eukaryotic translation initiation factor 4E-binding protein 1
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30035225 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 1
Homology
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Match: EIF4EBP3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3290]) HSP 1 Score: 50.0618 bits (118), Expect = 3.403e-8 Identity = 24/64 (37.50%), Postives = 39/64 (60.94%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKK-AIETKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++LL+ +NSP ++TPP CL +P + A +K + E D++QF+MD+ Sbjct: 37 RIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI 100
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Match: EIF4EBP1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3288]) HSP 1 Score: 48.9062 bits (115), Expect = 1.383e-7 Identity = 24/68 (35.29%), Postives = 40/68 (58.82%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA----IETKTQHC-SMNEAVLNYDDESQFQMDL 373 RI+YDR++L++ RNSP ++TPP+ L +P + + +E H + E +ESQF+MD+ Sbjct: 51 RIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI 118
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Match: EIF4EBP2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3289]) HSP 1 Score: 48.1358 bits (113), Expect = 2.973e-7 Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373 RI+YDR++LL RNSP +QTPP L N+P + IE + + N+D D++QF+MD+ Sbjct: 51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Fly
Match: Thor (gene:FBgn0261560 transcript:FBtr0077524) HSP 1 Score: 44.2838 bits (103), Expect = 3.296e-6 Identity = 23/70 (32.86%), Postives = 36/70 (51.43%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCS-------MNEAVLNYDDESQFQMDL 373 +++Y+R ++ LR SP SQTPP +NVP ++ T + C L +D+ QFQ+DL Sbjct: 51 KLIYERAFMKNLRGSPLSQTPP---SNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKIEDQEQFQLDL 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Fly
Match: Thor (gene:FBgn0261560 transcript:FBtr0345289) HSP 1 Score: 44.2838 bits (103), Expect = 3.296e-6 Identity = 23/70 (32.86%), Postives = 36/70 (51.43%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCS-------MNEAVLNYDDESQFQMDL 373 +++Y+R ++ LR SP SQTPP +NVP ++ T + C L +D+ QFQ+DL Sbjct: 51 KLIYERAFMKNLRGSPLSQTPP---SNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKIEDQEQFQLDL 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-031118-83]) HSP 1 Score: 48.521 bits (114), Expect = 1.126e-7 Identity = 23/67 (34.33%), Postives = 40/67 (59.70%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI----ETKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++LL RNSP +QTPP L +P + K + + + + ++A +++QF+MD+ Sbjct: 47 RIIYDRKFLLDRRNSPIAQTPPAHLPVIPGVTGKNILNEIKRNEANNINNHDAKPGQGEDAQFEMDI 113
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-041114-44]) HSP 1 Score: 47.7506 bits (112), Expect = 1.458e-7 Identity = 25/63 (39.68%), Postives = 42/63 (66.67%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++LL+ RNSP ++TPP CL ++P + + +++ Q + L+ DD SQF +D+ Sbjct: 46 RIIYDRKFLLECRNSPIARTPPCCLPDIPGV-TRPSLQIIEQE--EDSKDLSIDD-SQFVIDI 104
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2332]) HSP 1 Score: 47.7506 bits (112), Expect = 2.426e-7 Identity = 22/73 (30.14%), Postives = 40/73 (54.79%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN----------YDDESQFQMDL 373 RI+YDR++LL R+SP ++TPP CL ++P + ++ + +V N +++QF+MD+ Sbjct: 48 RIIYDRKFLLDCRSSPLARTPPCCLPDIPGVTSPPSVTVNNEKAYPKPSVNNNSISPPVDKSTGEDAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp3l (eukaryotic translation initiation factor 4E binding protein 3, like [Source:NCBI gene;Acc:324490]) HSP 1 Score: 47.3654 bits (111), Expect = 3.001e-7 Identity = 24/66 (36.36%), Postives = 38/66 (57.58%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIF---MKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++LL RNSP ++TPP CL +P + + + + + E D+SQF+MD+ Sbjct: 47 RIIYDRKFLLDCRNSPIARTPPCCLPQIPGVTIPSLHPVSKLQELKEELEEEKELAADDSQFEMDI 112
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2332]) HSP 1 Score: 47.3654 bits (111), Expect = 3.561e-7 Identity = 22/73 (30.14%), Postives = 39/73 (53.42%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN----------YDDESQFQMDL 373 RI+YDR++LL R+SP ++TPP CL ++P + ++ + V N +++QF+MD+ Sbjct: 48 RIIYDRKFLLDCRSSPLARTPPCCLPDIPGVTSPPSVTVNNEKAYPKPTVNNNSISPPVDKSTGEDAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Xenopus
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:NCBI gene;Acc:394958]) HSP 1 Score: 52.373 bits (124), Expect = 4.568e-9 Identity = 26/67 (38.81%), Postives = 42/67 (62.69%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI--ETKTQHCSMN--EAVLNYDDESQFQMDL 373 RI+YDR++LL RNSP +QTPP+ L ++P + E+K + ++N + D+SQF+MD+ Sbjct: 47 RIIYDRKFLLDRRNSPLAQTPPRRLPDIPGVTSPNTAVEESKVETNNLNNHDTKTAAGDDSQFEMDI 113
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:MGI Symbol;Acc:MGI:103267]) HSP 1 Score: 52.7582 bits (125), Expect = 3.078e-9 Identity = 26/68 (38.24%), Postives = 42/68 (61.76%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIE-----TKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++L++ RNSP ++TPPK L +P + + E +++Q S E +ESQF+MD+ Sbjct: 50 RIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:MGI Symbol;Acc:MGI:109198]) HSP 1 Score: 51.2174 bits (121), Expect = 1.103e-8 Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373 RI+YDR++LL RNSP +QTPP L N+P + A IE + + N+D DE+QF+MD+ Sbjct: 51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:MGI Symbol;Acc:MGI:109198]) HSP 1 Score: 51.2174 bits (121), Expect = 1.103e-8 Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373 RI+YDR++LL RNSP +QTPP L N+P + A IE + + N+D DE+QF+MD+ Sbjct: 51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:MGI Symbol;Acc:MGI:1270847]) HSP 1 Score: 50.0618 bits (118), Expect = 2.039e-8 Identity = 43/102 (42.16%), Postives = 61/102 (59.80%), Query Frame = 2 Query: 74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHC--SMNEAVLNYDDESQFQMDL 373 MSSS +D +L + STTPGGTLY TTPGGTRI+YDR++LL+ +NSP ++TPP CL +P + A+ + + D+ QF+MD+ Sbjct: 1 MSSSTSCPIPGCRD-QLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTLPAVPPSKLELLKEQKQTEVEITDDEQFEMDM 101
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q60876|4EBP1_MOUSE (Eukaryotic translation initiation factor 4E-binding protein 1 OS=Mus musculus OX=10090 GN=Eif4ebp1 PE=1 SV=3) HSP 1 Score: 52.7582 bits (125), Expect = 2.153e-8 Identity = 26/68 (38.24%), Postives = 42/68 (61.76%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIE-----TKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++L++ RNSP ++TPPK L +P + + E +++Q S E +ESQF+MD+ Sbjct: 50 RIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q62622|4EBP1_RAT (Eukaryotic translation initiation factor 4E-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Eif4ebp1 PE=1 SV=3) HSP 1 Score: 51.9878 bits (123), Expect = 3.999e-8 Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHC-----SMNEAVLNYDDESQFQMDL 373 RI+YDR++L++ RNSP ++TPPK L +P + + E Q S E +ESQF+MD+ Sbjct: 50 RIIYDRKFLMECRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q0P5A7|4EBP1_BOVIN (Eukaryotic translation initiation factor 4E-binding protein 1 OS=Bos taurus OX=9913 GN=EIF4EBP1 PE=3 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 4.825e-8 Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQ----HC-SMNEAVLNYDDESQFQMDL 373 RI+YDR++L++ RNSP ++TPP+ L +P + E T+ H S E +ESQF+MD+ Sbjct: 51 RIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPTGDEPPTEARQNHLRSSPEDKPAGGEESQFEMDI 118
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|P70445|4EBP2_MOUSE (Eukaryotic translation initiation factor 4E-binding protein 2 OS=Mus musculus OX=10090 GN=Eif4ebp2 PE=1 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 7.713e-8 Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373 RI+YDR++LL RNSP +QTPP L N+P + A IE + + N+D DE+QF+MD+ Sbjct: 51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q80VV3|4EBP3_MOUSE (Eukaryotic translation initiation factor 4E-binding protein 3 OS=Mus musculus OX=10090 GN=Eif4ebp3 PE=1 SV=1) HSP 1 Score: 50.0618 bits (118), Expect = 1.426e-7 Identity = 43/102 (42.16%), Postives = 61/102 (59.80%), Query Frame = 2 Query: 74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHC--SMNEAVLNYDDESQFQMDL 373 MSSS +D +L + STTPGGTLY TTPGGTRI+YDR++LL+ +NSP ++TPP CL +P + A+ + + D+ QF+MD+ Sbjct: 1 MSSSTSCPIPGCRD-QLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTLPAVPPSKLELLKEQKQTEVEITDDEQFEMDM 101
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: D2DJT7 (4EBP-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1) HSP 1 Score: 148.673 bits (374), Expect = 1.585e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 2 Query: 74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN 340 MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN Sbjct: 1 MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN 89
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A4W4GKX3 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=LOC113571276 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.107e-8 Identity = 49/109 (44.95%), Postives = 68/109 (62.39%), Query Frame = 2 Query: 77 SSSNYILPSAAKDIK----LLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI------ETKTQHCSMNEAVLNYDDESQFQMDL 373 +SS+Y +PS A D K L S TPGGT++ TTPGGTRI+YDR++LL+ RNSP ++TPP CL ++P + M A E + ++C A D+SQF MD+ Sbjct: 7 ASSSYPIPSRASDAKNWSPLPECYSQTPGGTVFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPHIPGVTMPSAHPLGSLQERQEENCQELSA-----DDSQFVMDI 110
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A401T378 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0015537 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 1.923e-8 Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIET---KTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++L++ RNSP ++TPP+ L N+P + A E T H + +E D++QF+MD+ Sbjct: 15 RIIYDRKFLMECRNSPVAKTPPRDLPNIPGVTSPNATEKVKPATNHVNSHEEKAAGGDDAQFEMDI 80
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A4D5R984 (Eukaryotic translation initiation factor 4E-binding protein OS=Scolopendra viridis OX=118503 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 4.039e-8 Identity = 28/69 (40.58%), Postives = 42/69 (60.87%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI------ETKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR +LLQ+RNSP ++TPPK L N+P + + A E +H + + + DE QF+MD+ Sbjct: 50 RIIYDRAFLLQMRNSPMAKTPPKNLPNIPGVTCRVASLSNSPKENGERHDAKGDEKQEHHDEPQFEMDI 118
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A232EVL8 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_005733 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 9.217e-8 Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSM------NEAVLNYDDESQFQMDL 373 RIVY+R +L+ LRNSP SQTPPK + N+P +K A T T + + AVL+ E QF+MD+ Sbjct: 50 RIVYERAFLMNLRNSPISQTPPKNMPNIPASLLKSAAPTVTSADKIPSPPVKDAAVLDESAE-QFEMDM 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp3 (eukaryotic translation initiation factor 4E-binding protein 3-like [Source:NCBI gene;Acc:103030329]) HSP 1 Score: 55.4546 bits (132), Expect = 1.658e-10 Identity = 45/102 (44.12%), Postives = 65/102 (63.73%), Query Frame = 2 Query: 80 SSNYILPSAAKDIK----LLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373 SS +PS A K L ++ S TPGGTL+ TTPGGTRI+YDR++LL+ RNSP ++TPP CL ++P + M ++ T + E + ++SQF MD+ Sbjct: 8 SSGCPIPSRAAAAKSWSPLPDSYSQTPGGTLFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPHIPGVTM-PSVPTLGKLPEQEEDCKDLSEDSQFVMDI 108
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp1 (eukaryotic translation initiation factor 4E-binding protein 2-like [Source:NCBI gene;Acc:103026948]) HSP 1 Score: 47.7506 bits (112), Expect = 2.091e-7 Identity = 25/70 (35.71%), Postives = 39/70 (55.71%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIET---KTQHCSMNEAVLNYD----DESQFQMDL 373 RI+YDR++LL R+SP ++TPP CL ++P + K Q N A D +++QF+MD+ Sbjct: 48 RIIYDRKFLLDCRSSPLARTPPCCLPDIPGVTSPPTATVKNDKAQETLNNNASPPVDKASGEDAQFEMDI 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp3l (eukaryotic translation initiation factor 4E-binding protein 3-like [Source:NCBI gene;Acc:103028149]) HSP 1 Score: 45.0542 bits (105), Expect = 1.769e-6 Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDI 277 RI+YDR++LL RNSP ++TPP CL +P + Sbjct: 47 RIIYDRKFLLDCRNSPIARTPPCCLPQIPGV 77
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp3l (eukaryotic translation initiation factor 4E-binding protein 3-like [Source:NCBI gene;Acc:103028149]) HSP 1 Score: 44.669 bits (104), Expect = 3.168e-6 Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDI 277 RI+YDR++LL RNSP ++TPP CL +P + Sbjct: 47 RIIYDRKFLLDCRNSPIARTPPCCLPQIPGV 77
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:NCBI gene;Acc:103025284]) HSP 1 Score: 44.2838 bits (103), Expect = 3.563e-6 Identity = 25/69 (36.23%), Postives = 41/69 (59.42%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYD------DESQFQMDL 373 RI+YDR++LL RNSP +QTPP L +P + + I + + N+ N+D +++QF+MD+ Sbjct: 47 RIIYDRKFLLDRRNSPIAQTPPAHLPVIPGV-TSQNIRNENKKNEANK-FNNHDGKPGPGEDAQFEMDI 113
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Nematostella
Match: EDO31445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX3]) HSP 1 Score: 50.8322 bits (120), Expect = 4.163e-9 Identity = 27/68 (39.71%), Postives = 41/68 (60.29%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIF----MKKAIETKTQHCSMNEAVLNYD-DESQFQMDL 373 RI+Y+R++LL+LRNSP +++PP L +P + K E K + S+ A D +E QFQMD+ Sbjct: 50 RIIYERKFLLELRNSPLAKSPPANLPVIPGVTCEDNGKPEPEEKPEVTSLPGARGEGDGEEPQFQMDI 117
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: eif4ebp3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:NCBI gene;Acc:101166144]) HSP 1 Score: 53.5286 bits (127), Expect = 1.069e-9 Identity = 24/63 (38.10%), Postives = 37/63 (58.73%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373 RI+YDR++LL+ RNSP ++TPP CL +P + + E + D+SQF+MD+ Sbjct: 47 RIIYDRKFLLECRNSPLARTPPCCLPQIPGVTIPATHSVGKLQDLKEEEEKDVADDSQFEMDI 109
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:NCBI gene;Acc:111948733]) HSP 1 Score: 49.6766 bits (117), Expect = 3.516e-8 Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNY------DDESQFQMDL 373 RI+YDR++LL RNSP +QTPP L +P + + + + Q N + N+ D+SQF+MD+ Sbjct: 47 RIIYDRKFLLDRRNSPIAQTPPAHLPVIPGVTSQNILR-ENQKNEANNHINNHGGKPAAGDDSQFEMDI 114
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028469.1 (eukaryotic translation initiation factor 4E-binding protein 2 [Source:NCBI gene;Acc:101165490]) HSP 1 Score: 45.4394 bits (106), Expect = 1.430e-6 Identity = 28/76 (36.84%), Postives = 47/76 (61.84%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDI-FMKKAIETKTQHCSMN--EAVL--NYD--------DESQFQMDL 373 RI+Y+R++LLQ R SP ++TPP NN+PDI + + + + + H + N EA N+D +++QF+MD+ Sbjct: 48 RIIYERKFLLQCRTSPLARTPP---NNLPDIPGVTRPLNSDSSHDTKNPVEAPTTNNHDTDVQTEEGEDAQFEMDI 120
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:NCBI gene;Acc:101162296]) HSP 1 Score: 44.669 bits (104), Expect = 3.560e-6 Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYD 346 RI+YDR++LL+ R+SP ++TPP+ L ++P + E + ++N V+N D Sbjct: 48 RIIYDRKFLLECRSSPLAKTPPRGLPSIPGVTSPPTKEFNKK--TLNGEVVNID 99
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Planmine SMEST
Match: SMESG000074256.1 (SMESG000074256.1) HSP 1 Score: 169.088 bits (427), Expect = 3.032e-55 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 2 Query: 74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373 MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN DDESQFQMDL Sbjct: 1 MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNDDDESQFQMDL 100
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Planmine SMEST
Match: SMESG000001074.1 (SMESG000001074.1) HSP 1 Score: 49.2914 bits (116), Expect = 2.694e-8 Identity = 24/63 (38.10%), Postives = 41/63 (65.08%), Query Frame = 2 Query: 185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAV-LNYDDESQFQMD 370 +I+YDRQ LL+LR+SP S++PP +N++P I + + ++ M+ + ++ DD QF MD Sbjct: 41 KIIYDRQVLLELRSSPLSKSPPANMNHIPGITFMTIVGSNQENGDMSPRLEVSMDD--QFSMD 101 The following BLAST results are available for this feature:
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 3
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 2
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 5
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 1
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 4
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 5
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 4
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30035225 ID=SMED30035225|Name=eukaryotic translation initiation factor 4E-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=461bpback to top protein sequence of SMED30035225-orf-1 >SMED30035225-orf-1 ID=SMED30035225-orf-1|Name=SMED30035225-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRback to top Annotated Terms
The following terms have been associated with this transcript:
|