eukaryotic translation initiation factor 4E-binding protein 1

Overview
Nameeukaryotic translation initiation factor 4E-binding protein 1
Smed IDSMED30035225
Length (bp)461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of eukaryotic translation initiation factor 4E-binding protein 1 (SMED30035225) t-SNE clustered cells

Violin plots show distribution of expression levels for eukaryotic translation initiation factor 4E-binding protein 1 (SMED30035225) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of eukaryotic translation initiation factor 4E-binding protein 1 (SMED30035225) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for eukaryotic translation initiation factor 4E-binding protein 1 (SMED30035225) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035225

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035225SMESG000074256.1 dd_Smed_v4_1877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Match: EIF4EBP3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3290])

HSP 1 Score: 50.0618 bits (118), Expect = 3.403e-8
Identity = 24/64 (37.50%), Postives = 39/64 (60.94%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKK-AIETKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++LL+ +NSP ++TPP CL  +P +     A  +K +     E      D++QF+MD+
Sbjct:   37 RIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI 100          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Match: EIF4EBP1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:HGNC Symbol;Acc:HGNC:3288])

HSP 1 Score: 48.9062 bits (115), Expect = 1.383e-7
Identity = 24/68 (35.29%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA----IETKTQHC-SMNEAVLNYDDESQFQMDL 373
            RI+YDR++L++ RNSP ++TPP+ L  +P +    +    +E    H  +  E      +ESQF+MD+
Sbjct:   51 RIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI 118          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Match: EIF4EBP2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:HGNC Symbol;Acc:HGNC:3289])

HSP 1 Score: 48.1358 bits (113), Expect = 2.973e-7
Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L N+P +      IE      +    + N+D      D++QF+MD+
Sbjct:   51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Fly
Match: Thor (gene:FBgn0261560 transcript:FBtr0077524)

HSP 1 Score: 44.2838 bits (103), Expect = 3.296e-6
Identity = 23/70 (32.86%), Postives = 36/70 (51.43%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCS-------MNEAVLNYDDESQFQMDL 373
            +++Y+R ++  LR SP SQTPP   +NVP   ++    T  + C             L  +D+ QFQ+DL
Sbjct:   51 KLIYERAFMKNLRGSPLSQTPP---SNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKIEDQEQFQLDL 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Fly
Match: Thor (gene:FBgn0261560 transcript:FBtr0345289)

HSP 1 Score: 44.2838 bits (103), Expect = 3.296e-6
Identity = 23/70 (32.86%), Postives = 36/70 (51.43%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCS-------MNEAVLNYDDESQFQMDL 373
            +++Y+R ++  LR SP SQTPP   +NVP   ++    T  + C             L  +D+ QFQ+DL
Sbjct:   51 KLIYERAFMKNLRGSPLSQTPP---SNVPSCLLRGTPRTPFRKCVPVPTELIKQTKSLKIEDQEQFQLDL 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-031118-83])

HSP 1 Score: 48.521 bits (114), Expect = 1.126e-7
Identity = 23/67 (34.33%), Postives = 40/67 (59.70%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI----ETKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L  +P +  K  +      +  + + ++A     +++QF+MD+
Sbjct:   47 RIIYDRKFLLDRRNSPIAQTPPAHLPVIPGVTGKNILNEIKRNEANNINNHDAKPGQGEDAQFEMDI 113          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-041114-44])

HSP 1 Score: 47.7506 bits (112), Expect = 1.458e-7
Identity = 25/63 (39.68%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++LL+ RNSP ++TPP CL ++P +  + +++   Q    +   L+ DD SQF +D+
Sbjct:   46 RIIYDRKFLLECRNSPIARTPPCCLPDIPGV-TRPSLQIIEQE--EDSKDLSIDD-SQFVIDI 104          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2332])

HSP 1 Score: 47.7506 bits (112), Expect = 2.426e-7
Identity = 22/73 (30.14%), Postives = 40/73 (54.79%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN----------YDDESQFQMDL 373
            RI+YDR++LL  R+SP ++TPP CL ++P +    ++    +      +V N            +++QF+MD+
Sbjct:   48 RIIYDRKFLLDCRSSPLARTPPCCLPDIPGVTSPPSVTVNNEKAYPKPSVNNNSISPPVDKSTGEDAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp3l (eukaryotic translation initiation factor 4E binding protein 3, like [Source:NCBI gene;Acc:324490])

HSP 1 Score: 47.3654 bits (111), Expect = 3.001e-7
Identity = 24/66 (36.36%), Postives = 38/66 (57.58%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIF---MKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++LL  RNSP ++TPP CL  +P +    +    + +     + E      D+SQF+MD+
Sbjct:   47 RIIYDRKFLLDCRNSPIARTPPCCLPQIPGVTIPSLHPVSKLQELKEELEEEKELAADDSQFEMDI 112          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Match: eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2332])

HSP 1 Score: 47.3654 bits (111), Expect = 3.561e-7
Identity = 22/73 (30.14%), Postives = 39/73 (53.42%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN----------YDDESQFQMDL 373
            RI+YDR++LL  R+SP ++TPP CL ++P +    ++    +       V N            +++QF+MD+
Sbjct:   48 RIIYDRKFLLDCRSSPLARTPPCCLPDIPGVTSPPSVTVNNEKAYPKPTVNNNSISPPVDKSTGEDAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Xenopus
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:NCBI gene;Acc:394958])

HSP 1 Score: 52.373 bits (124), Expect = 4.568e-9
Identity = 26/67 (38.81%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI--ETKTQHCSMN--EAVLNYDDESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP+ L ++P +        E+K +  ++N  +      D+SQF+MD+
Sbjct:   47 RIIYDRKFLLDRRNSPLAQTPPRRLPDIPGVTSPNTAVEESKVETNNLNNHDTKTAAGDDSQFEMDI 113          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:MGI Symbol;Acc:MGI:103267])

HSP 1 Score: 52.7582 bits (125), Expect = 3.078e-9
Identity = 26/68 (38.24%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIE-----TKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++L++ RNSP ++TPPK L  +P +    + E     +++Q  S  E      +ESQF+MD+
Sbjct:   50 RIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:MGI Symbol;Acc:MGI:109198])

HSP 1 Score: 51.2174 bits (121), Expect = 1.103e-8
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L N+P +    A IE      +    + N+D      DE+QF+MD+
Sbjct:   51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:MGI Symbol;Acc:MGI:109198])

HSP 1 Score: 51.2174 bits (121), Expect = 1.103e-8
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L N+P +    A IE      +    + N+D      DE+QF+MD+
Sbjct:   51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Match: Eif4ebp3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:MGI Symbol;Acc:MGI:1270847])

HSP 1 Score: 50.0618 bits (118), Expect = 2.039e-8
Identity = 43/102 (42.16%), Postives = 61/102 (59.80%), Query Frame = 2
Query:   74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHC--SMNEAVLNYDDESQFQMDL 373
            MSSS        +D +L +  STTPGGTLY TTPGGTRI+YDR++LL+ +NSP ++TPP CL  +P +    A+            +  +   D+ QF+MD+
Sbjct:    1 MSSSTSCPIPGCRD-QLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTLPAVPPSKLELLKEQKQTEVEITDDEQFEMDM 101          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q60876|4EBP1_MOUSE (Eukaryotic translation initiation factor 4E-binding protein 1 OS=Mus musculus OX=10090 GN=Eif4ebp1 PE=1 SV=3)

HSP 1 Score: 52.7582 bits (125), Expect = 2.153e-8
Identity = 26/68 (38.24%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIE-----TKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++L++ RNSP ++TPPK L  +P +    + E     +++Q  S  E      +ESQF+MD+
Sbjct:   50 RIIYDRKFLMECRNSPVAKTPPKDLPAIPGVTSPTSDEPPMQASQSQLPSSPEDKRAGGEESQFEMDI 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q62622|4EBP1_RAT (Eukaryotic translation initiation factor 4E-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Eif4ebp1 PE=1 SV=3)

HSP 1 Score: 51.9878 bits (123), Expect = 3.999e-8
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHC-----SMNEAVLNYDDESQFQMDL 373
            RI+YDR++L++ RNSP ++TPPK L  +P +    + E   Q       S  E      +ESQF+MD+
Sbjct:   50 RIIYDRKFLMECRNSPVAKTPPKDLPTIPGVTSPTSDEPPMQASQSHLHSSPEDKRAGGEESQFEMDI 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q0P5A7|4EBP1_BOVIN (Eukaryotic translation initiation factor 4E-binding protein 1 OS=Bos taurus OX=9913 GN=EIF4EBP1 PE=3 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 4.825e-8
Identity = 26/68 (38.24%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQ----HC-SMNEAVLNYDDESQFQMDL 373
            RI+YDR++L++ RNSP ++TPP+ L  +P +      E  T+    H  S  E      +ESQF+MD+
Sbjct:   51 RIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPTGDEPPTEARQNHLRSSPEDKPAGGEESQFEMDI 118          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|P70445|4EBP2_MOUSE (Eukaryotic translation initiation factor 4E-binding protein 2 OS=Mus musculus OX=10090 GN=Eif4ebp2 PE=1 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 7.713e-8
Identity = 29/70 (41.43%), Postives = 41/70 (58.57%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKA-IETKTQHCSMNEAVLNYD------DESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L N+P +    A IE      +    + N+D      DE+QF+MD+
Sbjct:   51 RIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q80VV3|4EBP3_MOUSE (Eukaryotic translation initiation factor 4E-binding protein 3 OS=Mus musculus OX=10090 GN=Eif4ebp3 PE=1 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 1.426e-7
Identity = 43/102 (42.16%), Postives = 61/102 (59.80%), Query Frame = 2
Query:   74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHC--SMNEAVLNYDDESQFQMDL 373
            MSSS        +D +L +  STTPGGTLY TTPGGTRI+YDR++LL+ +NSP ++TPP CL  +P +    A+            +  +   D+ QF+MD+
Sbjct:    1 MSSSTSCPIPGCRD-QLPDGYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTLPAVPPSKLELLKEQKQTEVEITDDEQFEMDM 101          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: D2DJT7 (4EBP-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.585e-43
Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 2
Query:   74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN 340
            MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN
Sbjct:    1 MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN 89          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A4W4GKX3 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=LOC113571276 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.107e-8
Identity = 49/109 (44.95%), Postives = 68/109 (62.39%), Query Frame = 2
Query:   77 SSSNYILPSAAKDIK----LLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI------ETKTQHCSMNEAVLNYDDESQFQMDL 373
            +SS+Y +PS A D K    L    S TPGGT++ TTPGGTRI+YDR++LL+ RNSP ++TPP CL ++P + M  A       E + ++C    A     D+SQF MD+
Sbjct:    7 ASSSYPIPSRASDAKNWSPLPECYSQTPGGTVFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPHIPGVTMPSAHPLGSLQERQEENCQELSA-----DDSQFVMDI 110          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A401T378 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0015537 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 1.923e-8
Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIET---KTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++L++ RNSP ++TPP+ L N+P +    A E     T H + +E      D++QF+MD+
Sbjct:   15 RIIYDRKFLMECRNSPVAKTPPRDLPNIPGVTSPNATEKVKPATNHVNSHEEKAAGGDDAQFEMDI 80          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A4D5R984 (Eukaryotic translation initiation factor 4E-binding protein OS=Scolopendra viridis OX=118503 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.039e-8
Identity = 28/69 (40.58%), Postives = 42/69 (60.87%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAI------ETKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR +LLQ+RNSP ++TPPK L N+P +  + A       E   +H +  +    + DE QF+MD+
Sbjct:   50 RIIYDRAFLLQMRNSPMAKTPPKNLPNIPGVTCRVASLSNSPKENGERHDAKGDEKQEHHDEPQFEMDI 118          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Match: A0A232EVL8 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_005733 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 9.217e-8
Identity = 31/69 (44.93%), Postives = 42/69 (60.87%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSM------NEAVLNYDDESQFQMDL 373
            RIVY+R +L+ LRNSP SQTPPK + N+P   +K A  T T    +      + AVL+   E QF+MD+
Sbjct:   50 RIVYERAFLMNLRNSPISQTPPKNMPNIPASLLKSAAPTVTSADKIPSPPVKDAAVLDESAE-QFEMDM 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp3 (eukaryotic translation initiation factor 4E-binding protein 3-like [Source:NCBI gene;Acc:103030329])

HSP 1 Score: 55.4546 bits (132), Expect = 1.658e-10
Identity = 45/102 (44.12%), Postives = 65/102 (63.73%), Query Frame = 2
Query:   80 SSNYILPSAAKDIK----LLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373
            SS   +PS A   K    L ++ S TPGGTL+ TTPGGTRI+YDR++LL+ RNSP ++TPP CL ++P + M  ++ T  +     E   +  ++SQF MD+
Sbjct:    8 SSGCPIPSRAAAAKSWSPLPDSYSQTPGGTLFSTTPGGTRIIYDRKFLLECRNSPIARTPPCCLPHIPGVTM-PSVPTLGKLPEQEEDCKDLSEDSQFVMDI 108          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp1 (eukaryotic translation initiation factor 4E-binding protein 2-like [Source:NCBI gene;Acc:103026948])

HSP 1 Score: 47.7506 bits (112), Expect = 2.091e-7
Identity = 25/70 (35.71%), Postives = 39/70 (55.71%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIET---KTQHCSMNEAVLNYD----DESQFQMDL 373
            RI+YDR++LL  R+SP ++TPP CL ++P +           K Q    N A    D    +++QF+MD+
Sbjct:   48 RIIYDRKFLLDCRSSPLARTPPCCLPDIPGVTSPPTATVKNDKAQETLNNNASPPVDKASGEDAQFEMDI 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp3l (eukaryotic translation initiation factor 4E-binding protein 3-like [Source:NCBI gene;Acc:103028149])

HSP 1 Score: 45.0542 bits (105), Expect = 1.769e-6
Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDI 277
            RI+YDR++LL  RNSP ++TPP CL  +P +
Sbjct:   47 RIIYDRKFLLDCRNSPIARTPPCCLPQIPGV 77          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp3l (eukaryotic translation initiation factor 4E-binding protein 3-like [Source:NCBI gene;Acc:103028149])

HSP 1 Score: 44.669 bits (104), Expect = 3.168e-6
Identity = 17/31 (54.84%), Postives = 24/31 (77.42%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDI 277
            RI+YDR++LL  RNSP ++TPP CL  +P +
Sbjct:   47 RIIYDRKFLLDCRNSPIARTPPCCLPQIPGV 77          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:NCBI gene;Acc:103025284])

HSP 1 Score: 44.2838 bits (103), Expect = 3.563e-6
Identity = 25/69 (36.23%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYD------DESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L  +P +   + I  + +    N+   N+D      +++QF+MD+
Sbjct:   47 RIIYDRKFLLDRRNSPIAQTPPAHLPVIPGV-TSQNIRNENKKNEANK-FNNHDGKPGPGEDAQFEMDI 113          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Nematostella
Match: EDO31445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX3])

HSP 1 Score: 50.8322 bits (120), Expect = 4.163e-9
Identity = 27/68 (39.71%), Postives = 41/68 (60.29%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIF----MKKAIETKTQHCSMNEAVLNYD-DESQFQMDL 373
            RI+Y+R++LL+LRNSP +++PP  L  +P +      K   E K +  S+  A    D +E QFQMD+
Sbjct:   50 RIIYERKFLLELRNSPLAKSPPANLPVIPGVTCEDNGKPEPEEKPEVTSLPGARGEGDGEEPQFQMDI 117          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: eif4ebp3 (eukaryotic translation initiation factor 4E binding protein 3 [Source:NCBI gene;Acc:101166144])

HSP 1 Score: 53.5286 bits (127), Expect = 1.069e-9
Identity = 24/63 (38.10%), Postives = 37/63 (58.73%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373
            RI+YDR++LL+ RNSP ++TPP CL  +P + +              E   +  D+SQF+MD+
Sbjct:   47 RIIYDRKFLLECRNSPLARTPPCCLPQIPGVTIPATHSVGKLQDLKEEEEKDVADDSQFEMDI 109          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: eif4ebp2 (eukaryotic translation initiation factor 4E binding protein 2 [Source:NCBI gene;Acc:111948733])

HSP 1 Score: 49.6766 bits (117), Expect = 3.516e-8
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNY------DDESQFQMDL 373
            RI+YDR++LL  RNSP +QTPP  L  +P +  +  +  + Q    N  + N+       D+SQF+MD+
Sbjct:   47 RIIYDRKFLLDRRNSPIAQTPPAHLPVIPGVTSQNILR-ENQKNEANNHINNHGGKPAAGDDSQFEMDI 114          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028469.1 (eukaryotic translation initiation factor 4E-binding protein 2 [Source:NCBI gene;Acc:101165490])

HSP 1 Score: 45.4394 bits (106), Expect = 1.430e-6
Identity = 28/76 (36.84%), Postives = 47/76 (61.84%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDI-FMKKAIETKTQHCSMN--EAVL--NYD--------DESQFQMDL 373
            RI+Y+R++LLQ R SP ++TPP   NN+PDI  + + + + + H + N  EA    N+D        +++QF+MD+
Sbjct:   48 RIIYERKFLLQCRTSPLARTPP---NNLPDIPGVTRPLNSDSSHDTKNPVEAPTTNNHDTDVQTEEGEDAQFEMDI 120          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Match: eif4ebp1 (eukaryotic translation initiation factor 4E binding protein 1 [Source:NCBI gene;Acc:101162296])

HSP 1 Score: 44.669 bits (104), Expect = 3.560e-6
Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYD 346
            RI+YDR++LL+ R+SP ++TPP+ L ++P +      E   +  ++N  V+N D
Sbjct:   48 RIIYDRKFLLECRSSPLAKTPPRGLPSIPGVTSPPTKEFNKK--TLNGEVVNID 99          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Planmine SMEST
Match: SMESG000074256.1 (SMESG000074256.1)

HSP 1 Score: 169.088 bits (427), Expect = 3.032e-55
Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 2
Query:   74 MSSSNYILPSAAKDIKLLNNISXXXXXXXXXXXXXXXRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL 373
            MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLN DDESQFQMDL
Sbjct:    1 MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNDDDESQFQMDL 100          
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Planmine SMEST
Match: SMESG000001074.1 (SMESG000001074.1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.694e-8
Identity = 24/63 (38.10%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  185 RIVYDRQYLLQLRNSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAV-LNYDDESQFQMD 370
            +I+YDRQ LL+LR+SP S++PP  +N++P I     + +  ++  M+  + ++ DD  QF MD
Sbjct:   41 KIIYDRQVLLELRSSPLSKSPPANMNHIPGITFMTIVGSNQENGDMSPRLEVSMDD--QFSMD 101          
The following BLAST results are available for this feature:
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
EIF4EBP33.403e-837.50eukaryotic translation initiation factor 4E bindin... [more]
EIF4EBP11.383e-735.29eukaryotic translation initiation factor 4E bindin... [more]
EIF4EBP22.973e-738.57eukaryotic translation initiation factor 4E bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Thor3.296e-632.86gene:FBgn0261560 transcript:FBtr0077524[more]
Thor3.296e-632.86gene:FBgn0261560 transcript:FBtr0345289[more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4ebp21.126e-734.33eukaryotic translation initiation factor 4E bindin... [more]
eif4ebp31.458e-739.68eukaryotic translation initiation factor 4E bindin... [more]
eif4ebp12.426e-730.14eukaryotic translation initiation factor 4E bindin... [more]
eif4ebp3l3.001e-736.36eukaryotic translation initiation factor 4E bindin... [more]
eif4ebp13.561e-730.14eukaryotic translation initiation factor 4E bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4ebp24.568e-938.81eukaryotic translation initiation factor 4E bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Eif4ebp13.078e-938.24eukaryotic translation initiation factor 4E bindin... [more]
Eif4ebp21.103e-841.43eukaryotic translation initiation factor 4E bindin... [more]
Eif4ebp21.103e-841.43eukaryotic translation initiation factor 4E bindin... [more]
Eif4ebp32.039e-842.16eukaryotic translation initiation factor 4E bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60876|4EBP1_MOUSE2.153e-838.24Eukaryotic translation initiation factor 4E-bindin... [more]
sp|Q62622|4EBP1_RAT3.999e-838.24Eukaryotic translation initiation factor 4E-bindin... [more]
sp|Q0P5A7|4EBP1_BOVIN4.825e-838.24Eukaryotic translation initiation factor 4E-bindin... [more]
sp|P70445|4EBP2_MOUSE7.713e-841.43Eukaryotic translation initiation factor 4E-bindin... [more]
sp|Q80VV3|4EBP3_MOUSE1.426e-742.16Eukaryotic translation initiation factor 4E-bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJT71.585e-43100.004EBP-like protein (Fragment) OS=Schmidtea mediterr... [more]
A0A4W4GKX31.107e-844.95Uncharacterized protein OS=Electrophorus electricu... [more]
A0A401T3781.923e-839.39Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A4D5R9844.039e-840.58Eukaryotic translation initiation factor 4E-bindin... [more]
A0A232EVL89.217e-844.93Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4ebp31.658e-1044.12eukaryotic translation initiation factor 4E-bindin... [more]
eif4ebp12.091e-735.71eukaryotic translation initiation factor 4E-bindin... [more]
eif4ebp3l1.769e-654.84eukaryotic translation initiation factor 4E-bindin... [more]
eif4ebp3l3.168e-654.84eukaryotic translation initiation factor 4E-bindin... [more]
eif4ebp23.563e-636.23eukaryotic translation initiation factor 4E bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO314454.163e-939.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
eif4ebp31.069e-938.10eukaryotic translation initiation factor 4E bindin... [more]
eif4ebp23.516e-837.68eukaryotic translation initiation factor 4E bindin... [more]
ENSORLT00000028469.11.430e-636.84eukaryotic translation initiation factor 4E-bindin... [more]
eif4ebp13.560e-637.04eukaryotic translation initiation factor 4E bindin... [more]
back to top
BLAST of eukaryotic translation initiation factor 4E-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074256.13.032e-5599.00SMESG000074256.1[more]
SMESG000001074.12.694e-838.10SMESG000001074.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035225 ID=SMED30035225|Name=eukaryotic translation initiation factor 4E-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=461bp
TACCATATGATATTATTTGTAAATATAACTTACAATTTTCTTTACACTAA
AATTAAAATTAAGATATTTTTAGATGAGTTCTTCTAATTACATTTTGCCA
TCTGCAGCTAAAGATATAAAACTTTTAAATAACATTTCAACCACACCCGG
TGGAACACTTTACGGCACAACTCCAGGAGGTACTCGAATAGTATATGACC
GTCAGTATTTGTTGCAATTGCGAAACTCCCCTTATAGTCAAACACCACCA
AAATGTTTGAATAATGTACCTGACATATTTATGAAAAAAGCAATAGAAAC
TAAAACGCAACACTGTTCGATGAATGAAGCTGTTTTAAATTATGATGATG
AAAGTCAATTTCAAATGGATTTATAGTTTTATATATTTACAACATTTAAT
TCCATATTTCGAAATTAATGATATTTGAAACATAATTTTTCGTGTGCTCC
TTGGAATAGAT
back to top

protein sequence of SMED30035225-orf-1

>SMED30035225-orf-1 ID=SMED30035225-orf-1|Name=SMED30035225-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MSSSNYILPSAAKDIKLLNNISTTPGGTLYGTTPGGTRIVYDRQYLLQLR
NSPYSQTPPKCLNNVPDIFMKKAIETKTQHCSMNEAVLNYDDESQFQMDL
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR008606EIF4EBP
Vocabulary: biological process
TermDefinition
GO:0045947negative regulation of translational initiation
GO:0006413translational initiation
Vocabulary: molecular function
TermDefinition
GO:0008190eukaryotic initiation factor 4E binding
GO:0003743translation initiation factor activity