGTTGAAAAT
GCTTATTTTGAAACCGAAGAATATGTGCAAGAAGCAACTTTATTCCCATT
TCCTAATTTTAATGCCAACGAAGACTGTGAAAAATTACGAAAAGCCATGA
AAGGACTGGGAACAGACGAAGCAGCTATTATAGACGTAATGGGTAAAAGA
TCATTTAAACAAAGAATGGAAATCGTTCAAAAATTCAAAACATTGTTGGG
TCGGGATCTTATTGCCGATTTTGATAGCGAACTAAGTGGAAACTTTCTTA
AAATATGTAAAGCGCTATGTATAGGCCCTGACGAGTACGATGCGTCAGAA
TTAAGAGCTGCAATGAAGGGATTGGGTACAGACGAAGATGCTTTGATTGA
GATAATTTGTACAAGAACCAATGCTCAAATTAAATCTTTTAAGGAAAAAT
ATAAACAATTGTATGCGACCAGAGATTTAGAAAAAGATATTATCAGTGAG
ACGTCGAGTAACTTCAAAAGACTTCTCATTTCTTTACTGCAAGCTTCGAG
AGATGAAAGTCAAACATTTGATCGAAATTTGGCAATTCAAGATGCAAAGG
AACTTTATGAAGCAGGCGAGAAAAAATTCGGAACTGACGAGTCGAAATTC
CACCAGATCATTCTCAATCGTTCTAATCCTCATTTAAGAGCAATGTTCGA
AGAGTATGAAAAACTTAGCAAAATGACTTTGGAACAAGCCATTAAATCCG
AAATGAGTGGCGACATAATGAATGGACTCGTTACTTTTGTGCGATGCATT
CAAAACAAGCCGAGATATTTTGCTATGGCACTAAATAAGTCGATGAAAGG
ATTGGGAACTGATGACAGGACGTTATTGAGAATCGTTATTACACGTTGCG
AAATTGACATGGTCCAAATAAAGAAAGCTTTTCAAGCGGAATACTCAAAG
CGCTTAGGAGAGTGGATAAAAGATGATACGTCGGGAGACTACCTGAAAAT
ATTACTTTGGCTTACTGGAGAAAATGATCTTATCAAATAAAATATTTTAA
ATGATTCAAAAACTTATGAAAAATGAAACAATTAAATATTTATAATAAAT
TCTTATGAGCAGG
back to top

protein sequence of SMED30035226-orf-1

>SMED30035226-orf-1 ID=SMED30035226-orf-1|Name=SMED30035226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=731bp
MPLAGGVAAPSVAPLKLNKPGKPKNHIDTGTYIELDTETPNCVVYFTTDG
TKPNPWKRVINGKELTYRYNGPFTLKPGKRTLKAIALHKVTKVESHVITK
TFYVDDIVDVESDDENVYEMESNHSYNSDIEEKKTPKYNSKPIDAWKESA
VDNFLHRTSDQGFSATNVSGTQINLWGGNPGMGWDVRTPGNTTFSGGYVP
QNQFPPPQMQFPQPDISMMQQHQLNAIANQLTQQIDHNRQATVAEVRNAL
KELENNKIKALPPTAGPVKKNNEPEIFPISPGNGDLKSQLEHIYGHLLEF
ARGNPDFKAAIGPAKMGKILSAEFDKNEESFLITIHLANPDYKKPVNPPP
KKEPSQKSLRPKPEEIPKGHSVEEKVRQAKGEKAAPIELKTEEKPPEKVE
NAYFETEEYVQEATLFPFPNFNANEDCEKLRKAMKGLGTDEAAIIDVMGK
RSFKQRMEIVQKFKTLLGRDLIADFDSELSGNFLKICKALCIGPDEYDAS
ELRAAMKGLGTDEDALIEIICTRTNAQIKSFKEKYKQLYATRDLEKDIIS
ETSSNFKRLLISLLQASRDESQTFDRNLAIQDAKELYEAGEKKFGTDESK
FHQIILNRSNPHLRAMFEEYEKLSKMTLEQAIKSEMSGDIMNGLVTFVRC
IQNKPRYFAMALNKSMKGLGTDDRTLLRIVITRCEIDMVQIKKAFQAEYS
KRLGEWIKDDTSGDYLKILLWLTGENDLIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037104Annexin_sf
IPR001464Annexin
IPR018502Annexin_repeat
IPR018252Annexin_repeat_CS
Vocabulary: molecular function
TermDefinition
GO:0005544calcium-dependent phospholipid binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001464AnnexinPRINTSPR00196ANNEXINcoord: 586..612
score: 51.85
coord: 475..491
score: 37.69
coord: 710..723
score: 62.43
coord: 666..686
score: 59.61
coord: 435..457
score: 53.22
coord: 502..523
score: 68.52
IPR018502Annexin repeatSMARTSM00335annex3coord: 510..563
e-value: 8.3E-19
score: 78.5
coord: 438..490
e-value: 2.1E-15
score: 67.2
coord: 670..722
e-value: 3.1E-17
score: 73.2
coord: 595..647
e-value: 7.8E-13
score: 58.6
IPR018502Annexin repeatPFAMPF00191Annexincoord: 497..563
e-value: 6.7E-22
score: 77.3
coord: 426..490
e-value: 8.2E-19
score: 67.5
coord: 657..720
e-value: 3.9E-19
score: 68.5
coord: 581..645
e-value: 1.2E-20
score: 73.4
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 494..567
e-value: 4.7E-28
score: 99.1
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 420..491
e-value: 7.7E-23
score: 82.3
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 568..653
e-value: 8.4E-29
score: 101.5
IPR037104Annexin superfamilyGENE3DG3DSA:1.10.220.10coord: 655..725
e-value: 3.1E-24
score: 86.7
IPR037104Annexin superfamilySUPERFAMILYSSF47874Annexincoord: 413..727
NoneNo IPR availablePFAMPF13290CHB_HEX_C_1coord: 26..98
e-value: 9.1E-11
score: 41.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 342..392
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 346..392
NoneNo IPR availablePANTHERPTHR10502ANNEXINcoord: 375..724
NoneNo IPR availablePANTHERPTHR10502:SF181coord: 375..724
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 653..724
score: 23.43
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 421..492
score: 24.802
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 493..565
score: 28.751
NoneNo IPR availablePROSITEPS51897ANNEXIN_2coord: 577..649
score: 25.002
IPR018252Annexin repeat, conserved sitePROSITEPS00223ANNEXIN_1coord: 670..722