Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30035224
Length (bp)3332
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30035224) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30035224) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30035224) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30035224) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035224

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30035224SMESG000020691.1 dd_Smed_v4_17110_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30035224SMESG000020691.1 SmedASXL_016739SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30035224SMESG000020691.1 dd_Smed_v4_17110_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035224SMESG000020691.1 dd_Smed_v6_17110_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30035224SMESG000020691.1 OX_Smed_1.0.08199ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 212.616 bits (540), Expect = 9.664e-56
Identity = 196/671 (29.21%), Postives = 314/671 (46.80%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D     +  +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL--DCRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 109.383 bits (272), Expect = 1.974e-23
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N K+ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSAMDADSGPNAKINYLLGPDAPPE------FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 83.9593 bits (206), Expect = 1.100e-15
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.772 bits (543), Expect = 1.021e-55
Identity = 196/671 (29.21%), Postives = 314/671 (46.80%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D     +  +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL--DCRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 108.997 bits (271), Expect = 3.196e-23
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N K+ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSAMDADSGPNAKINYLLGPDAPPE------FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 85.5001 bits (210), Expect = 5.057e-16
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.386 bits (542), Expect = 1.024e-55
Identity = 196/671 (29.21%), Postives = 314/671 (46.80%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D     +  +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL--DCRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 108.997 bits (271), Expect = 2.854e-23
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N K+ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSAMDADSGPNAKINYLLGPDAPPE------FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 85.5001 bits (210), Expect = 5.104e-16
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.386 bits (542), Expect = 1.073e-55
Identity = 196/671 (29.21%), Postives = 314/671 (46.80%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D     +  +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL--DCRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 108.612 bits (270), Expect = 3.941e-23
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N K+ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSAMDADSGPNAKINYLLGPDAPPE------FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 85.5001 bits (210), Expect = 5.264e-16
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 213.386 bits (542), Expect = 1.230e-55
Identity = 196/671 (29.21%), Postives = 314/671 (46.80%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D     +  +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL--DCRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 108.612 bits (270), Expect = 4.345e-23
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N K+ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSAMDADSGPNAKINYLLGPDAPPE------FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 85.1149 bits (209), Expect = 5.746e-16
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 147.132 bits (370), Expect = 3.106e-35
Identity = 169/669 (25.26%), Postives = 286/669 (42.75%), Query Frame = 1
Query:  538 GNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDEN-----NNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTEN---FYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIE--TKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIW--FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLND 2487
            G ++  ER+D             A N  +   I  K+      S ++ + + +ID ND+ P        + + E+  IG  +    A+D D S  N + +Y + E +  F +  D     S  ++  K +D E    Y++ + A D   P   T+ +I V ++D NDN P F+   YNV++ E +P G  I+T+KA+D D  +    I Y I+    D  V S   +      L ++  L    R  +  +V    ++ GG      VNV++ D N     N+ P           + + E+ P+   +  L   D D G N+ I   +    DS++F  ++ S    S+  S   D E      + +   D  SP L+T+  + + + D N+ SP F  S Y A + E+ P  +  LQ++A D D   N  + +  +  + +      ++D  +G +  +   +DRE+ + I   ++  D     S +A   +   +SD NDN P F + ++   I EN  V S VG ++A D DEG  A + + +     ++  +++     + NG +   T+ E D E   N            L+    T  V I + D NDNKP    F+    N   NV    ++G I         D   N  ++Y+L  ND
Sbjct:  430 GEVTLRERID-------------AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSM-EGSEDFIIDED-----SGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK---ITYRIEEA--DREVFSILDIGDQGAILSVSGELK---RQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPF---------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI----DSSQFFRIDPSSGDISV--SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK-LDREQFAVIVLPIFARDR-GTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEE--DAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSS---TVPVRIHVSDVNDNKPALKDFVIL-MNRFDNVQMARQIGFI------PAFDPDQNATLEYFLEEND 1041          

HSP 2 Score: 139.428 bits (350), Expect = 7.225e-33
Identity = 168/660 (25.45%), Postives = 295/660 (44.70%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN-GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYR---LTLEATDLGSPPM 2619
            S S  V + ++D  DN P F K +    I E A IG  +    A D D S  N   EY L E      L    +  KS  +Q    +D E  +   + ++A D   P   +   + + V D NDN P F S  YNV++ E I +   I TVKA D D   N   ++YS+       +      ++  TG++ L E +++K        + A+D           + + V D N++ P    L    + ITL EN  + +E+  +   D D G N +I   ++ ++D     ++++   L  I ++K  D E      L++   D G+PSL+T+ T+ + + D N+ +P F++  Y+  + E  P  S I+ + A D D++  + +  +      +  +D  + G I +    + R+      KV       ++        V   I D N + P F +  FS +I E+  +   V  + A D D G  A + YS+    SS+   +D      ++G I    ++DRE    F++++  +D      N  +T + + + D NDN P +    +S+    ++    VG   +Q+ A D D G NG V Y+  LN+  +  + + F ++ T+G + + ++L   ++    L + A D G+P +
Sbjct:  251 SASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLD-SGENGEIEYSLGEGNGKNLLA---INAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTN-GKVHYSMASS----SGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP---TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDF----IIDEDSGL--IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD----HKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRID-----PSSGDISVSSDLDREDRATFSVIVTASDHASPPLN-TSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF--LNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL 872          

HSP 3 Score: 132.109 bits (331), Expect = 1.047e-30
Identity = 152/631 (24.09%), Postives = 281/631 (44.53%), Query Frame = 1
Query:  619 IVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLL--ACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL 2475
            ++++ +   +K T     +  V++ ++D NDN P F+  +  + I E+  I   +    A D DF +  +VH Y +  S+    L  D     +  + L + ID +     A+        P   +   +T++V D ND+ P   +    ++++E + +G  +  V AID D   N   I YS++           F ++ D+G +   + L+ +   +Y+ +V A+D          T+ V +KD N+N P  D       ++T+ E  P +   I+T+   D   +  I   ++   D   FS+L+       +  S +   +  +V  ++I   D G   L     +N+ I D N  +P FN   +   + E++P   P++ + A D D+    R  +   +  F+ +ID  +G IS + + +DRE  +  S +V  +D  +    T+T  ++  + D NDN P F + +++  I E+I V +   QV A D D G   ++ Y L +  SS    +    L +T+G +    ++DRE      L I   D   P L+     + +T+ + D NDN P +       +I +NS           VG  +  ++A+D D G+N  + + +
Sbjct:  340 LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVH-YSMASSSGIGGLTID---YSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPN-GIIKYSMEG-------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEYNVTISEEMP-RGSQIITLKAVDNDEDQKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFF-RIDPSSGDISVSSD-LDREDRATFSVIVTASDHASPPLNTST-QIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE--SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLS---AASEITLTLSDVNDNAPTFEQLSYDLYIAENS----------PVGSTVGTIVARDADEGDNADISFRI 931          

HSP 4 Score: 131.339 bits (329), Expect = 2.228e-30
Identity = 152/632 (24.05%), Postives = 283/632 (44.78%), Query Frame = 1
Query:  781 LPLEAAVDHDFSSVNRVHE------YRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLA---CDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQE-IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAI-ETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRT 2625
            LP +  ++   +SV   H       Y ++   ++       L   S  ++L K +D E+   + + + A    DP    + ++ VHV D  DN P FE   Y   ++E  P+G T+L+V A DLD  +N   I YS+     + N ++   +N  +G +     L+ +        V+A D         A V + V D N+N P   +    + ++T+LEN  +   IA +  +D D G N  +   +     S+    L        +   ++ D +   +  + I+  D   P+LS+T  L I+++D N+++P    +     + EN      + ++ A DED   N  +++  +  +E+F   ID  +G I TT+ ++DRE  +  S  V   D +   S   + T+   + D NDN P F  + ++  I E +   S +  + A D DE     + Y + +      +EV ++  +   GAI    GE+ R+ D    + I+ TD+  L    V  NV I   D+ ++ P +    +    + +  +  +G  +I L A+D D G+N ++ Y +         ++++F ++ ++G + + + L     A + + + A+D  SPP+ T
Sbjct:  174 LPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGEN-GEIEYSLG----EGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAP---VFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM---ASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG-SEDFI--IDEDSGLIKTTK-LLDRETTARYSLKVTARD-MGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK--ITYRIEEA----DREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGGLQGRCV-VNVFI---DDVNSAPYF---NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID--------SSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNT 766          

HSP 5 Score: 123.635 bits (309), Expect = 4.991e-28
Identity = 148/557 (26.57%), Postives = 246/557 (44.17%), Query Frame = 1
Query:  640 LKNKITDIHSDSINVDLEII----DRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES-TNTFHLK--TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS--DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKID---TVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK--TATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIA 2259
            LK    D+ + S+N    I     D NDN P F K    + I E    G  +    AVD+D    ++   YR+ E+    F +    D+  + S   +L +  D++++ + + T        C    + V + D N + P F    ++V + E  P+GY ++T+KA D DR  N + I YSID           FR++  +GD+ ++  L+ + R  ++  V A D  +        + V + D N+N P       ++   T+ E+ P+   + L VS  D+D+G N ++   L  +  S    L    R   ++  S + D E+  V +L I   D G+PSLS    + +++ D N+ +P F Q  Y  Y+ EN+P  S +  I A D D+  NA + F      +     I+     NG +     I+ R +    +K       L   S   ++TV V+  +SD NDNKP   +        +N+ +   +G + A DPD+   A L+Y L        +E D +   K  G I  K E  R +D +F   ++
Sbjct:  549 LKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND---EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR-QDHKVRVEISATDQGGLQGRCV---VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDN-ARIVYSIDS-------SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ---FTSSSYAATISEDIPVG-TSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVV----RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQN--ATLEYFL--------EENDLIEAEKYTGKILVKQEWKRNMDVSFKTCVS 1071          

HSP 6 Score: 108.612 bits (270), Expect = 2.085e-23
Identity = 107/421 (25.42%), Postives = 194/421 (46.08%), Query Frame = 1
Query: 1408 LLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYV 2643
            L E+ P++ I I +V  S      L    + P +DS   +L         I  +K  D E     +L++  ++   P++S + T+ + +LD  + SP F +  Y   +RE+ P  + +L + A D D  +N  + +          L I+  +G I T   + DRE +S I   V  +D      + +T  V+  + D NDN PVFA ++++  I ENI + +++  V ATD D G    + YS+     +    +  L +  + G +  +  ID + +   T +I   D  +P L+    T  +TI + D ND+ P     +    +I +     +G+ + ++ A D D+G NG ++Y +          ++ F ++  +G +    +L+D    ARY L + A D+G+P + T   + V
Sbjct:  174 LPEDTPIETI-IASVKASHASSQPLYYSMVAP-QDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPL-DRETLSLIRLDVIASDK-GTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM-----ASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSS---TVPLTINVIDINDHAPTLIAAQK---MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--------GSEDFIIDEDSGLIKT-TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAV 569          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 145.976 bits (367), Expect = 5.765e-35
Identity = 169/669 (25.26%), Postives = 286/669 (42.75%), Query Frame = 1
Query:  538 GNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDEN-----NNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTEN---FYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIE--TKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIW--FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLND 2487
            G ++  ER+D             A N  +   I  K+      S ++ + + +ID ND+ P        + + E+  IG  +    A+D D S  N + +Y + E +  F +  D     S  ++  K +D E    Y++ + A D   P   T+ +I V ++D NDN P F+   YNV++ E +P G  I+T+KA+D D  +    I Y I+    D  V S   +      L ++  L    R  +  +V    ++ GG      VNV++ D N     N+ P           + + E+ P+   +  L   D D G N+ I   +    DS++F  ++ S    S+  S   D E      + +   D  SP L+T+  + + + D N+ SP F  S Y A + E+ P  +  LQ++A D D   N  + +  +  + +      ++D  +G +  +   +DRE+ + I   ++  D     S +A   +   +SD NDN P F + ++   I EN  V S VG ++A D DEG  A + + +     ++  +++     + NG +   T+ E D E   N            L+    T  V I + D NDNKP    F+    N   NV    ++G I         D   N  ++Y+L  ND
Sbjct:   71 GEVTLRERID-------------AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDED-SGPNGIIKYSM-EGSEDFIIDED-----SGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK---ITYRIEEA--DREVFSILDIGDQGAILSVSGELK---RQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPF---------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI----DSSQFFRIDPSSGDISV--SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSK-LDREQFAVIVLPIFARDR-GTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEE--DAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSS---TVPVRIHVSDVNDNKPALKDFVIL-MNRFDNVQMARQIGFI------PAFDPDQNATLEYFLEEND 682          

HSP 2 Score: 130.183 bits (326), Expect = 4.304e-30
Identity = 150/610 (24.59%), Postives = 272/610 (44.59%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLL--ACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL 2475
            V++ ++D NDN P F+  +  + I E+  I   +    A D DF +  +VH Y +  S+    L  D     +  + L + ID +     A+        P   +   +T++V D ND+ P   +    ++++E + +G  +  V AID D   N   I YS++           F ++ D+G +   + L+ +   +Y+ +V A+D          T+ V +KD N+N P  D       ++T+ E  P +   I+T+   D   +  I   ++   D   FS+L+       +  S +   +  +V  ++I   D G   L     +N+ I D N  +P FN   +   + E++P   P++ + A D D+    R  +   +  F+ +ID  +G IS + + +DRE  +  S +V  +D  +    T+T  ++  + D NDN P F + +++  I E+I V +   QV A D D G   ++ Y L +  SS    +    L +T+G +    ++DRE      L I   D   P L+     + +T+ + D NDN P +       +I +NS           VG  +  ++A+D D G+N  + + +
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVH-YSMASSSGIGGLTID---YSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPN-GIIKYSMEG-------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEYNVTISEEMP-RGSQIITLKAVDNDEDQKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFF-RIDPSSGDISVSSD-LDREDRATFSVIVTASDHASPPLNTST-QIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE--SSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLS---AASEITLTLSDVNDNAPTFEQLSYDLYIAENS----------PVGSTVGTIVARDADEGDNADISFRI 572          

HSP 3 Score: 124.79 bits (312), Expect = 1.962e-28
Identity = 136/546 (24.91%), Postives = 250/546 (45.79%), Query Frame = 1
Query: 1000 ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN-GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYR---LTLEATDLGSPPM 2619
            + + V D NDN P F S  YNV++ E I +   I TVKA D D   N   ++YS+       +      ++  TG++ L E +++K        + A+D           + + V D N++ P    L    + ITL EN  + +E+  +   D D G N +I   ++ ++D     ++++   L  I ++K  D E      L++   D G+PSL+T+ T+ + + D N+ +P F++  Y+  + E  P  S I+ + A D D++  + +  +      +  +D  + G I +    + R+      KV       ++        V   I D N + P F +  FS +I E+  +   V  + A D D G  A + YS+    SS+   +D      ++G I    ++DRE    F++++  +D      N  +T + + + D NDN P +    +S+    ++    VG   +Q+ A D D G NG V Y+  LN+  +  + + F ++ T+G + + ++L   ++    L + A D G+P +
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTN-GKVHYSMASS----SGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP---TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSGL--IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD----HKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSID---SSQFFRID-----PSSGDISVSSDLDREDRATFSVIVTASDHASPPLN-TSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF--LNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL 513          

HSP 4 Score: 122.865 bits (307), Expect = 7.247e-28
Identity = 148/557 (26.57%), Postives = 246/557 (44.17%), Query Frame = 1
Query:  640 LKNKITDIHSDSINVDLEII----DRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES-TNTFHLK--TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS--DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKID---TVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK--TATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIA 2259
            LK    D+ + S+N    I     D NDN P F K    + I E    G  +    AVD+D    ++   YR+ E+    F +    D+  + S   +L +  D++++ + + T        C    + V + D N + P F    ++V + E  P+GY ++T+KA D DR  N + I YSID           FR++  +GD+ ++  L+ + R  ++  V A D  +        + V + D N+N P       ++   T+ E+ P+   + L VS  D+D+G N ++   L  +  S    L    R   ++  S + D E+  V +L I   D G+PSLS    + +++ D N+ +P F Q  Y  Y+ EN+P  S +  I A D D+  NA + F      +     I+     NG +     I+ R +    +K       L   S   ++TV V+  +SD NDNKP   +        +N+ +   +G + A DPD+   A L+Y L        +E D +   K  G I  K E  R +D +F   ++
Sbjct:  190 LKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND---EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR-QDHKVRVEISATDQGGLQGRCV---VNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDN-ARIVYSIDSSQF-------FRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ---FTSSSYAATISEDIPVG-TSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVV----RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQN--ATLEYFL--------EENDLIEAEKYTGKILVKQEWKRNMDVSFKTCVS 712          

HSP 5 Score: 68.9366 bits (167), Expect = 2.316e-11
Identity = 60/230 (26.09%), Postives = 111/230 (48.26%), Query Frame = 1
Query: 1975 VKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYV 2643
            V+  + D NDN PVFA ++++  I ENI + +++  V ATD D G    + YS+     +    +  L +  + G +  +  ID + +   T +I   D  +P L+    T  +TI + D ND+ P     +    +I +     +G+ + ++ A D D+G NG ++Y +          ++ F ++  +G +    +L+D    ARY L + A D+G+P + T   + V
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM-----ASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDGAQPALSS---TVPLTINVIDINDHAPTLIAAQK---MITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--------GSEDFIIDEDSGLIKT-TKLLDRETTARYSLKVTARDMGTPSLNTSTTIAV 210          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 143.28 bits (360), Expect = 4.243e-34
Identity = 180/694 (25.94%), Postives = 306/694 (44.09%), Query Frame = 1
Query:  610 INCIVKIYIPLKNKITDIHSDSINVDLEII----DRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS-ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKT-LNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPD--EGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL--MDARY-RLTLEATDLGSPPMRTPIVLYVRV 2649
            I+C +   I  + +  D  S +++ DL+++    D     PQF K   ++ IPE   IG  L    A +    +  R+  Y L       HL  D +   S  + + K  D+E Q  Y  T++A + +  T+ S I++ ++D NDN P F    Y+++V+E       +L V A D+D S  F  + Y I      L+  S+F +N  TG++   + L    R +++  V A+D     + + A +++ V D++   P     +  +++        L  IAI +V     G  S +   +        FS+     D   I+ ++  D +     +L IQ      PS  + +T + I I D N+  P F+ S     +RE+     P   + A D+D  KN  +R+   +      ++ID   G +ST  +++D E        V  TD L    +++ +T+   + D NDN P F ++ ++ E+ EN    ++VG+V+A D D  E G  V + +    +    +++ N++         TK  IDRE+  +  + I   D+  +     T +  I + D NDN P       S   I V +   +   I  ++A D D G NG V Y   L            FV  + G VY++ QL   D R+ RL++  +D G P  R  +V +V V
Sbjct:  498 IDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIR-YSL--QNQDEHLTVDTM---SGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMD-SGTFGEVSYHI------LSESSSFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTP----QFSRSKYEIRTTEDILPGIAIGSV-----GAMSKVKYSIYSGDQDHNFSI---DEDTGKIYVTRYLDADVHDTVLLNIQAT---LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTG-SLLDYEATRNYKLRVKATD-LGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVY---------TKRSIDREVISHVDISIVAEDK-GVPPRSSTASARISVLDVNDNPPSCL----SITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQ--------SSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP--RKSVVCHVPV 1134          

HSP 2 Score: 113.235 bits (282), Expect = 8.059e-25
Identity = 166/665 (24.96%), Postives = 291/665 (43.76%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES--TNTFHLKTDKLKLK-SFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHIT-LLENQPLQEI-AILTVSDS--DLGVNSLIACELKPTK-DSAKFSLL----NKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTN-VTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGS 2610
             ++I++ +E+ D NDN P F+   +KL I E A++G    L    D D    + VH + +++    N F L + K+  +    L +N  +D E +  Y + + A D   P        ++ + D NDN P F    Y  SV   I +G  ++TV+A D D  +N S I Y I  K       S F +++          L +     ++  VVA D  +      A V + V     + P +DI++    +   L+EN  L  I A ++++    D  +  + +  L P + D A   LL       R+  S H  K F  EK+   +++        P L       ++I D N+ +P ++ S  H  +   T   S  L     D  +N  +R+   ++ +   + ID   G I    N ID    SEI   V   D     + +  + V   + D     P F +  +  EI E+  + + + +V+A +   G +  ++YSL       Q + ++L +   +G +  +   D E   ++   +  T+    A++  +T+ ++IR++D NDN PI F P   +  + V   PK  + ++ + A D+D+G  G+V Y++ L++      +  F +N  TG V+ Q  L   R+ L + A D G 
Sbjct:  103 GETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFD-VHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGEN-SRISYDI--KKTSAPSNSNFAISQSGVITTTASLLPAST---HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLK-FLLEKDGQIIIE-------HPQL-------LTIGDINDNAPQWHSSQIHISLNR-TQGGSRTLTAKDPDLGQNGWIRY---SVLDTELVSIDKETGRI-FVPNTIDCNIGSEIKFRVRAEDG-GSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL-------QNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATN----ANSETSTSLISIRLKDVNDNWPI-FYPNEYH--LTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI-LSE------SSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGG 718          

HSP 3 Score: 104.76 bits (260), Expect = 2.793e-22
Identity = 126/556 (22.66%), Postives = 247/556 (44.42%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEI-QTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIR--IQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQE-IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEG-GAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRI 2319
            + + + D NDN P F      L + E  K    L + +A D D  +   V  Y ++  +++F +     ++         F    + +  + + + A D    ++++   I + V D++   P+F    Y +   E I  G  I +V A+        S + YSI     D N    F ++ DTG + +  +L++ +   +  N Q      E+    +   V ++++D N+N P       +   I++ E+  L E   ++  SD D   N  +   +  +   +   +   +  L    +    DYE  +   L+++  D G P  S+  TL I +LD N+ +P F +S Y   V EN+P ++ + ++ A D+D  +N  + +   N +E  Y  ID   G + T  + IDRE IS +  +  V +      +++T + +  + D NDN P         +     +++ +G ++A DPD+G   +VL  + L++         +LF++K+NG +  + +++   + +  L + V+D+  +    V  +V +RI
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEV-SYHILSESSSFSINPVTGEV---------FAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM--------SKVKYSIYSGDQDHN----FSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGES----NQTQVVIFIEDHNDNPPQFS---SSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQL---STGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE--YFGIDEKLGNVYTKRS-IDREVISHVD-ISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQS---------SLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQ-GVPRKSVVCHVPVRI 1136          

HSP 4 Score: 94.7449 bits (234), Expect = 3.122e-19
Identity = 141/621 (22.71%), Postives = 260/621 (41.87%), Query Frame = 1
Query:  826 RVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMT-LLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGG-NIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLY------SIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR----YRLTLEATDLGSPPMRTPIVLYVRV 2649
            R  + RLI S+     +TD+  +  + L L   +D E  +++ +  LL  D          + + D NDN P++ S   ++S+  T   G   LT K  D D  +N    Y  +D +++ ++        ++TG + +   ++  I  +  F+V A+D  +   + DL  V   +  E+        L+     + + E+ P+    +  V+++    NS             ++SL N+   L       ++   K FD+EK++     +   +  S +  +T  ++I + D N+  P F  + YH  VRE      P+L ++A D D        +  L+E+    I+ V G +   + +           VV   D   + S+  +  +   + D++   P F+ + +     E+I+    +G V       G  + ++YS+   +S  Q    N  + +  G I     +D ++ D   L I  T  P    N   T V I I D NDN P +    +S   I++    K+ +    + A D D   NG+V+Y +  + P + +    F    +TG       L+D      Y+L ++ATDLG PP  + + L++ V
Sbjct:  370 RDTKLRLIGSSALCPQQTDQAHV--YLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRT-QGGSRTLTAK--DPDLGQNGWIRYSVLDTELVSID--------KETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALW----QVEIPEDTPIGTCLVKVVANNSQCGNS----------KRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSET--STSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLAR----GRFHLVVSAKDGGGQSSEN-SANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSI---YSGDQDH--NFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT-LPSGESN--QTQVVIFIEDHNDNPPQF---SSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTG------SLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHV 932          

HSP 5 Score: 85.1149 bits (209), Expect = 2.496e-16
Identity = 149/659 (22.61%), Postives = 280/659 (42.49%), Query Frame = 1
Query:  718 PQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRL------NRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTV--SDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFN----QSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYL---KIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVK-FQISDENDNKPVFAETFSFEIQENIIVNSLVG---QVLATDPDEGGAAVLQYSLLKT-WSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRD--ENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGS 2610
            P F +   K  +PESA+IG  +   +    + ++     +Y ++   E T+ F LK D+   +S  +     +DYE ++ + +  +  + +      I V V DENDN P F   V  + + E   LG +       D D  K F    +     I+  NV + F+L       +   DLV+N  L+ + R +Y   + AQD      I     ++ + D N+N P    ++  +R+   +         ++TV  +D+D+G NS I+ ++K T   +  +       + +  +S       + + +      D GSPSLS++  + I++L     SP  +         A++ EN+   S + +++   + ++  LR     L  +  L   + D  + ++     I+DRE  SE     ++   L KD +      +   I D NDN P +  +     Q +I +N   G    + A DPD G    ++YS+L T   S  KE   +F+  T         ID  +       +   D    A   ++T++ + + D  + ++KP  F  + +   + +     +G  +++++A +   GN+ +++Y L   D       ++  V++ +G V IQ          Y+ T+ AT+  S
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESAA----PKYFVVFPDEQTSKF-LKVDE---RSGEISTIAHLDYEKRSKFDIVAVKVE-ESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPK-FDVHRFV----ILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAP----VFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVV----ASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLR-----LIGSSALCPQQTDQAHVYLLLLCGILDRETASE----HHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSS-----QIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELVSIDKETGRIFVPNT---------IDCNIGSEIKFRVRAEDGGSPA---LSTDLQV-VADLLDTESKPPQF--EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQD-------EHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANS 620          

HSP 6 Score: 81.6481 bits (200), Expect = 2.867e-15
Identity = 157/672 (23.36%), Postives = 283/672 (42.11%), Query Frame = 1
Query:  670 DSINVDLEIIDRNDNKPQF-SKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL--KTDKLKLKSFYLQLNKFIDYEIQ---TDYAMTLLACDPDFCTNQSITVHVRD---ENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYS--IHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENT--PARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNK-DSKTATVTVKFQISD-ENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYY-LSLNDPENEVATKYFFVNSTTGYVYIQ-------NQLMDARYRLTLEATDLGSP 2613
            DS  V + + D+NDNKPQ  + T  +L I ES+++G  L    A D D     +     L +S+ +  L  +T  L L+    +L+    ++I+    D+ +      P     +++ +  R+   E     +F    Y  ++ E +P G  I  ++          + + YSI    ++ N+ S F ++ + G +  N  L+ +I  +Y+ +V+   S   G      V+V V + N+N P     +P ++   + EN  +    + TV   D  V++L         DS+  +  + + D ++  IH +   D+E      L I+  D    S  T   L I + D N+ +P F++  Y   V   T  P + P  +I A D D    L +     + + + ++   +G +         E+      +V VT T N   S + +V V   I + E  +KP F +  F FE+ EN  +   +G +   +  E       Y +      +  E   +F +   G +   G IDRE        + + +E  +    V     + + DENDN P++       ++ +  ++   G  I Q++A D D+G NG+V Y  LS ND           +N  TG + +        ++  +A +++ +EA D G P
Sbjct: 1709 DSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLR----RLSSLQSWKIKLRVVDHGV------PGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQP-------ELAGLTYSI----VEGNIDSAFSVDSE-GVIRTNLELDREILERYSLKVIGTGS---GQQIGTRVDVRVNNLNDNVPS----FPMSKPRRVPENLRVGSY-VATVGAKD--VDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQ-PFAKIEAHDLDARGALTYSLGQGSSSIF-RVAPESGALFMKVLPPAGERY-----LVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESRE-----FHYRI------QDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNE-MMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAH---GQKIGQIMASDQDSGENGRVSYRILSGND------LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHP 2317          

HSP 7 Score: 75.485 bits (184), Expect = 2.091e-13
Identity = 103/429 (24.01%), Postives = 180/429 (41.96%), Query Frame = 1
Query:  712 NKPQFSKTNLKLFIPESAKIGFYLP-LEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSIT----VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKI----RIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGV-NSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDRE--KISEISKVVYVTDTLNKDSKT 1962
            +KP F K   +  + E++KIG  +  L      +F        YR+ +   +     DK       L +   ID E +  +   +   D +  T+Q +     V V DENDNLP F S  Y +S+K+++  G  I  + A D D  +N    Y     +I+  N  +   LN DTG + LNE+ ++++       +   V A+D  +     +  V V +K  + +      + P    + +LE+  +  +     + + LG+ N  +   LK  +   K  +  K+ +L         D+E E +  + +   D      S    L I +   +E++P F +S Y   +  +TPA   + Q+ A DED       ++        +KI+   G I   + ++ R    I +I+ V Y + T  K SKT
Sbjct: 2127 DKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREF-------HYRIQDPEASKIFSIDKFG----RLFVAGPIDREQRATHEFQV-EIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSY-----RILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPV-YEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLK--EHQGKLGIDVKTGELT---LKTHLDWESEPIISMYLSVSDGN--GRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPT--KQSKT 2528          

HSP 8 Score: 64.6994 bits (156), Expect = 4.232e-10
Identity = 122/564 (21.63%), Postives = 221/564 (39.18%), Query Frame = 1
Query: 1033 LPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEI----AILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKS-RDLYSIHSSK-------------QFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFD------NLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKP-----VFAETFSFEIQENIIVNSLVGQV-LATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRT 2625
             P F   +   +V E+  +G  I  +      R ++ +  Y+ + P   D       +++  +G++     L+ + R +++  V  +  E+G  ID+    V V DEN+N P           +  LE     ++    A+ TV+D D            P  D  +F +L  +  +++ + S K             Q D E      L I+  D G P+       +I I+D N+ +P F++S Y A V  N    S ++ + A D D     R  +D          NF +   + +G I+TT +++     +    V+ V       S +++  V   +     + P        E+ S  + EN  + S+V +V +A    +    ++  S L    + Q  V  L L          G +DRE      L   +  +  +    +     + I D NDN P W    +S+ I    +  + G     L AKD D G NG ++Y +        + T+   ++  TG +++ N +   + +  +  + A D GSP + T
Sbjct:   19 FPTFCQCLTKFTVPESAQIGTRIGWISG---KREESAAPKYFVVFP---DEQTSKFLKVDERSGEISTIAHLDYEKRSKFDI-VAVKVEESGETIDIL---VEVDDENDNAPSF------ADQVVKLEISEFAQLGTSFALPTVTDGD-----------GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAI---SQSGVITTTASLLP----ASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLC---------GILDRETASEHHLKFLLEKDGQI---IIEHPQLLTIGDINDNAPQW----HSSQIHISLNRTQGGSRT--LTAKDPDLGQNGWIRYSV--------LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALST 522          

HSP 9 Score: 62.7734 bits (151), Expect = 1.717e-9
Identity = 130/519 (25.05%), Postives = 205/519 (39.50%), Query Frame = 1
Query: 1036 PKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELK-PTKDSAK--FSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTL------NISILDENEY----SPA-------FNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNK-----------PVFAETFSFE--------IQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL 2475
            P+F++G   V+++E  P G  I TV A   D S   S I Y   P +ID      F +++ TGD+ L + L+  +   YN  V A  S  G  + L TVNV   D N++ P I +  PT     LL +   +   +  V   DL  +  I   LK    + AK  F +  KS +++ + SS                   FG   L  T T+      +++  DE +     S A       F++ H    +   +P  S ILQ+  F E     +  +    + +F LK                       SK+V       K +  AT T +F I  + D++           PVF E             I+EN+ +     ++LAT   E      Q +  K             +  T G+I     +DRE      L+I +TD     D   +  V + + D+NDNKP   +  ++ + + +    +VGD++ +  A D+D G NGK  + L
Sbjct: 1329 PRFDTGHLRVNIREDTPTGSIITTVNATVSDDSA--SPISYRF-PLLID-----NFSIDQFTGDITLIDTLHWHVTPTYNLIVEAFTSGPGTTL-LVTVNV--DDVNDHTPFI-VSQPT----VLLPSSYRKGGMVHRVVAIDLDKDPEIRYSLKYAGSEVAKEFFKIDEKSGEIFVVESSSAL-------------STSFGGAGLPETLTIRATDLQDLTKFDEQKVLLKASNASRSTWHFFDEQHKDVTILSTSPQGSQILQLK-FQEG----VDLQLIPSSPHFELKS----------------------SKIV------QKSASVATGTQRFTIVAQKDDELDYSTLKIHVEPVFTEPPKISSTSCGVVTIEENVGIEDF-KRILATGMTEESRFRFQGNAPK-----------FSINSTTGSISVL-PLDREASQEHLLIIILTDGGSRND---SCTVRVTVADQNDNKPQ--LDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL 1767          

HSP 10 Score: 58.151 bits (139), Expect = 4.646e-8
Identity = 121/523 (23.14%), Postives = 216/523 (41.30%), Query Frame = 1
Query:  649 KITDIHSDSI-NVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIE-STNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRD-ENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIH----SSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYS---PAFNQSHYHAYVRENTPARSPILQIAAFDE--DKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV 2166
            K TD   D+  N+ + + D NDN P FSK   +  +   A      P      HD  +   +  Y L + S++ F +  +   L  F   L    +      Y +T+ A D   P F T+  ++V + + E  + P FE   +   V E   +G   L +  +  + S+ F   +Y    +I D      F +++  G L +   ++ + R  + FQV   +            +V V DEN+N P+   + Y  +   ++   Q   +I  +  SD D G N  ++  +    D    +++  + D  SI     +  Q D        + ++  D G P+ +    + +S L  + +S   P F    Y  +V E+T   + + +I A +    +N  L +          L ID   G + T +  +D E    IS  + V+D    + ++A V +K  +   ++  PVF ++ ++ +I  +      VGQ+ A D D G   V++YS+    S RQ  V
Sbjct: 2003 KATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTV-SPATFSPGQPFAKIEAHDLDARGAL-TYSLGQGSSSIFRVAPESGAL--FMKVLPPAGER-----YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIG---LQIGNLSGEESREF---HY----RIQDPEASKIFSIDK-FGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQ---KIGQIMASDQDSGENGRVSYRILSGND---LNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVS-LKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKE--HQGKLGIDVKTGEL-TLKTHLDWESEPIISMYLSVSD---GNGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSI----SDRQSTV 2488          

HSP 11 Score: 52.373 bits (124), Expect = 2.617e-6
Identity = 120/513 (23.39%), Postives = 209/513 (40.74%), Query Frame = 1
Query:  655 TDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYL-PLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFY--LQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNS------KIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVN-SLIAC----ELKPTKDSAKFSLLNKSRDLYSIHSSK--QFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFS-FEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLK 2139
            TD  ++ + VDLEI     +KP+F   +L++ I E    G  +  + A V  D +S      YR       F L  D   +  F   + L   + + +   Y + + A      T   +TV+V D ND+ P F      V +  +   G  +  V AIDLD+      I YS+     ++  +  F+++  +G++ + E  ++         +     + A D ++    D     V +K  N +R         ++ +T+L   P Q   IL +   + GV+  LI      ELK +K   K + +      ++I + K  + DY   ++ +  +    F  P   ++ +  +  ++EN     F +                IL     +E      RF F      F   I++  G IS     +DRE   E   ++ +TD     S+  + TV+  ++D+NDNKP   A T S  EI E+  V  ++ +  A+D D G      + LL+
Sbjct: 1308 TDGSAEEMRVDLEISRTKSDKPRFDTGHLRVNIREDTPTGSIITTVNATVSDDSAS---PISYR-------FPLLIDNFSIDQFTGDITLIDTLHWHVTPTYNLIVEAFTSGPGTTLLVTVNVDDVNDHTP-FIVSQPTVLLPSSYRKGGMVHRVVAIDLDKDPE---IRYSLKYAGSEV-AKEFFKIDEKSGEIFVVESSSALSTSFGGAGLPETLTIRATDLQDLTKFD--EQKVLLKASNASRSTWHFFDEQHKDVTILSTSP-QGSQILQLKFQE-GVDLQLIPSSPHFELKSSKIVQKSASVATGTQRFTIVAQKDDELDYSTLKIHVEPV----FTEPPKISSTSCGVVTIEENVGIEDFKR----------------ILATGMTEES-----RFRFQGNAPKF--SINSTTGSISVLP--LDREASQEHLLIIILTD---GGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLE 1769          

HSP 12 Score: 52.373 bits (124), Expect = 2.895e-6
Identity = 81/352 (23.01%), Postives = 156/352 (44.32%), Query Frame = 1
Query: 1576 FDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQS-HYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA------ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATD 2601
             D E  Q  +L I   D GS + S T  + +++ D+N+  P  + S      + E++     + +  A D D     +F F+ L E+    +D V      T +++ R ++S +         ++       V    +IS+ N      A      +T+   I E +     + ++    P+  G   L YS++      +  +D+ F + + G I T  E+DRE+ + ++L +  T     +   + T V +R+ + NDN P + + K      N+    +VG  +  + AKDVD  N   ++Y+L ++D   +  T +F ++  TG +++   L   +   + LT++ATD
Sbjct: 1687 LDREASQEHLLIIILTDGGSRNDSCT--VRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFE-LLEDSSGSLDLV----PETGDLVLR-RLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL---QPELAG---LTYSIV------EGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTG----SGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENL----RVGSYVATVGAKDVD--NLAPLRYFL-VSDSSGQTPT-HFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD 2006          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 128.257 bits (321), Expect = 1.672e-29
Identity = 134/578 (23.18%), Postives = 245/578 (42.39%), Query Frame = 1
Query:  670 DSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSV-KETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRI---QYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLEN-QPLQEIAILTVS------DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYE--KEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNA---TLRFEFDNLTENFYLKIDTVNGWIST----TENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKP 2343
            D++ V + I D NDN P F +      + ES   G  +    A D D  S  R H          F ++TD     S  + + + +D+E    Y + L+A D       ++ +H+ D NDN P+FE   Y  +V +E + +   +  V A D D+ +  S I Y ++ +  D      FR+ + +G + L + L+         +NF V A D +  G +  A V V V+D N+N P    ++P      + EN +P+    +  +       D     N+ I   +   K     S+    ++   I + +  D E   E+  +++++ +D G PS      + I + D N+ +P F ++ Y   V E  P  + ++  +AFD D+ A      ++    ++ FY+  D  +   S      +  +D E +++     ++   ++     A   V   + D ND+ P         ++E++   + +G+  ATD D G  A  +        +RQ +    F +  +G +     +DRE    + L+I   D    ++N     V + ++D NDN P
Sbjct: 1317 DNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTD-----SGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD----EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP----IFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQ-RDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRI-------NRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN---SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 87.0409 bits (214), Expect = 7.023e-17
Identity = 153/575 (26.61%), Postives = 238/575 (41.39%), Query Frame = 1
Query:  982 FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFR--------LNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL---ATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAIL--TVSDSDLG----VNSLIACELKPTKDSAKFSLLNK---SRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVREN-TPAR-------SPILQIAAFDEDKNA---TLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTD----------TLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINV-TSYPKVGDIIIQLIAKDVDAG-NNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL 2562
            FC     +V V D NDN P+FE   Y  SV     +G +++TV A D D + N + I YS++   ID       +        +NR +G++ L + +  K + ++ F V+A D  NG    L   A V + V D+    P           IT+ EN  L ++ +    VS  D      +  L A      K  +KF   NK     +   +   +  DYE+     L +   D  S  +++TKT  + + D N+  P F    +   + E  TP          PI+ + A D D +     + +      N  E  + +ID + G I   E   DREKI      V  +D            NKD+    V V+  I+D NDN P F E  +   ++E+      V  + A D D+   + L+Y L+     R       F ++T+ G I  K  +D E  D + L++  +D  H A    TTNV I I D NDN P +   K +  +I      PKV   +  + A D D    + ++ Y L     E + A + F +   +G + +   L
Sbjct:  962 FC---QFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHN-AEITYSLE---IDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ-KFIFNVIADD--NGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS-RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKF-DREKIDMYILTVEASDRSVSALPGANGPNKDN----VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGRIP-----FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNA----TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKV---LFNVHATDADQDEKSSRIVYRL-----EGQGADEVFRIGKYSGTIELVKAL 1501          

HSP 3 Score: 85.8853 bits (211), Expect = 1.554e-16
Identity = 126/535 (23.55%), Postives = 221/535 (41.31%), Query Frame = 1
Query:  889 KLKSFYLQLNKF--------------IDYEIQTDYAMTLLACD--PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPL--------GYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQST--FRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD-------SENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACEL-KPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYV-RENTPARSPILQIAAFDED---KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK--TATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVG----QVLATDPDEGGA--AVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAV-TDEPHLADNYVTTNVTIRIRDENDNKPIW 2349
            K +S + Q NKF              +DYE   +Y +TL A D      + ++  V VRD ND +P+F   ++  ++ E +          G  I+TVKAID D     + ++Y I   + + N + T  FR++  TG++  NE  + +    Y   V A D         NG N D   V + + D N+N P     +   ++I  ++    +   ++T+   DL  +S +   L         F +     D  +I   +  D+E      L +   D      + T  + I I D N+ +P F Q  Y   V  E+      +  + A D D   K++ + +  +    +   +I   +G I   +  +DR+  + +    +V   ++ D         V+  + D NDN P+F E     I+EN       G     V A D D+     A ++Y +++   ++    +++F +  N G I     +DRE+      +I V  ++  +       NVTI++ D NDN P +
Sbjct: 1144 KAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRI---VGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS----FEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRT---DSGTIFVKEPLDFEASDQYHLVLIASD---GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVK-ALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVR---NKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF 1661          

HSP 4 Score: 82.0333 bits (201), Expect = 2.241e-15
Identity = 84/290 (28.97%), Postives = 130/290 (44.83%), Query Frame = 1
Query:  679 NVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKS--FYLQLNKFIDYE--IQTD-YAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS-TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPT-KDSAKFS 1527
            NV +++ D NDN P F KT  +  + E+A IG  +   +A D D  + + V  Y+L E ++ F++ TDK   +S    L++ + +DYE   Q D + + +   D       ++ V + D ND+ P    G     V+E +P G +I    A D D        I    DPK         F +++D G L +   L+ +    YN  + A D+ N  NI    V VY++D N+N P     Y   R     EN P               VN L  CE++ T +D+A+F 
Sbjct: 1646 NVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPK-------RQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPE---PYTVPRPCIFRENTP---------------VNQLGTCEIRATDRDTAEFG 1906          

HSP 5 Score: 78.9518 bits (193), Expect = 2.064e-14
Identity = 155/642 (24.14%), Postives = 252/642 (39.25%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYL------PLEA--AVDHDFSSV-NRVHEYRLIESTN---TFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCT----------NQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVY--VKDENNNRPLIDILYPTNRHITLLENQPLQEIAIL-----TVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPI---------LQIAAFDEDKNATLRFEFDNLTENF-----YLKIDTVNGWISTTENIIDREKISEISKVVYV-TDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAA-VLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRE---LDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQ 2466
            +E+ D ND  PQF+       I E      +L      P+    A+D D     N VH YR++   N   T H + D+L  + F    N+  D E    Y +T+ A D               N  + + + D NDN P FE   Y   VKE+   G+ ++T+KA DLD+  N    Y+ I         +  F +  D+G + + E L+ +   QY+  ++A D  +      AT NVY  ++D N+N P     +   ++ T +  + +    +L     T +D D   +S I   L+       F +   S  +  + +  +            +Q  D     L     + +++ D N+ SP F +  +  Y+ EN   R PI         +Q   FD+        E+  +           +ID   G I    + +DRE  SE   ++ V  +     S+     V  +++D NDN P F +T +   ++E   + + V    A D DE     V  Y L +         D      + G +  K  +D E     D F L I V+D  H A+      V + + D ND+ P            +V   P+ G  I +  A D DAG+  + +
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVH-YRIVGEANGEETKHFRIDELTGEIF---PNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLR--YHLIGAG----GGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHN-----ATTNVYIHIEDVNDNAP----QFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEK-SSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLF-GYIEEN---REPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRS-LDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAE----AAVHVALVDRNDHAPHIHGATEHRVREDV---PR-GTSIGRYTATDRDAGDTARFR 1807          

HSP 6 Score: 78.5666 bits (192), Expect = 3.019e-14
Identity = 160/703 (22.76%), Postives = 284/703 (40.40%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVN-RVHEYRLIESTN-----TFHLKTD---------KLKLKSFYLQLNKFIDYE---IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLN----VQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTV----SDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDY-EKEQVCMLQIQCHDFGS----PSLSTTK--TLNISILDENEYSPAFNQSHYH---AYVRENTPARSP--ILQIAAFDEDKNA------TLRFEFDNLTENFYLKIDTVNGWISTTENII-DREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSL-LKTWSSRQKEVDNLFLMKTNGAIETKGEIDR----ELDDNFTLLIAVTDEPHLADNYVTT-NVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSL-NDPENEVATKYFFVNS-TTGYVYIQNQLMDA-------RYRLTLEATDLGS 2610
            LEI+  ++  PQF+K   ++ + E   +            D+S V+ +   +R  E        T+ L+ D         ++   +  + L + +D++   +   + + + A + +  ++  +T+ + D NDN+P F   +Y   V+E IPL  TIL V A+D D   N S I YS+D     +N    + +  RL+ D     LNE         Y F V A+D  +G  + L ++  ++++ EN N     +  PT+++   +         ++ +    +D D    S +    + T+    FS+   +  +   H     D  E E    L +   D GS    PS + T   TL I I D N   P F     +   A + E T    P  I+++ A D+D +A      +L +      + F   ID   G ++ + +++ DRE        V  TD  ++           ++ D NDN P F   ++   +     V + V  V A D D    A + YSL + T +  + + D  F    N      GEI       +     +   + D+  + +   ++  VT+ + D+    P W    +    I V    ++  +I++  A       N  V Y L+    P N+  +K+   N    G  +++  +M+         Y LTL ATD+ S
Sbjct:  519 LEIL-ADERPPQFAKQEYEVTVSEDNLV------------DYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDN-SRITYSVDNHNFSINSNGEISAKVRLDADQ----LNER-----HFVYRFNVTARD--HGEPVSLSSSAMIHIRTENTNDESA-VFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFV--IDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDR-PLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVN---RRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS 1189          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 128.257 bits (321), Expect = 1.672e-29
Identity = 134/578 (23.18%), Postives = 245/578 (42.39%), Query Frame = 1
Query:  670 DSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSV-KETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRI---QYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLEN-QPLQEIAILTVS------DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYE--KEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNA---TLRFEFDNLTENFYLKIDTVNGWIST----TENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKP 2343
            D++ V + I D NDN P F +      + ES   G  +    A D D  S  R H          F ++TD     S  + + + +D+E    Y + L+A D       ++ +H+ D NDN P+FE   Y  +V +E + +   +  V A D D+ +  S I Y ++ +  D      FR+ + +G + L + L+         +NF V A D +  G +  A V V V+D N+N P    ++P      + EN +P+    +  +       D     N+ I   +   K     S+    ++   I + +  D E   E+  +++++ +D G PS      + I + D N+ +P F ++ Y   V E  P  + ++  +AFD D+ A      ++    ++ FY+  D  +   S      +  +D E +++     ++   ++     A   V   + D ND+ P         ++E++   + +G+  ATD D G  A  +        +RQ +    F +  +G +     +DRE    + L+I   D    ++N     V + ++D NDN P
Sbjct: 1317 DNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTD-----SGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD----EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP----IFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQ-RDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRI-------NRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN---SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 2 Score: 87.0409 bits (214), Expect = 7.023e-17
Identity = 153/575 (26.61%), Postives = 238/575 (41.39%), Query Frame = 1
Query:  982 FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFR--------LNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL---ATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAIL--TVSDSDLG----VNSLIACELKPTKDSAKFSLLNK---SRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVREN-TPAR-------SPILQIAAFDEDKNA---TLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTD----------TLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINV-TSYPKVGDIIIQLIAKDVDAG-NNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL 2562
            FC     +V V D NDN P+FE   Y  SV     +G +++TV A D D + N + I YS++   ID       +        +NR +G++ L + +  K + ++ F V+A D  NG    L   A V + V D+    P           IT+ EN  L ++ +    VS  D      +  L A      K  +KF   NK     +   +   +  DYE+     L +   D  S  +++TKT  + + D N+  P F    +   + E  TP          PI+ + A D D +     + +      N  E  + +ID + G I   E   DREKI      V  +D            NKD+    V V+  I+D NDN P F E  +   ++E+      V  + A D D+   + L+Y L+     R       F ++T+ G I  K  +D E  D + L++  +D  H A    TTNV I I D NDN P +   K +  +I      PKV   +  + A D D    + ++ Y L     E + A + F +   +G + +   L
Sbjct:  962 FC---QFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHN-AEITYSLE---IDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ-KFIFNVIADD--NGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS-RVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKF-DREKIDMYILTVEASDRSVSALPGANGPNKDN----VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGRIP-----FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNA----TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKV---LFNVHATDADQDEKSSRIVYRL-----EGQGADEVFRIGKYSGTIELVKAL 1501          

HSP 3 Score: 85.8853 bits (211), Expect = 1.554e-16
Identity = 126/535 (23.55%), Postives = 221/535 (41.31%), Query Frame = 1
Query:  889 KLKSFYLQLNKF--------------IDYEIQTDYAMTLLACD--PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPL--------GYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQST--FRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD-------SENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACEL-KPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYV-RENTPARSPILQIAAFDED---KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK--TATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVG----QVLATDPDEGGA--AVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAV-TDEPHLADNYVTTNVTIRIRDENDNKPIW 2349
            K +S + Q NKF              +DYE   +Y +TL A D      + ++  V VRD ND +P+F   ++  ++ E +          G  I+TVKAID D     + ++Y I   + + N + T  FR++  TG++  NE  + +    Y   V A D         NG N D   V + + D N+N P     +   ++I  ++    +   ++T+   DL  +S +   L         F +     D  +I   +  D+E      L +   D      + T  + I I D N+ +P F Q  Y   V  E+      +  + A D D   K++ + +  +    +   +I   +G I   +  +DR+  + +    +V   ++ D         V+  + D NDN P+F E     I+EN       G     V A D D+     A ++Y +++   ++    +++F +  N G I     +DRE+      +I V  ++  +       NVTI++ D NDN P +
Sbjct: 1144 KAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRI---VGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS----FEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRT---DSGTIFVKEPLDFEASDQYHLVLIASD---GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVK-ALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVR---NKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF 1661          

HSP 4 Score: 82.0333 bits (201), Expect = 2.241e-15
Identity = 84/290 (28.97%), Postives = 130/290 (44.83%), Query Frame = 1
Query:  679 NVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKS--FYLQLNKFIDYE--IQTD-YAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS-TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPT-KDSAKFS 1527
            NV +++ D NDN P F KT  +  + E+A IG  +   +A D D  + + V  Y+L E ++ F++ TDK   +S    L++ + +DYE   Q D + + +   D       ++ V + D ND+ P    G     V+E +P G +I    A D D        I    DPK         F +++D G L +   L+ +    YN  + A D+ N  NI    V VY++D N+N P     Y   R     EN P               VN L  CE++ T +D+A+F 
Sbjct: 1646 NVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH-GATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPK-------RQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSN--NIGRQMVAVYLQDVNDNGPE---PYTVPRPCIFRENTP---------------VNQLGTCEIRATDRDTAEFG 1906          

HSP 5 Score: 78.9518 bits (193), Expect = 2.064e-14
Identity = 155/642 (24.14%), Postives = 252/642 (39.25%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYL------PLEA--AVDHDFSSV-NRVHEYRLIESTN---TFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCT----------NQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVY--VKDENNNRPLIDILYPTNRHITLLENQPLQEIAIL-----TVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPI---------LQIAAFDEDKNATLRFEFDNLTENF-----YLKIDTVNGWISTTENIIDREKISEISKVVYV-TDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAA-VLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRE---LDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQ 2466
            +E+ D ND  PQF+       I E      +L      P+    A+D D     N VH YR++   N   T H + D+L  + F    N+  D E    Y +T+ A D               N  + + + D NDN P FE   Y   VKE+   G+ ++T+KA DLD+  N    Y+ I         +  F +  D+G + + E L+ +   QY+  ++A D  +      AT NVY  ++D N+N P     +   ++ T +  + +    +L     T +D D   +S I   L+       F +   S  +  + +  +            +Q  D     L     + +++ D N+ SP F +  +  Y+ EN   R PI         +Q   FD+        E+  +           +ID   G I    + +DRE  SE   ++ V  +     S+     V  +++D NDN P F +T +   ++E   + + V    A D DE     V  Y L +         D      + G +  K  +D E     D F L I V+D  H A+      V + + D ND+ P            +V   P+ G  I +  A D DAG+  + +
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVH-YRIVGEANGEETKHFRIDELTGEIF---PNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLR--YHLIGAG----GGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHN-----ATTNVYIHIEDVNDNAP----QFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEK-SSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLF-GYIEEN---REPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRS-LDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAE----AAVHVALVDRNDHAPHIHGATEHRVREDV---PR-GTSIGRYTATDRDAGDTARFR 1807          

HSP 6 Score: 78.5666 bits (192), Expect = 3.019e-14
Identity = 160/703 (22.76%), Postives = 284/703 (40.40%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVN-RVHEYRLIESTN-----TFHLKTD---------KLKLKSFYLQLNKFIDYE---IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLN----VQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTV----SDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDY-EKEQVCMLQIQCHDFGS----PSLSTTK--TLNISILDENEYSPAFNQSHYH---AYVRENTPARSP--ILQIAAFDEDKNA------TLRFEFDNLTENFYLKIDTVNGWISTTENII-DREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSL-LKTWSSRQKEVDNLFLMKTNGAIETKGEIDR----ELDDNFTLLIAVTDEPHLADNYVTT-NVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSL-NDPENEVATKYFFVNS-TTGYVYIQNQLMDA-------RYRLTLEATDLGS 2610
            LEI+  ++  PQF+K   ++ + E   +            D+S V+ +   +R  E        T+ L+ D         ++   +  + L + +D++   +   + + + A + +  ++  +T+ + D NDN+P F   +Y   V+E IPL  TIL V A+D D   N S I YS+D     +N    + +  RL+ D     LNE         Y F V A+D  +G  + L ++  ++++ EN N     +  PT+++   +         ++ +    +D D    S +    + T+    FS+   +  +   H     D  E E    L +   D GS    PS + T   TL I I D N   P F     +   A + E T    P  I+++ A D+D +A      +L +      + F   ID   G ++ + +++ DRE        V  TD  ++           ++ D NDN P F   ++   +     V + V  V A D D    A + YSL + T +  + + D  F    N      GEI       +     +   + D+  + +   ++  VT+ + D+    P W    +    I V    ++  +I++  A       N  V Y L+    P N+  +K+   N    G  +++  +M+         Y LTL ATD+ S
Sbjct:  519 LEIL-ADERPPQFAKQEYEVTVSEDNLV------------DYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDN-SRITYSVDNHNFSINSNGEISAKVRLDADQ----LNER-----HFVYRFNVTARD--HGEPVSLSSSAMIHIRTENTNDESA-VFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFV--IDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDR-PLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVN---RRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTS 1189          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 200.675 bits (509), Expect = 1.267e-51
Identity = 191/685 (27.88%), Postives = 307/685 (44.82%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTD------KLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ------SITVHVRDENDNLPKFESGVYNVSVKETIPLGY---TILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNG-WISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            S +  + + ++D ND+ P F     +  I E A +G  +    A D D    N   EY +   T+   L  D      ++  +S  +     +D E    Y + + A D     ++      S+ V V D+NDN P+F    Y V V E    G    T+  ++A D D+  N +  Y      II  N QS F ++  +GD+ L + L+ +    Y   + AQD  +    +   + V V D N+N P     Y +    ++LEN P+   I  +   DSD G N+ I   +    D+  F L    R  + + + K  D E++     Q+   D G P  S + ++ I++ D N+  PAFN  +Y A V E+ P  +P+  + A D D+++ L +E           I + NG  + T    +D ++       V  TD+     ++ T TV   I+D N+  P+F    +S  + E+  V + V  V ATD D G  A + YSL +   +     D   +    GAI T   +DRE    + L +   D   P L+D   TT+V I + D NDN P +  P    +I+       VG  +IQ+ A D D G NG+++Y LS  D E+      F ++ T+G +   N+ +D    A + LT  A D GSPP+ + + + +R+
Sbjct:  445 SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY-----AIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR---FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--FPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRDIED----GSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 163.696 bits (413), Expect = 3.257e-40
Identity = 159/588 (27.04%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPDFCTNQSIT---VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDP-----KIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGNIDLATVNVYVKDENNNRPLID-----ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPM 2619
            +D E+   +   ++A D  F      T   V+V D ND+ P FE+  +  S++E   +G T++T++A D D  KN + I Y I+       +        FR++  +G +     L+ +    Y+  V A D   +++      A+V V V D+N+N P        +  P ++     +N     +A +  +D+D G N+ I   +      ++FS+ + S D+  +   K  DYE  +   L I+  D GSPS S T  L ++++D N+ +P F  S +   V EN P    I+++ A+D D+  NA + +      +NF L +D   GW+ T +  +DRE+    +  V   D      K+A+ +V   + D NDN P F  + +   + E+    + V  V ATDPDE   + L Y  + T ++R +    +      G I     +D + +  F L +A TD    +D   T  V I I D N+  PI+   +N+    +V     VG  ++ + A D D G N ++ Y L+        +   F +N  TG + + N  +D    + Y LT+ A D G+P +
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKN-AEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYE-ITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD---TATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSL 987          

HSP 3 Score: 101.293 bits (251), Expect = 4.552e-21
Identity = 112/389 (28.79%), Postives = 173/389 (44.47%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVR--DENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIID-LNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTK-DSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRF 1809
            S S +V + + D NDN P F+    +  + E    G  +    A D D  S  R+H Y +                +   + + + +DY+ +  + +T+ A D     + + TVH+   D N+  P FE+  Y+ SV E  P+G T+L V A D D   N + I YS++ + I+ L     F +N  TG +V N  L+ +    Y   V A+D  N    D   V + V D N+N P     LY      ++LE+  +    I +  SD D+G+N  I   L     +   F +   S    +I ++K  D E   V  L     D GSP LS+T  + I + D N+  P F       YV EN+P  S + +I A D D+  NA + +
Sbjct:  775 SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLH-YEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG-RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN-AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY----QASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG---TIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 59.6918 bits (143), Expect = 1.787e-8
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYE-IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFE--SGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSEN 1305
            S ++ V + + D ND+ P F+   + L++PE++ +G  +    A D D   VN V  Y +I  + +N F L T     ++  L + + +DYE  +  + + + A  P    +  I + V D NDN P       ++N + ++  P G  I  + A D D S     ++Y    +I+  N  +  RLN  +G LVL+  LN+ +      +V   D  N
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFN-NFRDHFPSG-EIGRIPAFDADVSDK---LHY----RILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGIN 1300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 200.675 bits (509), Expect = 1.267e-51
Identity = 191/685 (27.88%), Postives = 307/685 (44.82%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTD------KLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ------SITVHVRDENDNLPKFESGVYNVSVKETIPLGY---TILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNG-WISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            S +  + + ++D ND+ P F     +  I E A +G  +    A D D    N   EY +   T+   L  D      ++  +S  +     +D E    Y + + A D     ++      S+ V V D+NDN P+F    Y V V E    G    T+  ++A D D+  N +  Y      II  N QS F ++  +GD+ L + L+ +    Y   + AQD  +    +   + V V D N+N P     Y +    ++LEN P+   I  +   DSD G N+ I   +    D+  F L    R  + + + K  D E++     Q+   D G P  S + ++ I++ D N+  PAFN  +Y A V E+ P  +P+  + A D D+++ L +E           I + NG  + T    +D ++       V  TD+     ++ T TV   I+D N+  P+F    +S  + E+  V + V  V ATD D G  A + YSL +   +     D   +    GAI T   +DRE    + L +   D   P L+D   TT+V I + D NDN P +  P    +I+       VG  +IQ+ A D D G NG+++Y LS  D E+      F ++ T+G +   N+ +D    A + LT  A D GSPP+ + + + +R+
Sbjct:  445 SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY-----AIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR---FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--FPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRDIED----GSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 163.696 bits (413), Expect = 3.257e-40
Identity = 159/588 (27.04%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPDFCTNQSIT---VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDP-----KIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGNIDLATVNVYVKDENNNRPLID-----ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPM 2619
            +D E+   +   ++A D  F      T   V+V D ND+ P FE+  +  S++E   +G T++T++A D D  KN + I Y I+       +        FR++  +G +     L+ +    Y+  V A D   +++      A+V V V D+N+N P        +  P ++     +N     +A +  +D+D G N+ I   +      ++FS+ + S D+  +   K  DYE  +   L I+  D GSPS S T  L ++++D N+ +P F  S +   V EN P    I+++ A+D D+  NA + +      +NF L +D   GW+ T +  +DRE+    +  V   D      K+A+ +V   + D NDN P F  + +   + E+    + V  V ATDPDE   + L Y  + T ++R +    +      G I     +D + +  F L +A TD    +D   T  V I I D N+  PI+   +N+    +V     VG  ++ + A D D G N ++ Y L+        +   F +N  TG + + N  +D    + Y LT+ A D G+P +
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKN-AEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYE-ITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD---TATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSL 987          

HSP 3 Score: 101.293 bits (251), Expect = 4.552e-21
Identity = 112/389 (28.79%), Postives = 173/389 (44.47%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVR--DENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIID-LNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTK-DSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRF 1809
            S S +V + + D NDN P F+    +  + E    G  +    A D D  S  R+H Y +                +   + + + +DY+ +  + +T+ A D     + + TVH+   D N+  P FE+  Y+ SV E  P+G T+L V A D D   N + I YS++ + I+ L     F +N  TG +V N  L+ +    Y   V A+D  N    D   V + V D N+N P     LY      ++LE+  +    I +  SD D+G+N  I   L     +   F +   S    +I ++K  D E   V  L     D GSP LS+T  + I + D N+  P F       YV EN+P  S + +I A D D+  NA + +
Sbjct:  775 SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLH-YEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG-RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN-AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY----QASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG---TIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 59.6918 bits (143), Expect = 1.787e-8
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYE-IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFE--SGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSEN 1305
            S ++ V + + D ND+ P F+   + L++PE++ +G  +    A D D   VN V  Y +I  + +N F L T     ++  L + + +DYE  +  + + + A  P    +  I + V D NDN P       ++N + ++  P G  I  + A D D S     ++Y    +I+  N  +  RLN  +G LVL+  LN+ +      +V   D  N
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFN-NFRDHFPSG-EIGRIPAFDADVSDK---LHY----RILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGIN 1300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 200.675 bits (509), Expect = 1.312e-51
Identity = 191/685 (27.88%), Postives = 307/685 (44.82%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTD------KLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ------SITVHVRDENDNLPKFESGVYNVSVKETIPLGY---TILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNG-WISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            S +  + + ++D ND+ P F     +  I E A +G  +    A D D    N   EY +   T+   L  D      ++  +S  +     +D E    Y + + A D     ++      S+ V V D+NDN P+F    Y V V E    G    T+  ++A D D+  N +  Y      II  N QS F ++  +GD+ L + L+ +    Y   + AQD  +    +   + V V D N+N P     Y +    ++LEN P+   I  +   DSD G N+ I   +    D+  F L    R  + + + K  D E++     Q+   D G P  S + ++ I++ D N+  PAFN  +Y A V E+ P  +P+  + A D D+++ L +E           I + NG  + T    +D ++       V  TD+     ++ T TV   I+D N+  P+F    +S  + E+  V + V  V ATD D G  A + YSL +   +     D   +    GAI T   +DRE    + L +   D   P L+D   TT+V I + D NDN P +  P    +I+       VG  +IQ+ A D D G NG+++Y LS  D E+      F ++ T+G +   N+ +D    A + LT  A D GSPP+ + + + +R+
Sbjct:  445 SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY-----AIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR---FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--FPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRDIED----GSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 163.696 bits (413), Expect = 3.459e-40
Identity = 159/588 (27.04%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPDFCTNQSIT---VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDP-----KIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGNIDLATVNVYVKDENNNRPLID-----ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPM 2619
            +D E+   +   ++A D  F      T   V+V D ND+ P FE+  +  S++E   +G T++T++A D D  KN + I Y I+       +        FR++  +G +     L+ +    Y+  V A D   +++      A+V V V D+N+N P        +  P ++     +N     +A +  +D+D G N+ I   +      ++FS+ + S D+  +   K  DYE  +   L I+  D GSPS S T  L ++++D N+ +P F  S +   V EN P    I+++ A+D D+  NA + +      +NF L +D   GW+ T +  +DRE+    +  V   D      K+A+ +V   + D NDN P F  + +   + E+    + V  V ATDPDE   + L Y  + T ++R +    +      G I     +D + +  F L +A TD    +D   T  V I I D N+  PI+   +N+    +V     VG  ++ + A D D G N ++ Y L+        +   F +N  TG + + N  +D    + Y LT+ A D G+P +
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKN-AEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYE-ITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD---TATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSL 987          

HSP 3 Score: 101.293 bits (251), Expect = 4.010e-21
Identity = 112/389 (28.79%), Postives = 173/389 (44.47%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVR--DENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIID-LNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTK-DSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRF 1809
            S S +V + + D NDN P F+    +  + E    G  +    A D D  S  R+H Y +                +   + + + +DY+ +  + +T+ A D     + + TVH+   D N+  P FE+  Y+ SV E  P+G T+L V A D D   N + I YS++ + I+ L     F +N  TG +V N  L+ +    Y   V A+D  N    D   V + V D N+N P     LY      ++LE+  +    I +  SD D+G+N  I   L     +   F +   S    +I ++K  D E   V  L     D GSP LS+T  + I + D N+  P F       YV EN+P  S + +I A D D+  NA + +
Sbjct:  775 SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLH-YEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG-RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN-AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY----QASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG---TIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 59.6918 bits (143), Expect = 1.787e-8
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYE-IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFE--SGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSEN 1305
            S ++ V + + D ND+ P F+   + L++PE++ +G  +    A D D   VN V  Y +I  + +N F L T     ++  L + + +DYE  +  + + + A  P    +  I + V D NDN P       ++N + ++  P G  I  + A D D S     ++Y    +I+  N  +  RLN  +G LVL+  LN+ +      +V   D  N
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFN-NFRDHFPSG-EIGRIPAFDADVSDK---LHY----RILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGIN 1300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 200.675 bits (509), Expect = 1.324e-51
Identity = 191/685 (27.88%), Postives = 307/685 (44.82%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTD------KLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ------SITVHVRDENDNLPKFESGVYNVSVKETIPLGY---TILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNG-WISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            S +  + + ++D ND+ P F     +  I E A +G  +    A D D    N   EY +   T+   L  D      ++  +S  +     +D E    Y + + A D     ++      S+ V V D+NDN P+F    Y V V E    G    T+  ++A D D+  N +  Y      II  N QS F ++  +GD+ L + L+ +    Y   + AQD  +    +   + V V D N+N P     Y +    ++LEN P+   I  +   DSD G N+ I   +    D+  F L    R  + + + K  D E++     Q+   D G P  S + ++ I++ D N+  PAFN  +Y A V E+ P  +P+  + A D D+++ L +E           I + NG  + T    +D ++       V  TD+     ++ T TV   I+D N+  P+F    +S  + E+  V + V  V ATD D G  A + YSL +   +     D   +    GAI T   +DRE    + L +   D   P L+D   TT+V I + D NDN P +  P    +I+       VG  +IQ+ A D D G NG+++Y LS  D E+      F ++ T+G +   N+ +D    A + LT  A D GSPP+ + + + +R+
Sbjct:  445 SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY-----AIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR---FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--FPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRDIED----GSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 163.696 bits (413), Expect = 3.286e-40
Identity = 159/588 (27.04%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPDFCTNQSIT---VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDP-----KIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGNIDLATVNVYVKDENNNRPLID-----ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPM 2619
            +D E+   +   ++A D  F      T   V+V D ND+ P FE+  +  S++E   +G T++T++A D D  KN + I Y I+       +        FR++  +G +     L+ +    Y+  V A D   +++      A+V V V D+N+N P        +  P ++     +N     +A +  +D+D G N+ I   +      ++FS+ + S D+  +   K  DYE  +   L I+  D GSPS S T  L ++++D N+ +P F  S +   V EN P    I+++ A+D D+  NA + +      +NF L +D   GW+ T +  +DRE+    +  V   D      K+A+ +V   + D NDN P F  + +   + E+    + V  V ATDPDE   + L Y  + T ++R +    +      G I     +D + +  F L +A TD    +D   T  V I I D N+  PI+   +N+    +V     VG  ++ + A D D G N ++ Y L+        +   F +N  TG + + N  +D    + Y LT+ A D G+P +
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKN-AEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYE-ITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD---TATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSL 987          

HSP 3 Score: 101.293 bits (251), Expect = 4.552e-21
Identity = 112/389 (28.79%), Postives = 174/389 (44.73%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVR--DENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIID-LNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTK-DSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRF 1809
            S S +V + + D NDN P F+    +  + E    G  +    A D D  S  R+H Y +                +   + + + +DY+ +  + +T+ A D    ++ + TVH+   D N+  P FE+  Y+ SV E  P+G T+L V A D D   N + I YS++ + I+ L     F +N  TG +V N  L+ +    Y   V A+D  N    D   V + V D N+N P     LY      ++LE+  +    I +  SD D+G+N  I   L     +   F +   S    +I ++K  D E   V  L     D GSP LS+T  + I + D N+  P F       YV EN+P  S + +I A D D+  NA + +
Sbjct:  775 SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLH-YEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGGRSD-TATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN-AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY----QASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG---TIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 59.6918 bits (143), Expect = 1.896e-8
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYE-IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFE--SGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSEN 1305
            S ++ V + + D ND+ P F+   + L++PE++ +G  +    A D D   VN V  Y +I  + +N F L T     ++  L + + +DYE  +  + + + A  P    +  I + V D NDN P       ++N + ++  P G  I  + A D D S     ++Y    +I+  N  +  RLN  +G LVL+  LN+ +      +V   D  N
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFN-NFRDHFPSG-EIGRIPAFDADVSDK---LHY----RILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGIN 1300          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 200.675 bits (509), Expect = 1.324e-51
Identity = 191/685 (27.88%), Postives = 307/685 (44.82%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTD------KLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ------SITVHVRDENDNLPKFESGVYNVSVKETIPLGY---TILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNG-WISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            S +  + + ++D ND+ P F     +  I E A +G  +    A D D    N   EY +   T+   L  D      ++  +S  +     +D E    Y + + A D     ++      S+ V V D+NDN P+F    Y V V E    G    T+  ++A D D+  N +  Y      II  N QS F ++  +GD+ L + L+ +    Y   + AQD  +    +   + V V D N+N P     Y +    ++LEN P+   I  +   DSD G N+ I   +    D+  F L    R  + + + K  D E++     Q+   D G P  S + ++ I++ D N+  PAFN  +Y A V E+ P  +P+  + A D D+++ L +E           I + NG  + T    +D ++       V  TD+     ++ T TV   I+D N+  P+F    +S  + E+  V + V  V ATD D G  A + YSL +   +     D   +    GAI T   +DRE    + L +   D   P L+D   TT+V I + D NDN P +  P    +I+       VG  +IQ+ A D D G NG+++Y LS  D E+      F ++ T+G +   N+ +D    A + LT  A D GSPP+ + + + +R+
Sbjct:  445 SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY-----AIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR---FYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN--FPLAVDPRTGW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS---GGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSD---TTDVEIGVTDVNDNAPAFKSPLYQASILEDA---LVGTSVIQVAASDPDVGLNGRIKYLLSDRDIED----GSFVIDPTSGTIRT-NKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRL 1103          

HSP 2 Score: 163.696 bits (413), Expect = 3.286e-40
Identity = 159/588 (27.04%), Postives = 270/588 (45.92%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPDFCTNQSIT---VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDP-----KIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGNIDLATVNVYVKDENNNRPLID-----ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPM 2619
            +D E+   +   ++A D  F      T   V+V D ND+ P FE+  +  S++E   +G T++T++A D D  KN + I Y I+       +        FR++  +G +     L+ +    Y+  V A D   +++      A+V V V D+N+N P        +  P ++     +N     +A +  +D+D G N+ I   +      ++FS+ + S D+  +   K  DYE  +   L I+  D GSPS S T  L ++++D N+ +P F  S +   V EN P    I+++ A+D D+  NA + +      +NF L +D   GW+ T +  +DRE+    +  V   D      K+A+ +V   + D NDN P F  + +   + E+    + V  V ATDPDE   + L Y  + T ++R +    +      G I     +D + +  F L +A TD    +D   T  V I I D N+  PI+   +N+    +V     VG  ++ + A D D G N ++ Y L+        +   F +N  TG + + N  +D    + Y LT+ A D G+P +
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKN-AEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLV---KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHYE-ITTGNTRGRFA--ITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSD---TATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAI-VTNAPLDRETTSGYLLTVTAKDGGNPSL 987          

HSP 3 Score: 101.293 bits (251), Expect = 4.552e-21
Identity = 112/389 (28.79%), Postives = 174/389 (44.73%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVR--DENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIID-LNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTK-DSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRF 1809
            S S +V + + D NDN P F+    +  + E    G  +    A D D  S  R+H Y +                +   + + + +DY+ +  + +T+ A D    ++ + TVH+   D N+  P FE+  Y+ SV E  P+G T+L V A D D   N + I YS++ + I+ L     F +N  TG +V N  L+ +    Y   V A+D  N    D   V + V D N+N P     LY      ++LE+  +    I +  SD D+G+N  I   L     +   F +   S    +I ++K  D E   V  L     D GSP LS+T  + I + D N+  P F       YV EN+P  S + +I A D D+  NA + +
Sbjct:  775 SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDS--RLH-YEITTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGGRSD-TATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVN-AQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY----QASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSG---TIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY 1150          

HSP 4 Score: 59.6918 bits (143), Expect = 1.896e-8
Identity = 59/218 (27.06%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYE-IQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFE--SGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSEN 1305
            S ++ V + + D ND+ P F+   + L++PE++ +G  +    A D D   VN V  Y +I  + +N F L T     ++  L + + +DYE  +  + + + A  P    +  I + V D NDN P       ++N + ++  P G  I  + A D D S     ++Y    +I+  N  +  RLN  +G LVL+  LN+ +      +V   D  N
Sbjct: 1094 SSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD-EGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTE-LDYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFN-NFRDHFPSG-EIGRIPAFDADVSDK---LHY----RILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGIN 1300          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 216.853 bits (551), Expect = 2.193e-57
Identity = 200/725 (27.59%), Postives = 348/725 (48.00%), Query Frame = 1
Query:  616 CIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLKTDKLKLKSF-YLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS---TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHA-YVRENTPARSPILQIAAFDEDK--NATLRFEF--DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAI-INVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLM---DARYRLTLEATDLGSPPMRTPIVLYVRVTGQIS 2664
            C ++  + + + I +     I   +E+ D NDN PQF    L L +PE+  +G    +  A D D +  N V +Y L    E+   F L+  + + +    L +   +D E++  Y +T+ A D   P   ++  + V + D NDN PKFE   Y   V E  P+G+++L VKA D D   N     T++ +IDP      V    R++R +G + +   L+ +      F VVA+D           V++ V D+N+N P ++I     R I L+          E+ P+   +A++ VSD D G N+++ C        +L+P  DS   S+ NK +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ SP F+ + +   +  EN P    ++++ A D D   NA L +    D+ T   + +ID  +G +    + +DRE        V   D     S   T TV  ++ D NDN P F    +SF + EN+   S VG V   D DEG  A +Q S+       + +V    +    G I +    DRE + ++T  +   D  +P  + +YV   VTI + DENDN P+   P NS+ I ++  + P   D +++++ A+D+D+G+N ++ Y ++  +P +      F+++ + G + +  +L       +RL ++ +D G P      ++++ V   I+
Sbjct:   95 CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP------VPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEI-----RGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS---SVDNKRK--YFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEK-VVEVVASDADSGTNAELVYSIIADSSTRGLF-EIDPNSGEVR-ARSPLDREHKDRYEFRVTAADK-GVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSV-------EPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVVTKPSNSSFIRLSPMAAP---DSVVEVVEAEDIDSGSNAELVYSIAGGNPHD-----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIA 780          

HSP 2 Score: 75.485 bits (184), Expect = 3.172e-13
Identity = 78/299 (26.09%), Postives = 129/299 (43.14%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISE---------ISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSL-----------LKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLN-DPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            YL++D   G I TTE  IDRE + +         +   V VTD +   S    +  + ++ D NDN P F +   +  + EN  + +L    LATD D     V  Y+L           L+    R +++  L ++         G +DREL D++ L I   D  +    Y +  + + I D NDN P +   + S+    V     +G  ++Q+ A D D G NG+++Y L    DP      K   ++ ++G +Y++  L        +  + A D G  P  +   + + VT Q
Sbjct:   63 YLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPR-LIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVL---------GSLDRELKDSYDLTIKAVDGGN-PPRYSSALLRVVIADANDNAPKF---EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP----VPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQ 343          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 218.009 bits (554), Expect = 2.230e-57
Identity = 198/708 (27.97%), Postives = 341/708 (48.16%), Query Frame = 1
Query:  616 CIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLKTDKLKLKSF-YLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS---TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHA-YVRENTPARSPILQIAAFDEDK--NATLRFEF--DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAI-INVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLM---DARYRLTLEATDLGSP 2613
            C ++  + + + I +     I   +E+ D NDN PQF    L L +PE+  +G    +  A D D +  N V +Y L    E+   F L+  + + +    L +   +D E++  Y +T+ A D   P   ++  + V + D NDN PKFE   Y   V E  P+G+++L VKA D D   N     T++ +IDP      V    R++R +G + +   L+ +      F VVA+D           V++ V D+N+N P ++I     R I L+          E+ P+   +A++ VSD D G N+++ C        +L+P  DS   S+ NK +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ SP F+ + +   +  EN P    ++++ A D D   NA L +    D+ T   + +ID  +G +    + +DRE        V   D     S   T TV  ++ D NDN P F    +SF + EN+   S VG V   D DEG  A +Q S+       + +V    +    G I +    DRE + ++T  +   D  +P  + +YV   VTI + DENDN P+   P NS+ I ++  + P   D +++++ A+D+D+G+N ++ Y ++  +P +      F+++ + G + +  +L       +RL ++ +D G P
Sbjct:   95 CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP------VPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEI-----RGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDS---SVDNKRK--YFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEK-VVEVVASDADSGTNAELVYSIIADSSTRGLF-EIDPNSGEVR-ARSPLDREHKDRYEFRVTAADK-GVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSV-------EPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVVTKPSNSSFIRLSPMAAP---DSVVEVVEAEDIDSGSNAELVYSIAGGNPHD-----LFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKP 763          

HSP 2 Score: 76.6406 bits (187), Expect = 1.482e-13
Identity = 71/264 (26.89%), Postives = 116/264 (43.94%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV---------VYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSL-----------LKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLN-DPENEVATKYFFVNSTTGYVYIQNQL 2562
            YL++D   G I TTE  IDRE + +             V VTD +   S    +  + ++ D NDN P F +   +  + EN  + +L    LATD D     V  Y+L           L+    R +++  L ++         G +DREL D++ L I   D  +    Y +  + + I D NDN P +   + S+    V     +G  ++Q+ A D D G NG+++Y L    DP      K   ++ ++G +Y++  L
Sbjct:   63 YLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPR-LIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVL---------GSLDRELKDSYDLTIKAVDGGN-PPRYSSALLRVVIADANDNAPKF---EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP----VPKLLRIDRSSGIIYVKGPL 308          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 214.927 bits (546), Expect = 9.810e-57
Identity = 199/707 (28.15%), Postives = 328/707 (46.39%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAIN---CIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYP---TNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL---SLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +CS      G  N   C  +I +  L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++S + F L   +      + QL   + +D E +  + M +   D   P   +   + V V D NDN P F+     V+V E  P+G ++  + A D D   N + I++S   +I   + +  F ++  TG + + + L+ ++   +   V+A D  +  +   ATV V V D N+N P ID  Y     N  + L EN PL  +IA++TV+D D  +N  + C    T     F L     D + + ++   DYE  +   ++I   D G P L+T+  + I I DEN+  P F Q      + EN    + +++I+A D D   NA + +       + +  ID+ +G +S  +  +DREK  + S  V   D        + VTVK  + D+NDN P F    ++F + EN+ +   VG +  TD D G  AV+  S++          DN  +    G I+     DRE   ++T ++   D   L        VTI + D NDN+P++ IP ++ +   V S    G ++ ++ A D D G N ++QY +   SL           F ++ TTG + +Q +++ A    +RL ++  DLG P
Sbjct:   90 RIDREKLCS------GVFNEKRCYYEIEVAVLPDEIFRL----VKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSN-AQIHFSFSNQI-SPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPS--RATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGF-NIDSRSGILSVVKR-LDREKQEKYSFTVIARDN-GTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGK-------DNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDA-GLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLR--------GLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQP 759          

HSP 2 Score: 88.5817 bits (218), Expect = 3.285e-17
Identity = 78/280 (27.86%), Postives = 133/280 (47.50%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREKISEI---SKVVY--VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVAT---KYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            +K++   G I TT N IDREK+       K  Y  +   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   +  Y L+K+ S    ++           +  +  +DRE  D F + I V D  +   +  T  + + + D NDN+P++   K+S   +NV     +G  +  L A D D G+N ++ +  S     N+++    ++F ++STTG + ++  L   ++  ++L + A+D  S P R  +++ V
Sbjct:   75 VKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSS-TAILQVTVSDVNDNRPVF---KDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFS-----NQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 214.542 bits (545), Expect = 1.774e-56
Identity = 199/707 (28.15%), Postives = 328/707 (46.39%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAIN---CIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYP---TNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL---SLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +CS      G  N   C  +I +  L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++S + F L   +      + QL   + +D E +  + M +   D   P   +   + V V D NDN P F+     V+V E  P+G ++  + A D D   N + I++S   +I   + +  F ++  TG + + + L+ ++   +   V+A D  +  +   ATV V V D N+N P ID  Y     N  + L EN PL  +IA++TV+D D  +N  + C    T     F L     D + + ++   DYE  +   ++I   D G P L+T+  + I I DEN+  P F Q      + EN    + +++I+A D D   NA + +       + +  ID+ +G +S  +  +DREK  + S  V   D        + VTVK  + D+NDN P F    ++F + EN+ +   VG +  TD D G  AV+  S++          DN  +    G I+     DRE   ++T ++   D   L        VTI + D NDN+P++ IP ++ +   V S    G ++ ++ A D D G N ++QY +   SL           F ++ TTG + +Q +++ A    +RL ++  DLG P
Sbjct:   90 RIDREKLCS------GVFNEKRCYYEIEVAVLPDEIFRL----VKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSN-AQIHFSFSNQI-SPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPS--RATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGF-NIDSRSGILSVVKR-LDREKQEKYSFTVIARDN-GTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGK-------DNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDA-GLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLR--------GLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQP 759          

HSP 2 Score: 88.5817 bits (218), Expect = 3.160e-17
Identity = 78/280 (27.86%), Postives = 133/280 (47.50%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREKISEI---SKVVY--VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVAT---KYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            +K++   G I TT N IDREK+       K  Y  +   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   +  Y L+K+ S    ++           +  +  +DRE  D F + I V D  +   +  T  + + + D NDN+P++   K+S   +NV     +G  +  L A D D G+N ++ +  S     N+++    ++F ++STTG + ++  L   ++  ++L + A+D  S P R  +++ V
Sbjct:   75 VKVEASTGEILTTANRIDREKLCSGVFNEKRCYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSS-TAILQVTVSDVNDNRPVF---KDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFS-----NQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: dchs1b (dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-GENE-050208-41])

HSP 1 Score: 214.157 bits (544), Expect = 9.319e-56
Identity = 188/645 (29.15%), Postives = 303/645 (46.98%), Query Frame = 1
Query:  673 SINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES--TNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLEN--QPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEF--DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDR-ELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL 2562
            ++ V + + D ND+ P F K    L IPE   +G    LE A D D   +  V  Y++ E      F L+T +   K  YL L  N  +D E ++ Y++ + A D   P      ++ + V+D ND+ P F    YN  + E++P G  IL V A D D   N   + Y I+ +  D +    F ++  +G + LN+ L+ ++R  +   V A+D+ +   I  A V ++V+D N+N+P + I++ +      +    QP Q +A ++VSD D G  S +   L+      KF+L  K   +Y I+  +  D E+     L++   D G+P L    +  I + D N+  P F+Q  Y   + E     S +LQ+ A D+D+  N  +R+    D  T + +  ID V G I TT   +D E I + S  V  TD   +   ++T  V+  + D NDN+PVF  +F +  I+EN    +   +V A D D G    + YS+     S    +    + K +G I T   +DR E  D+F   +  TD         + +V + + D NDN+P  F P N    ++  S P  G  +I++ A D DAG NG+V Y+           + +F +N  TG + +   L
Sbjct:  127 TVKVSITVNDINDHAPTFPKKKASLKIPEQTAVGTKFSLEPATDADKDQLT-VQGYQIKEGNVGQVFRLETKRAANKVLYLDLVVNGVLDREKRSSYSLVVEAFDGGSPRQNGQMTLDILVQDINDHAPVFNQSRYNAIISESLPQGSNILQVFASDADEGDN-GLVLYEINRRQSDPD--RYFVIDPRSGIITLNKALDYEMRKVHELVVQARDNASHPEITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGEYSNVNVSLE--GGDGKFALTTKDSIIYLIYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVVYPGSFVLQVTARDKDQGPNGDIRYSILPDKKTHSSWFTIDPVTGII-TTATKLDYETIPKPSIKVVATDG-GRPPLSSTAVVEIDLQDTNDNEPVFGSSFYNVSIKENTSEGTCFLEVKADDADGGSFGTITYSIGS--GSVSAPLSQFSINKESGQICTSTALDRDEGADSFHFTVTATDG---GGLSSSASVLVSLEDINDNRP-SFYPLNYAVSLSTQSSP--GTSVIRVTAHDPDAGANGRVTYHTVSGG-----GSSFFTLNKDTGVISLSRSL 750          

HSP 2 Score: 184.111 bits (466), Expect = 2.445e-46
Identity = 180/654 (27.52%), Postives = 306/654 (46.79%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD-----PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL---ATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF-LMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDL 2604
            +++I      P+ +  ++ L   E AK G  +    A D    ++N    Y ++  T+  H  T  +   +  + L + +DYE  + Y + +   D     P+    Q + ++V+D ND+ P+F      + + E    G ++ T +A D D S   S I YS+  +  D      F L+  TG L L   L+ +        V A DS    N  L    T  V+V DEN+N P+    + +   ++++E+QP+  + +  ++ D+D G N  ++  ++    + +F L + S  L  +   K  D E+++   L I   D G P  STT+ L+I ++D N+ +P F ++ + A +REN PA + I+Q+ A D D        +  +TE+ +  I+   G IS T  ++DRE     +  VY  D        A   V   + DENDN P F  + +S E+ EN+    L   + ATD D G +  L+Y +      +  + D  F L  ++GA+ T   +DRE   +++L + V D    + N  T +V I + D NDN P +    +S+  ++V+    +G +++   A DVD G NG++ Y+LS      + A   F V+  TG +     L+D    A Y   + A DL
Sbjct: 1313 IQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTD--HEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPNTHMIQ-LEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPD--NPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPI----FSSPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSIL---KPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTYGGVTEDGF-TINAETGVISATR-VLDRELQDHYTITVYAKDG-GIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELF-TLKATDRDIGESGRLEYKI------KAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNS-TASVEISVLDVNDNSPKF---SSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLS------QEAKGAFTVDPNTGRITTA-ALLDREKRASYFFQVYAVDL 1933          

HSP 3 Score: 162.925 bits (411), Expect = 7.565e-40
Identity = 177/645 (27.44%), Postives = 275/645 (42.64%), Query Frame = 1
Query:  673 SINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLEN-QPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAA--FDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVG-----QVLAT----DPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKY--FFVNSTTGYVYIQN 2556
            S+   + + D NDN P FS     + + E   +GF L    A D D     RV  YR I+S NT       L   S  L + K +D E Q  Y +T++A D   P   T Q +++ V D ND  P FE   +   ++E  P G +I+ V A D D   N    Y  +         +  F +N +TG +     L+ +++  Y   V A+D     N   A V++ V DEN+N P   +       + + EN QP+ E+  L  +D D+G +  +  ++K       F L   S    ++ +S+  D E++    LQ+   D GSPSL++T ++ IS+LD N+ SP F+ S Y   V E+      +L   A   DE +N  + +      +  +  +D   G I TT  ++DREK +     VY  D      + +T  V   I D NDN P F       IQ+ +I+N   G     QV+AT    D D G    + Y            V    +    GAI+T   +        TL++   D+     +  +  V I    E D K I F    +   +++      G ++ Q  A+  D   +G      S N        KY  F ++S TG +++Q+
Sbjct: 1527 SVTARVFVTDENDNAPIFSSPT-AVSVMEDQPVGFVLLYVMAWDADQGENGRV-SYR-IQSGNTAGRFV--LSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTYGGV--------TEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGL---QQYSLEVPENLQPV-ELFTLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSG---ALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAF-TVDPNTGRI-TTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFF-------IQDPLIINVSSGSVFTHQVVATMRAEDKDFGANGSVFYRF-------AMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQS--SLGVVIIYVKEQDYKGIRF--SRTARDVSLQENADKGTVVAQAQAQHPDGTRDGINYSIFSGN--------KYHSFSISSNTGEIWVQS 2123          

HSP 4 Score: 161.77 bits (408), Expect = 1.805e-39
Identity = 173/673 (25.71%), Postives = 283/673 (42.05%), Query Frame = 1
Query:  700 DRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCT---NQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDR-SKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS--DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNA---------TLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSF-EIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAI-INVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLM---DARYRLTLEATDLGSPPMRTPIVLYVRVTG 2655
            D NDN+P F   N  + +   +  G  +    A D D  +  RV  + +    ++F      L   +  + L++ +  +  +   M + A D    T   N  + + V   +   P FE   Y  +V E +  G  +  V+A   +  SK+ +    + DP          F ++ +TG L  +  L+ + R  ++ ++ A+        D   V V + D N+N P   I +P++    LL         +  V   D D G N  ++ +L  +     F +   S ++  I S     Y+      LQ+   D G+P LS T +L + I  EN   P F+   Y   ++ENTP  +  LQ+ A + D N          TL +      +     I   +GW+   ++ +DRE        V  T    +  +T + T++  ++DENDN P F++   F  ++EN+   +  G+V ATD D G  + L Y LL T        D  F + +  G I T+  +DRE   ++ L++ V D         T    I + DENDN P +   +    I I V      G ++  L AKD D G NG + Y LS +  E       F +N  TG +   + L     A Y  T+ A+D G+P   +  VL ++V G
Sbjct:  679 DINDNRPSFYPLNYAVSLSTQSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGSSFF----TLNKDTGVISLSRSLHGKANSVIPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRASSRNGVSKDVTYTISAGDPD-------GYFMVDPETGALRTSLPLDHESRPFFDLEIQARSGSPPAFGD-TRVRVTIADVNDNAP---IFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSGGQRTFGVERSSGEVRLIGS---LSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVGFGIAPDSGWL-FVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHT--------DRYFQINSQTGEISTRAALDREHQSSYQLMVVVQDG-GTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAER------FSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIG 1317          

HSP 5 Score: 140.198 bits (352), Expect = 8.060e-33
Identity = 170/651 (26.11%), Postives = 289/651 (44.39%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACE-LKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED---KNATLRFEF--DNLTENFYLK--IDTVNG-WISTTENII-----DREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL-SLNDPENEVATKYFFVNSTTGYVYIQNQLMD 2568
            + V+L + D NDN+P+F   N   ++ E+   G+  P+   V  D            IES+N   L   K+  ++  +     +D EI T   + + A D   P      +ITV + D NDN P        V V E   +G  I  V   D+D     S   YS+    +D + Q  F ++R  G + L   L+ + R  Y   + A DS++    +L  V   V D          LY     +TL E+ P     I +T +D D G N  ++   L  T+D   F +  K+  L+ I    +FD E+  V ++ I+  D GSP LS++ T+ + ++D N+ +P F+Q  Y A V E+    + IL + A D D   +N+   F     N+   F ++  +  + G    T   +I     D E +S  +  V V+D      ++++V     ++D NDN PVF    +   + E     + + +V ATDPD    A +QYS+      +   VD        GA++ +  +DRE  ++  +++  +D       +    +++ ++D NDN+P + I   +    ++     +   +  L A D D G  G+++YYL   + P  ++    FFV+  +G V  + Q+ D
Sbjct: 2150 MAVNLILQDVNDNRPRFQLQNYVTYMHEAQ--GYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLF--KIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPV-PREVRVPENSLIGTEITLVTGNDVDSGPVLS---YSLQ---LDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPT--FTQDLY----QVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDG--FYVDPKNGTLF-IRQKAKFDPEEPSVSIV-IEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDR-GVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKLFSVDQW-----TGAMKLQRPLDRESQNSHVVIVQASDG---HGRFALAPISVEVKDINDNRPYFPI---ATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDL----FFVDQNSGEVRTK-QIFD 2762          

HSP 6 Score: 135.961 bits (341), Expect = 1.613e-31
Identity = 167/637 (26.22%), Postives = 284/637 (44.58%), Query Frame = 1
Query:  694 IIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRL-IESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL---ATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-PLQEIAILTVSDSDL-----GVNSLIAC----ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTT--ENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQ 2553
            I+D NDN P       ++ +PE++ IG  + L    D D   V     Y L ++++       D+   +   + L   +DYE +T Y +T+ A D    +  ++TV V D NDN+P F   +Y V++ E  P G  ++TV A D D  +N    Y  +       + +  F ++   G L + +   +K   +     +  ++ +GG+  L   ATV V + D N+N P   I +      T+ E+Q P   I  L   D DL     G +  IA          + S +F   +  + + ++  +++ D+E      L +   D G P  S++    I++ D N+  P F ++ Y   + E   A + IL++ A D D       ++ +++    +K+ +V+ W      +  +DRE  S+ S VV V  + +   + A   +  ++ D NDN+P F   T +  I+EN  +NS V  + A D D G    L+Y L+   S  +   D  F+ + +G + TK   D E  ++F  +    D     +N  T  V + I  E++  P++     S+    V    K G  I  + AKD D G +G V Y    + P       YF VN TTG +Y++
Sbjct: 2261 IVDLNDNSPTI-PVPREVRVPENSLIGTEITLVTGNDVDSGPV---LSYSLQLDASTQGKFDIDRYNGR---VSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLS------STRDGFYVDPKNGTLFIRQ--KAKFDPEEPSVSIVIEARDGGSPPLSSSATVQVQLMDVNDNAP---IFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQY-SISSGDDMKLFSVDQWTGAMKLQRPLDRE--SQNSHVVIVQAS-DGHGRFALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGK---DLFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDA---GNNSATVTVQVFITGEDEYDPVF---TTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSP-------YFDVNKTTGVIYLK 2859          

HSP 7 Score: 119.783 bits (299), Expect = 1.146e-26
Identity = 163/670 (24.33%), Postives = 289/670 (43.13%), Query Frame = 1
Query:  664 HSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD----PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETI-PLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSL--STTKTLNISILDENEYSPAFNQSHYHAYVRENTP-ARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPV-FAETFS-FEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSY--PKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYV---YIQNQLMDARYRLTLEATDLGSPPM 2619
            HS +  + +++ID ND  P F +   +  I E+   G  +    A D D  +   V    + E   T + +T         +   + +D E+Q  Y +T+ A D    P+F   + + + V DENDN P F    Y++ V E + P+   + T+KA D D  ++    Y     KI   +    FRL+  +G L  +  L+ + +  Y+ QVV QD  +      A+V + V D N+N P       ++  + + E+  +  + +  T +D D G N  I   L      A     N  R    I ++   D EK      Q+   D  SP+   ++T  + ++ILD N+ +P F Q      V   +      +  + A D+D   N ++ + F      F   I+++ G I TTEN+   + +++  + + V          +++ V      E D K + F+ T     +QEN    ++V Q  A  PD G    + YS+         +  +  +    G I  +     + +D   L + V  E   + +++  N+   ++D NDN+P + +      +     Y  P     IIQ++A+DVD G NG+V Y +     E+   +  F ++  TG +    I ++ +  + +L ++ATD GSP +
Sbjct: 1628 HSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTYGGVTEDGFTINAETG-------VISATRVLDRELQDHYTITVYAKDGGIPPNFAKAK-VHITVLDENDNAPAFGLQQYSLEVPENLQPV--ELFTLKATDRDIGESGRLEY-----KIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFS---SSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGR----ITTAALLDREKRASYFFQVYAVDL-SPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRGF--AINSLTGAIQTTENL---QTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPD-GTRDGINYSIFSG-----NKYHSFSISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSSSFMAVNLI--LQDVNDNRPRFQLQNYVTYMHEAQGYDFP-----IIQVVAEDVDQGQNGQVTYTI-----ESSNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKL 2251          

HSP 8 Score: 110.153 bits (274), Expect = 1.116e-23
Identity = 109/377 (28.91%), Postives = 176/377 (46.68%), Query Frame = 1
Query: 1576 FDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTE--NFYLKIDTVNGWISTTENIIDRE--KISEISKVVYVTDTLNKDSKT-ATVTVKFQISDENDNKPV-----FAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGA----IETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
             D EK     L ++  D GSP  +   TL+I + D N+++P FNQS Y+A + E+ P  S ILQ+ A D D+  N  + +E +      + Y  ID  +G I T    +D E  K+ E+  VV   D  +    T A VT+   + D NDN+P       +E  S +I E       V ++  +DPD G  + +  SL        +  D  F + T  +    I     +DRE  D++ L +  TD   P L   +  ++ TI + D NDN P++        I  V  YP  G  ++Q+ A+D D G NG ++Y +    P+ +  + +F ++  TG +    +L      +  + + ATD G PP+ +  V+ +
Sbjct:  214 LDREKRSSYSLVVEAFDGGSPRQNGQMTLDILVQDINDHAPVFNQSRYNAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDRYFVIDPRSGII-TLNKALDYEMRKVHEL--VVQARDNASHPEITNAFVTI--HVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGEYSNVNVSL--------EGGDGKFALTTKDSIIYLIYVDQILDREERDSYELRVMATDSGTPPL---HAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVV-YP--GSFVLQVTARDKDQGPNGDIRYSIL---PDKKTHSSWFTIDPVTGIITTATKLDYETIPKPSIKVVATDGGRPPLSSTAVVEI 568          

HSP 9 Score: 106.301 bits (264), Expect = 1.714e-22
Identity = 120/437 (27.46%), Postives = 187/437 (42.79%), Query Frame = 1
Query:  622 VKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES--TNTFHLKTDKLKLKSFYLQ------LNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACEL----KPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK-----------NATLRFEFDNLTENFYLKID 1851
            V I I  ++  +   S S  V ++++D NDN P F +   K  + E    G  +    AVD D S  N   ++ +      N F +++    ++    Q      L + +D+E  + Y +T+   D   P   ++    + V D NDN P F    Y V++ E    G  IL V A D D S  ++ + YSI     D+ +   F +++ TG + L   L+ +   Q +  V+ Q S+  G   LA ++V VKD N+NRP   I   T    ++ ENQPL   + +L   D D GV   +   L     P KD     L    ++   + + + FD+EK           D G+   S T T+ + I  E+EY P F  S     V E       I  + A DED            N++  F+ +  T   YLK+D
Sbjct: 2442 VSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPD-SAPYAEVQYSISSG-DDMKL---FSVDQWTGAMKLQRPLDRE--SQNSHVVIVQASDGHGRFALAPISVEVKDINDNRPYFPIATLT---ASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKD-----LFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDAGNN--SATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSPYFDVNKTTGVIYLKMD 2861          

HSP 10 Score: 105.531 bits (262), Expect = 2.661e-22
Identity = 143/629 (22.73%), Postives = 273/629 (43.40%), Query Frame = 1
Query:  721 QFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYS--IHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLT---ENFYLKIDTVNGWISTTENI-IDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPD---EGGAAVLQYSLLKTWSSRQKEVDNLFL----MKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL 2562
            +FS+T   + + E+A  G  +  +A   H   + + ++ Y +  S N +H  +        ++Q +  +D+E      + + A      +  ++ + ++D NDN P+F+   Y   + E     + I+ V A D+D+ +N   + Y+I+      N    F+++  TG +     ++ +I  Q    + A D  +   +  AT+ V + D N+N P I    P  R + + EN  +  EI ++T +D D G     + +L  +    KF +     D Y+  +  +   DYE+     L I+  D       +   L + + D N+  P F Q  Y   + E++P  SP++ + A D D     +  +  L+   + FY  +D  NG +   +    D E+ S +S V+   D       +++ TV+ Q+ D NDN P+F +  +   + E+ +  + +  + A D D   E        +     ++ Q E    F+     +T G +     +D E   ++ L ++V+D   +     +    I + D NDN P++     +  I+ ++     G  I+++ A D D+    +VQY +S  D       K F V+  TG + +Q  L
Sbjct: 2062 RFSRTARDVSLQENADKGTVV-AQAQAQHPDGTRDGIN-YSIF-SGNKYHSFSISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSSSFMAVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDFPIIQVVAEDVDQGQN-GQVTYTIESS----NQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTI----PVPREVRVPENSLIGTEITLVTGNDVDSGPVLSYSLQLDAST-QGKFDI-----DRYNGRVSLTAPLDYEERTWYKLTIRASD---SKHQSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDGFY--VDPKNGTLFIRQKAKFDPEEPS-VSIVIEARDG-GSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDR-GVPQRSSSVPAIITVTDVNDNPPVF---GRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGD-----DMKLFSVDQWTGAMKLQRPL 2656          

HSP 11 Score: 87.4261 bits (215), Expect = 8.951e-17
Identity = 157/684 (22.95%), Postives = 280/684 (40.94%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRV-HEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD----PDFCTNQSITVHVRDENDNLPK----FESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSI---DPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLID----------ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDS-AKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKN--ATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF-LMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDII----IQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL-MDAR--YRLTLEATDLGSPP 2616
            + +D+ + D ND+ P F+++     I ES   G  +    A D D      V +E    +S    +   D    +S  + LNK +DYE++  + + + A D    P+  TN  +T+HVRD NDN P     F S   +  + E    G  +  +   D D  + +S +  S+   D K       S   L      + +++ L+ + R  Y  +V+A DS        ++  ++V D N+N PL D          ++YP +             +  +T  D D G N  I   + P K + + +  ++    +  I ++ + DYE      +++   D G P LS+T  + I + D N+  P F  S Y+  ++ENT   +  L++ A D D     T+ +   + + +  L   ++N   G I T+  +   E        V  TD       +++ +V   + D NDN+P F    ++  +       + V +V A DPD G    + Y  +    S      + F L K  G I     +  + +    ++I+  D   L    V   V I +   +   P++   + +     V+      D++    + ++      G +  V Y +S  DP+      YF V+  TG +     L  ++R  + L ++A   GSPP
Sbjct:  240 MTLDILVQDINDHAPVFNQSRYNAIISESLPQGSNILQVFASDADEGDNGLVLYEINRRQSDPDRYFVIDP---RSGIITLNKALDYEMRKVHELVVQARDNASHPE-ITNAFVTIHVRDYNDNQPTMTIIFLSEDGSPQISEGAQPGQYVARISVSDPDYGE-YSNVNVSLEGGDGKFALTTKDSIIYL------IYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVTDVNDNPPLFDQQAYKQTIPEVVYPGSF------------VLQVTARDKDQGPNGDIRYSILPDKKTHSSWFTIDPVTGI--ITTATKLDYETIPKPSIKVVATDGGRPPLSSTAVVEIDLQDTNDNEPVFGSSFYNVSIKENTSEGTCFLEVKADDADGGSFGTITYSIGSGSVSAPLSQFSINKESGQICTSTALDRDEGADSFHFTVTATD---GGGLSSSASVLVSLEDINDNRPSFYPLNYAVSLSTQSSPGTSVIRVTAHDPDAGANGRVTYHTVSGGGS------SFFTLNKDTGVISLSRSLHGKANSVIPMVISARDGGGLT-APVNARVNISVVGGSVAPPVF---EQAQYFFTVSE-----DVLRGTEVGVVRASSRNGVSKDVTYTISAGDPDG-----YFMVDPETGALRTSLPLDHESRPFFDLEIQARS-GSPP 874          

HSP 12 Score: 78.9518 bits (193), Expect = 3.500e-14
Identity = 92/386 (23.83%), Postives = 169/386 (43.78%), Query Frame = 1
Query: 1558 IHSSKQFDYE-KEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNA----TLRFEFDNLTENFYLKIDTVNGWIS----TTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLM-KTNGAIETKGEIDRELDDNFTLLIAVTD---EPHLADNYVTTNVTIRIRDENDNKP---IWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR----YRLTLEATDLGSPPMRTPIVLYVRVT 2652
            I ++++ D E ++    + +    F       T  ++I++ D N+++P F +      + E T   +      A D DK+       + +  N+ + F L+       +         ++DREK S  S VV   D      +   +T+   + D ND+ PVF ++ ++  I E++   S + QV A+D DEG   ++ Y + +    RQ + D  F++   +G I     +D E+     L++   D    P + + +VT    I +RD NDN+P   I F+ ++ +  I+  + P  G  + ++   D D G    V   L   D +  + TK   +     Y+   +Q++D      Y L + ATD G+PP+       + VT
Sbjct:  102 IKTARRLDREERDHYSFIAVTMTGF-------TVKVSITVNDINDHAPTFPKKKASLKIPEQTAVGTKFSLEPATDADKDQLTVQGYQIKEGNVGQVFRLETKRAANKVLYLDLVVNGVLDREKRSSYSLVVEAFDG-GSPRQNGQMTLDILVQDINDHAPVFNQSRYNAIISESLPQGSNILQVFASDADEGDNGLVLYEINR----RQSDPDRYFVIDPRSGIITLNKALDYEMRKVHELVVQARDNASHPEITNAFVT----IHVRDYNDNQPTMTIIFLSEDGSPQISEGAQP--GQYVARISVSDPDYGEYSNVNVSLEGGDGKFALTTKDSII-----YLIYVDQILDREERDSYELRVMATDSGTPPLHAESSFTIHVT 464          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 210.69 bits (535), Expect = 4.107e-55
Identity = 195/710 (27.46%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  601 CGAINCIVKIYIPLKNKITDIHSDS---INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ----------PLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN-SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARY---RLTLEATDLGSP 2613
            C  +    K ++  +  +TD+ S     ++  +EI+D NDN P F+   + L IPE+  IG   P+ AA D D S VN V  Y LI   E+ + F L+  +    K   L +   +D E +  Y +T+   D   P   ++  + + + D NDN PKFE   Y   + E  P+G+++L VKA D D+  N + I YS   +  D  V+    L+R TG + +   ++ +      F VVA+D           V + ++D N+N+P+I+I     R   L+ +Q          P++  +A++ VSD D GVN+ + C        +LK   D+      + S+  Y + ++   DYE  +   ++I   D G+P LS+T +L + + D N+ +P F+QS       EN      +++++A D D     +  +  L +     I ++N   G I     ++DRE+       V   D     S   T +V   + D NDN P F    ++F + EN+   S VG V   D D+G  A +  S+       + E     +    G I +    DRE    +T  +   D  +P  + +YV   VTI + DENDN P+  +P N S   +   ++P  G  +  + A+D+D G N ++ Y ++  +P      + F ++   G V ++  ++   Y   RL ++ TD G P
Sbjct:  132 CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVN-AEIDYSFH-QASD-TVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-----RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTG-----SDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVN-TVLDREQREHYDFHVVAVDK-GIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVIVVPSNISYKYLTPQTHP--GTPVNWVRAEDMDTGINAELDYSIASGNP-----FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          

HSP 2 Score: 64.6994 bits (156), Expect = 9.303e-10
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVT 2652
            YL++D   G I TTE  IDRE + E   +           V +TD ++   +   +  + +I D NDN P F +   +  I EN  +  L     ATD D G   V  Y L+        E  +LF ++     + K       G +DRE  D++ L I V D   P  A + +   + I I D NDN P +        +P+NS           +G  ++Q+ A D D G N ++ Y        ++   +   ++ +TG + +Q  +        + ++ A D G+ P   RT + + +R T
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPR--LLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG-----PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSAL---LRISILDTNDNAPKFEKMAYEAELPENS----------PMGHSVLQVKANDSDQGVNAEIDYSFHQ---ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDT 388          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 210.69 bits (535), Expect = 6.161e-55
Identity = 195/710 (27.46%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  601 CGAINCIVKIYIPLKNKITDIHSDS---INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ----------PLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN-SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARY---RLTLEATDLGSP 2613
            C  +    K ++  +  +TD+ S     ++  +EI+D NDN P F+   + L IPE+  IG   P+ AA D D S VN V  Y LI   E+ + F L+  +    K   L +   +D E +  Y +T+   D   P   ++  + + + D NDN PKFE   Y   + E  P+G+++L VKA D D+  N + I YS   +  D  V+    L+R TG + +   ++ +      F VVA+D           V + ++D N+N+P+I+I     R   L+ +Q          P++  +A++ VSD D GVN+ + C        +LK   D+      + S+  Y + ++   DYE  +   ++I   D G+P LS+T +L + + D N+ +P F+QS       EN      +++++A D D     +  +  L +     I ++N   G I     ++DRE+       V   D     S   T +V   + D NDN P F    ++F + EN+   S VG V   D D+G  A +  S+       + E     +    G I +    DRE    +T  +   D  +P  + +YV   VTI + DENDN P+  +P N S   +   ++P  G  +  + A+D+D G N ++ Y ++  +P      + F ++   G V ++  ++   Y   RL ++ TD G P
Sbjct:  124 CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVN-AEIDYSFH-QASD-TVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-----RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTG-----SDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVN-TVLDREQREHYDFHVVAVDK-GIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVIVVPSNISYKYLTPQTHP--GTPVNWVRAEDMDTGINAELDYSIASGNP-----FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 800          

HSP 2 Score: 65.4698 bits (158), Expect = 6.141e-10
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVT 2652
            YL++D   G I TTE  IDRE + E   +           V +TD ++   +   +  + +I D NDN P F +   +  I EN  +  L     ATD D G   V  Y L+        E  +LF ++     + K       G +DRE  D++ L I V D   P  A + +   + I I D NDN P +        +P+NS           +G  ++Q+ A D D G N ++ Y        ++   +   ++ +TG + +Q  +        + ++ A D G+ P   RT + + +R T
Sbjct:   99 YLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPR--LLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG-----PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSAL---LRISILDTNDNAPKFEKMAYEAELPENS----------PMGHSVLQVKANDSDQGVNAEIDYSFHQ---ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDT 380          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 209.92 bits (533), Expect = 7.737e-55
Identity = 195/710 (27.46%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  601 CGAINCIVKIYIPLKNKITDIHSDS---INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ----------PLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN-SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARY---RLTLEATDLGSP 2613
            C  +    K ++  +  +TD+ S     ++  +EI+D NDN P F+   + L IPE+  IG   P+ AA D D S VN V  Y LI   E+ + F L+  +    K   L +   +D E +  Y +T+   D   P   ++  + + + D NDN PKFE   Y   + E  P+G+++L VKA D D+  N + I YS   +  D  V+    L+R TG + +   ++ +      F VVA+D           V + ++D N+N+P+I+I     R   L+ +Q          P++  +A++ VSD D GVN+ + C        +LK   D+      + S+  Y + ++   DYE  +   ++I   D G+P LS+T +L + + D N+ +P F+QS       EN      +++++A D D     +  +  L +     I ++N   G I     ++DRE+       V   D     S   T +V   + D NDN P F    ++F + EN+   S VG V   D D+G  A +  S+       + E     +    G I +    DRE    +T  +   D  +P  + +YV   VTI + DENDN P+  +P N S   +   ++P  G  +  + A+D+D G N ++ Y ++  +P      + F ++   G V ++  ++   Y   RL ++ TD G P
Sbjct:  132 CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVN-AEIDYSFH-QASD-TVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-----RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTG-----SDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVN-TVLDREQREHYDFHVVAVDK-GIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVIVVPSNISYKYLTPQTHP--GTPVNWVRAEDMDTGINAELDYSIASGNP-----FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          

HSP 2 Score: 63.929 bits (154), Expect = 1.382e-9
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVT 2652
            YL++D   G I TTE  IDRE + E   +           V +TD ++   +   +  + +I D NDN P F +   +  I EN  +  L     ATD D G   V  Y L+        E  +LF ++     + K       G +DRE  D++ L I V D   P  A + +   + I I D NDN P +        +P+NS           +G  ++Q+ A D D G N ++ Y        ++   +   ++ +TG + +Q  +        + ++ A D G+ P   RT + + +R T
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPR--LLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG-----PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSAL---LRISILDTNDNAPKFEKMAYEAELPENS----------PMGHSVLQVKANDSDQGVNAEIDYSFHQ---ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDT 388          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 210.305 bits (534), Expect = 8.428e-55
Identity = 195/710 (27.46%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  601 CGAINCIVKIYIPLKNKITDIHSDS---INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ----------PLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN-SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARY---RLTLEATDLGSP 2613
            C  +    K ++  +  +TD+ S     ++  +EI+D NDN P F+   + L IPE+  IG   P+ AA D D S VN V  Y LI   E+ + F L+  +    K   L +   +D E +  Y +T+   D   P   ++  + + + D NDN PKFE   Y   + E  P+G+++L VKA D D+  N + I YS   +  D  V+    L+R TG + +   ++ +      F VVA+D           V + ++D N+N+P+I+I     R   L+ +Q          P++  +A++ VSD D GVN+ + C        +LK   D+      + S+  Y + ++   DYE  +   ++I   D G+P LS+T +L + + D N+ +P F+QS       EN      +++++A D D     +  +  L +     I ++N   G I     ++DRE+       V   D     S   T +V   + D NDN P F    ++F + EN+   S VG V   D D+G  A +  S+       + E     +    G I +    DRE    +T  +   D  +P  + +YV   VTI + DENDN P+  +P N S   +   ++P  G  +  + A+D+D G N ++ Y ++  +P      + F ++   G V ++  ++   Y   RL ++ TD G P
Sbjct:  132 CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVN-AEIDYSFH-QASD-TVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-----RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTG-----SDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVN-TVLDREQREHYDFHVVAVDK-GIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVIVVPSNISYKYLTPQTHP--GTPVNWVRAEDMDTGINAELDYSIASGNP-----FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          

HSP 2 Score: 65.0846 bits (157), Expect = 7.045e-10
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVT 2652
            YL++D   G I TTE  IDRE + E   +           V +TD ++   +   +  + +I D NDN P F +   +  I EN  +  L     ATD D G   V  Y L+        E  +LF ++     + K       G +DRE  D++ L I V D   P  A + +   + I I D NDN P +        +P+NS           +G  ++Q+ A D D G N ++ Y        ++   +   ++ +TG + +Q  +        + ++ A D G+ P   RT + + +R T
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPR--LLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG-----PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSAL---LRISILDTNDNAPKFEKMAYEAELPENS----------PMGHSVLQVKANDSDQGVNAEIDYSFHQ---ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDT 388          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 209.92 bits (533), Expect = 9.208e-55
Identity = 195/710 (27.46%), Postives = 327/710 (46.06%), Query Frame = 1
Query:  601 CGAINCIVKIYIPLKNKITDIHSDS---INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ----------PLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN-SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARY---RLTLEATDLGSP 2613
            C  +    K ++  +  +TD+ S     ++  +EI+D NDN P F+   + L IPE+  IG   P+ AA D D S VN V  Y LI   E+ + F L+  +    K   L +   +D E +  Y +T+   D   P   ++  + + + D NDN PKFE   Y   + E  P+G+++L VKA D D+  N + I YS   +  D  V+    L+R TG + +   ++ +      F VVA+D           V + ++D N+N+P+I+I     R   L+ +Q          P++  +A++ VSD D GVN+ + C        +LK   D+      + S+  Y + ++   DYE  +   ++I   D G+P LS+T +L + + D N+ +P F+QS       EN      +++++A D D     +  +  L +     I ++N   G I     ++DRE+       V   D     S   T +V   + D NDN P F    ++F + EN+   S VG V   D D+G  A +  S+       + E     +    G I +    DRE    +T  +   D  +P  + +YV   VTI + DENDN P+  +P N S   +   ++P  G  +  + A+D+D G N ++ Y ++  +P      + F ++   G V ++  ++   Y   RL ++ TD G P
Sbjct:  132 CQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVN-AEIDYSFH-QASD-TVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI-----RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTG-----SDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVN-TVLDREQREHYDFHVVAVDK-GIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSV-------EPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRS-SYV--GVTINVLDENDNAPVIVVPSNISYKYLTPQTHP--GTPVNWVRAEDMDTGINAELDYSIASGNP-----FELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKP 808          

HSP 2 Score: 64.6994 bits (156), Expect = 9.836e-10
Identity = 79/305 (25.90%), Postives = 129/305 (42.30%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVT 2652
            YL++D   G I TTE  IDRE + E   +           V +TD ++   +   +  + +I D NDN P F +   +  I EN  +  L     ATD D G   V  Y L+        E  +LF ++     + K       G +DRE  D++ L I V D   P  A + +   + I I D NDN P +        +P+NS           +G  ++Q+ A D D G N ++ Y        ++   +   ++ +TG + +Q  +        + ++ A D G+ P   RT + + +R T
Sbjct:  107 YLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPR--LLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVG-----PEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSAL---LRISILDTNDNAPKFEKMAYEAELPENS----------PMGHSVLQVKANDSDQGVNAEIDYSFHQ---ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDT 388          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 208.379 bits (529), Expect = 1.450e-54
Identity = 187/696 (26.87%), Postives = 314/696 (45.11%), Query Frame = 1
Query:  616 CIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRL---IESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIY-YSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-----------PLQEIAILTVSDSDLGVNSLIACELK---PTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFD-NLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPP 2616
            CI++  + + + + +     +   +E+ D NDN P F+   + L IPE+  IG   P+  A D D +  N V  Y L    E+   F L+  +  + K   L +   +D E    Y +T+   D   P   ++  + V V D NDN PKFE   Y   + E  P+G++++ VKA D D+  N    Y +   P++    V+   RL+R+TG + +   ++ +      F V+A+D         A V V VKD N+N P I+I     R I L+ +Q               +A++ VSD D G N+ + C +    P +        + S+  Y + ++   DYEK +   ++I   D G+P LS+T +L + ++D N+ +P F QS       EN      + ++ A D D   NA L +  +          I   NG I    + +DRE+       V   D     S   T TV   + D NDN P F    ++F + EN+   S VG V   D D+G  A +Q S+       +++  +  +    G I +    DRE    +T  +   D   +        VTI + DENDN P    P N++  + +T   ++G+ + Q+ A+D+D+G N ++ Y ++  +P        F + S +G + ++ ++       +RL ++ +D G PP
Sbjct:  110 CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRD-AGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEV----VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEI-----RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTS-LDREQRDSYELKVVAADR-GSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG-GVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYG-----LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 779          

HSP 2 Score: 112.464 bits (280), Expect = 1.268e-24
Identity = 127/496 (25.60%), Postives = 216/496 (43.55%), Query Frame = 1
Query: 1276 FQVVAQDSENGGNIDLATVNVYVKDENNN-----RPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSS----KQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTE--NFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKP---------VFAETFSFEIQENIIVNSLVGQVLATDPDEG-GAAV-------LQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYP---KVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL-MDAR--YRLTLEATDLGSPPMRTPIVLYVRV 2649
            F+V   D    G+  L    + V+D N+N      P+I +  P N +I  L   PL        +D D G N + + EL+   ++ +   L  + D              D E+     L I+  D G+P  +++  L +++LD N+ +P F +  Y A + EN+P    ++Q+ A D D+  NA + + F    E     L++D   G I T +  +DRE +S +   V   D      K+A   V   + D NDN P         V  +     I E++   + V  V  +D DEG  AAV       + + L +   +        FL  T         +D E   ++T+ I   D   P L+    T ++ +++ D NDN P++     + +I  V ++P   K G+++ ++ A D D+G+N ++ Y L   +PE   A   F ++   G + ++  L  + R  Y L + A D GSP ++    + V V
Sbjct:  114 FEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPL-------ATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLI-TVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-------PLDYEKVKDYTIEIVAVDSGNPPLSS---TNSLKVQVVDVNDNAPVF-----TQSITEV-AFPENNKPGEVVAEVTASDADSGSNAELVYSL---EPE-PAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNV 580          

HSP 3 Score: 74.7146 bits (182), Expect = 6.153e-13
Identity = 84/307 (27.36%), Postives = 130/307 (42.35%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVTGQISQTLKI 2679
            YL++D   G I TTE  IDRE + E               V +TD L ++     +  + ++ D NDN P FA    +  I EN  + SL    LATD D G   V  Y L         E   LF ++     E K       G +DRE  D++ L I V D   P  A + +   + + + D NDN P +  P        ++    +G  +IQ+ A D D G N ++ Y         EV  +   ++  TG + +Q  +     +  R ++ A D G+ P   R  +V+ V+     + T++I
Sbjct:   76 YLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITD-LVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL-----QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSAL---LRVTVLDTNDNAPKFERPTYE---AELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEI 367          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 208.379 bits (529), Expect = 1.450e-54
Identity = 187/696 (26.87%), Postives = 314/696 (45.11%), Query Frame = 1
Query:  616 CIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRL---IESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIY-YSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-----------PLQEIAILTVSDSDLGVNSLIACELK---PTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFD-NLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPP 2616
            CI++  + + + + +     +   +E+ D NDN P F+   + L IPE+  IG   P+  A D D +  N V  Y L    E+   F L+  +  + K   L +   +D E    Y +T+   D   P   ++  + V V D NDN PKFE   Y   + E  P+G++++ VKA D D+  N    Y +   P++    V+   RL+R+TG + +   ++ +      F V+A+D         A V V VKD N+N P I+I     R I L+ +Q               +A++ VSD D G N+ + C +    P +        + S+  Y + ++   DYEK +   ++I   D G+P LS+T +L + ++D N+ +P F QS       EN      + ++ A D D   NA L +  +          I   NG I    + +DRE+       V   D     S   T TV   + D NDN P F    ++F + EN+   S VG V   D D+G  A +Q S+       +++  +  +    G I +    DRE    +T  +   D   +        VTI + DENDN P    P N++  + +T   ++G+ + Q+ A+D+D+G N ++ Y ++  +P        F + S +G + ++ ++       +RL ++ +D G PP
Sbjct:  110 CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRD-AGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEV----VRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEI-----RGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTS-LDREQRDSYELKVVAADR-GSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSV-------EQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDG-GVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYG-----LFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP 779          

HSP 2 Score: 112.464 bits (280), Expect = 1.268e-24
Identity = 127/496 (25.60%), Postives = 216/496 (43.55%), Query Frame = 1
Query: 1276 FQVVAQDSENGGNIDLATVNVYVKDENNN-----RPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSS----KQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTE--NFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKP---------VFAETFSFEIQENIIVNSLVGQVLATDPDEG-GAAV-------LQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYP---KVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL-MDAR--YRLTLEATDLGSPPMRTPIVLYVRV 2649
            F+V   D    G+  L    + V+D N+N      P+I +  P N +I  L   PL        +D D G N + + EL+   ++ +   L  + D              D E+     L I+  D G+P  +++  L +++LD N+ +P F +  Y A + EN+P    ++Q+ A D D+  NA + + F    E     L++D   G I T +  +DRE +S +   V   D      K+A   V   + D NDN P         V  +     I E++   + V  V  +D DEG  AAV       + + L +   +        FL  T         +D E   ++T+ I   D   P L+    T ++ +++ D NDN P++     + +I  V ++P   K G+++ ++ A D D+G+N ++ Y L   +PE   A   F ++   G + ++  L  + R  Y L + A D GSP ++    + V V
Sbjct:  114 FEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPL-------ATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLI-TVQGPVDREDLSTLRFSVLAKDR-GATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTT-------PLDYEKVKDYTIEIVAVDSGNPPLSS---TNSLKVQVVDVNDNAPVF-----TQSITEV-AFPENNKPGEVVAEVTASDADSGSNAELVYSL---EPE-PAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNV 580          

HSP 3 Score: 74.7146 bits (182), Expect = 6.153e-13
Identity = 84/307 (27.36%), Postives = 130/307 (42.35%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKV-----------VYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPP--MRTPIVLYVRVTGQISQTLKI 2679
            YL++D   G I TTE  IDRE + E               V +TD L ++     +  + ++ D NDN P FA    +  I EN  + SL    LATD D G   V  Y L         E   LF ++     E K       G +DRE  D++ L I V D   P  A + +   + + + D NDN P +  P        ++    +G  +IQ+ A D D G N ++ Y         EV  +   ++  TG + +Q  +     +  R ++ A D G+ P   R  +V+ V+     + T++I
Sbjct:   76 YLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCILEFEVSITD-LVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYEL-----QAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSAL---LRVTVLDTNDNAPKFERPTYE---AELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ---APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEI 367          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 207.994 bits (528), Expect = 3.078e-54
Identity = 201/708 (28.39%), Postives = 328/708 (46.33%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAINCIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRF--EFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLM-KTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +C+   I   A  C  ++ +  L ++I  +    + +   I D NDN P F  T + + IPE++ I     L AA+D D   +N V  Y+LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F      VS+ E  P+G ++  + A D D  +N    +Y  +  ++    +  F LN  TG + + E L+ +    +   V+A D   G     ATV V V D N+N P IDI Y   PTN  + L EN PL  +IA++TV D D   N  + C    T     F L     + + + ++   D+E  +   +++   D G P L+ +  L I + DEN+ +P F QS     V EN    + + +I+A D D  +NA + +   FD   E     +D   G ++  + + DREK  +    V   D        +  TV   + D+NDN P+F    ++F + E++  +  VG +  TDPD G  + +  S+L        +V++ F +   +G I      DRE  +++T  +   D   ++ +  T  VTI + D NDNKPI+  P ++ +   V      G ++ +++A D D G N +V Y +   +         F +  T+G + ++ + M +    +R+ ++A DLG P
Sbjct:   90 RIDREKLCA--GIVLDA-RCFYEVEVAVLPDEIFRL----VKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSN--LVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDG--GSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCF---TDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPE---FNLDQRTGILTAVKKL-DREKQEKYYFTVLAQDN-GIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL--------DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSS-TARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN-----TKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 107.071 bits (266), Expect = 6.792e-23
Identity = 117/466 (25.11%), Postives = 207/466 (44.42%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNR-HITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENF---YLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKP-------VFAETFSFEIQENIIVNSLVGQVLATDPD-EGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +PT   +I++ EN  +     L  + D D+G+N +   +L  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F +      + EN P  S + Q+ A D D  +NA + F F NL  N       ++T  G I+  E  +DRE+      +V  TD     S  A  TV   ++D NDN P       V     +  + EN  +N+ +  +   D D E    V  ++  +     +    N FL++T   ++   E  RE      LL A   +P L     ++ + I+++DENDN P++     S   ++V      G  + ++ A D D+G N ++ Y L  + P        F ++  TG +    +L      +Y  T+ A D G PP+ +   ++V V  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEP-LDREESPSHKLLVLATD---GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDF--ESTREY--AIKLLAADAGKPPLNQ---SSMLLIKVKDENDNAPVF---TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPE------FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQ 563          

HSP 3 Score: 90.8929 bits (224), Expect = 5.801e-18
Identity = 81/277 (29.24%), Postives = 129/277 (46.57%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREKISEI----SKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK+       ++  Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN PI FI K     +++     +G  + QL A D D G N ++ +Y S  +  + +A + F +N+TTG + ++  L       ++L + ATD GS P R  +++ V
Sbjct:   75 IRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVADTNDNHPI-FIEKEIE--VSIPENAPIGSSVTQLHATDADIGENARIHFYFS--NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 206.453 bits (524), Expect = 5.057e-54
Identity = 201/708 (28.39%), Postives = 329/708 (46.47%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAINCIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRF--EFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLM-KTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +C+   I   A  C  ++ +  L ++I  +    + +   I D NDN P F  T + + IPE++ I     L AA+D D   +N V  Y+LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F      VS+ E  P+G ++  + A D D  +N    +Y  +  ++    +  F LN  TG + + E L+ +    +   V+A D   G     ATV V V D N+N P IDI Y   PTN  + L EN PL  +IA++TV D D   N  + C    T     F L     + + + ++   D+E  +   +++   D G P L+ +  L I + DEN+ +P F QS     V EN    + + +I+A D D  +NA + +   FD   E     +D   G ++  + + DREK  +    V   D        +  TV   + D+NDN P+F    ++F + E++  +  VG +  TDPD G  + +  S+L        +V++ F +   +G I      DRE  +++T  +   D   ++ +  T  VTI + D NDNKPI+  P ++ +   V      G ++ +++A D D G N +V Y +   + +       F +  T+G + ++ + M +    +R+ ++A DLG P
Sbjct:   90 RIDREKLCA--GIVLDA-RCFYEVEVAVLPDEIFRL----VKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSN--LVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDG--GSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCF---TDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPE---FNLDQRTGILTAVKKL-DREKQEKYYFTVLAQDN-GIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL--------DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSS-TARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKG-----LFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 107.457 bits (267), Expect = 5.196e-23
Identity = 117/466 (25.11%), Postives = 207/466 (44.42%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNR-HITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENF---YLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKP-------VFAETFSFEIQENIIVNSLVGQVLATDPD-EGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +PT   +I++ EN  +     L  + D D+G+N +   +L  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F +      + EN P  S + Q+ A D D  +NA + F F NL  N       ++T  G I+  E  +DRE+      +V  TD     S  A  TV   ++D NDN P       V     +  + EN  +N+ +  +   D D E    V  ++  +     +    N FL++T   ++   E  RE      LL A   +P L     ++ + I+++DENDN P++     S   ++V      G  + ++ A D D+G N ++ Y L  + P        F ++  TG +    +L      +Y  T+ A D G PP+ +   ++V V  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEP-LDREESPSHKLLVLATD---GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDF--ESTREY--AIKLLAADAGKPPLNQ---SSMLLIKVKDENDNAPVF---TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPE------FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQ 563          

HSP 3 Score: 90.5077 bits (223), Expect = 7.666e-18
Identity = 81/277 (29.24%), Postives = 129/277 (46.57%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREKISEI----SKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK+       ++  Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN PI FI K     +++     +G  + QL A D D G N ++ +Y S  +  + +A + F +N+TTG + ++  L       ++L + ATD GS P R  +++ V
Sbjct:   75 IRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVADTNDNHPI-FIEKEIE--VSIPENAPIGSSVTQLHATDADIGENARIHFYFS--NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNV 345          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 207.223 bits (526), Expect = 7.226e-54
Identity = 201/708 (28.39%), Postives = 328/708 (46.33%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAINCIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRF--EFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLM-KTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +C+   I   A  C  ++ +  L ++I  +    + +   I D NDN P F  T + + IPE++ I     L AA+D D   +N V  Y+LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F      VS+ E  P+G ++  + A D D  +N    +Y  +  ++    +  F LN  TG + + E L+ +    +   V+A D   G     ATV V V D N+N P IDI Y   PTN  + L EN PL  +IA++TV D D   N  + C    T     F L     + + + ++   D+E  +   +++   D G P L+ +  L I + DEN+ +P F QS     V EN    + + +I+A D D  +NA + +   FD   E     +D   G ++  + + DREK  +    V   D        +  TV   + D+NDN P+F    ++F + E++  +  VG +  TDPD G  + +  S+L        +V++ F +   +G I      DRE  +++T  +   D   ++ +  T  VTI + D NDNKPI+  P ++ +   V      G ++ +++A D D G N +V Y +   +         F +  T+G + ++ + M +    +R+ ++A DLG P
Sbjct:   90 RIDREKLCAG--IVLDA-RCFYEVEVAVLPDEIFRL----VKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIG-INGVQNYQLIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSN--LVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDG--GSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCF---TDHEVPFRLRPVFSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPE---FNLDQRTGILTAVKKL-DREKQEKYYFTVLAQDN-GIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSIL--------DVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSS-TARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGN-----TKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 105.916 bits (263), Expect = 1.658e-22
Identity = 117/466 (25.11%), Postives = 207/466 (44.42%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNR-HITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENF---YLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKP-------VFAETFSFEIQENIIVNSLVGQVLATDPD-EGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +PT   +I++ EN  +     L  + D D+G+N +   +L  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F +      + EN P  S + Q+ A D D  +NA + F F NL  N       ++T  G I+  E  +DRE+      +V  TD     S  A  TV   ++D NDN P       V     +  + EN  +N+ +  +   D D E    V  ++  +     +    N FL++T   ++   E  RE      LL A   +P L  + +   + I+++DENDN P++     S   ++V      G  + ++ A D D+G N ++ Y L  + P        F ++  TG +    +L      +Y  T+ A D G PP+ +   ++V V  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEP-LDREESPSHKLLVLATD---GGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPVFSNQFLLETAAFLDF--ESTREY--AIKLLAADAGKPPLNQSSM---LLIKVKDENDNAPVF---TQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPE------FNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQ 563          

HSP 3 Score: 91.2781 bits (225), Expect = 5.615e-18
Identity = 81/277 (29.24%), Postives = 129/277 (46.57%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREKISEI----SKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK+       ++  Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN PI FI K     +++     +G  + QL A D D G N ++ +Y S  +  + +A + F +N+TTG + ++  L       ++L + ATD GS P R  +++ V
Sbjct:   75 IRIEEGTGEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVADTNDNHPI-FIEKEIE--VSIPENAPIGSSVTQLHATDADIGENARIHFYFS--NLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNV 345          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.904e-56
Identity = 197/705 (27.94%), Postives = 327/705 (46.38%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAINCIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKT----DKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRF--EFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +C+   I   A +C  ++ +  L ++I  +    + +   I D NDN P F  T + + IPE++ I     L A +D D + +N V  Y LI+  + F L      +  K+    +Q  K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N    +Y  +  +I    +  F LN  TG + + E L+ +    +   V+A D   G     A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  ++C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F Q      V EN    + + +I+A D D  +NA + +   FD  +E     +D   G ++  + + DREK  + S  V   D           TV   + D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L          D+  +    G I+     DRE  +++T  +   D   ++ +  T  VTI + D NDNKP++ +P ++ +   V      G ++  ++A D D G N +++Y +   + +       F ++ T+G + ++ + + A    +RL ++A DLG P
Sbjct:   90 RIDREKLCA--GIVVDA-HCFYEVEVAVLPDEIFRL----VKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPD-TGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQ--KELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSN--LISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDG--GLTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCF---TDHEVPFRLRPVFSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSE---FNLDHRTGILTAVKKL-DREKQEKYSFTVLAKDN-GMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGENSAVILSILDAN-------DDFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSS-TAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKG-----LFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          

HSP 2 Score: 103.605 bits (257), Expect = 6.291e-21
Identity = 120/468 (25.64%), Postives = 203/468 (43.38%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSL----LNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLK---IDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +    A+    D D G+N +    L   K  + F L      +   +  +   K+ D E++   +++I+  D G P  S+T  L +S+ D N+  P F ++     + EN P  S + Q+ A D D  +NA + F F NL  N   K   +++  G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + EN  +N+ +  +  TD D      +          R + V  N FL++T   ++   E  RE      LL A   +P L  + +   + I+++DENDN P++  P  S   ++V      G  + ++ A D D+G N ++ Y L  + P        F ++  TG +    +L      +Y  T+ A D G PP+ T   + V V  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHL--IKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEP-LDREESPNHKLLVLASD---GGLTPARAMVLVNVTDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEVPFRLRPVFSNQFLLETAAYLDY--ESTREY--AIKLLAADAGKPPLNQSSM---LLIKVKDENDNAPVFTQPFLS---LSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDAPSE------FNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQ 563          

HSP 3 Score: 90.8929 bits (224), Expect = 4.625e-17
Identity = 81/277 (29.24%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK-----ISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK     + +      V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS        DPD G   V  Y L+K  S    +V      +    +  + E+DRE  D + + I V D         T  + + + D NDN+P++   K +   +++     VG  + QL A D D G N K+ +Y S  +  + +A K F +NSTTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEGTGEIFTTGARIDREKLCAGIVVDAHCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDG-GFPQRSSTAILQVSVADTNDNRPVF---KENEIEVSIPENAPVGSSVTQLHATDADIGENAKIHFYFS--NLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 6.753e-55
Identity = 196/671 (29.21%), Postives = 314/671 (46.80%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D     +  +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSL--DCRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 108.227 bits (269), Expect = 2.129e-22
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N K+ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSAMDADSGPNAKINYLLGPDAPPE------FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 85.1149 bits (209), Expect = 2.910e-15
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.712e-54
Identity = 196/671 (29.21%), Postives = 313/671 (46.65%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D        +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNMFGLDVIETPEGDKMP----QLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSL--DRRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 108.997 bits (271), Expect = 1.357e-22
Identity = 117/475 (24.63%), Postives = 212/475 (44.63%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D EK+   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N ++ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSATDADSGPNAEINYLLGPDAPPE------FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 85.5001 bits (210), Expect = 2.218e-15
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:   75 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 345          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.777e-54
Identity = 196/671 (29.21%), Postives = 312/671 (46.50%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      +++++A D D        +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    + F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P  + +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  155 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSL--DRRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 791          

HSP 2 Score: 105.531 bits (262), Expect = 1.619e-21
Identity = 110/467 (23.55%), Postives = 208/467 (44.54%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYP-TNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNG--WISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL    +P T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N    + T +  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      E    +D E    +   LL A   +P L  + +   + I+++DENDN P++     S   +++      G  ++++ A D D+G N ++ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  154 LVKIRFLIEDINDNAPL----FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ENAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVF---TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPE------FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 595          

HSP 3 Score: 85.5001 bits (210), Expect = 2.349e-15
Identity = 79/277 (28.52%), Postives = 126/277 (45.49%), Query Frame = 1
Query: 1840 LKIDTVNGWISTTENIIDREK----ISEISKVVY-VTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYV 2643
            ++I+   G I TT   IDREK    I       Y V   +  D     V ++F I D NDN P+F  T  +  I EN  +NS      A DPD G   V  Y L+K+ +    +V           +  + E+DRE  D + + + V D         T  + + + D NDN P++   K +   +++     VG  + QL A D D G N K+ +  S ++  + +A + F +N+TTG + I+  L       ++L + A+D G  P R  +++ V
Sbjct:  107 IRIEEDTGEIFTTGARIDREKLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVF---KETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHF--SFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNV 377          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 4.235e-54
Identity = 196/671 (29.21%), Postives = 313/671 (46.65%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHL------KTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ--LMD-ARYRLTLEATDLGSP 2613
            + +   I D NDN P F  T + + IPE++ I     L AAVD D   +N V  Y LI+S N F L      + DK+      L + K +D E +  Y M +   D  F    S   + V V D NDN P F+     VS+ E  P+G ++  + A D D  +N + I++S    + ++  +  F LN  TG + + E L+ +    +   V+A D   GG +   A V V V D N+N P IDI Y   P N  + L EN PL  +IA++TV+D D   N  + C    T     F L     + + + ++   DYE  +   +++   D G P L+ +  L I + DEN+ +P F QS     + EN      + +++A D D        +    +    F L  D   G ++  + + DREK  +     Y+   L KD+     T+ VTV   I D+NDN PVF    ++F + EN+  +  VG +  TDPD G  + +  S+L        E D+  +    G I      DRE  +++T  +   D   ++ +  +  VTI + D NDNKP++ +P ++ +   V      G ++ Q+IA D D G N +V+Y +   +  +      F ++  TG + +  +  + D   +R+ ++A DLG P
Sbjct:  123 VKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIETPEGDKMP----QLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGEN-AKIHFSFSNLVSNI-ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF---TDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSL--DRRTGMLTVVKKL-DREKEDK-----YLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILD-------ENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSS-SAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          

HSP 2 Score: 107.071 bits (266), Expect = 5.855e-22
Identity = 115/474 (24.26%), Postives = 210/474 (44.30%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS-DSDLGVNSLIACELKPTKDSAKFSLLN--KSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVN---GWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFT--LLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL      T  +I++ EN  +     L  + D D+G+N +   EL  +++     ++   +   +  +   K+ D E++   +++++  D G P  S+T  L +S+ D N+  P F ++     + EN P  + + Q+ A D D  +NA + F F NL  N   ++  +N   G I+  E  +DRE+      +V  +D        A   V   ++D NDN P     +       +  + ENI +N+ +  +  TD D      +          R + V  N FL+      ET   +D E    +   LL A   +P L  + +   + I+++DENDN P++        IP+N++  I +T          ++ A D D+G N ++ Y L  + P        F ++  TG + +  +L    + +Y  T+ A D G PP+ + + ++V +  Q
Sbjct:  122 LVKIRFLIEDINDNAPLFPA---TVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEP-LDREETPNHKLLVLASD---GGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM---LFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLT----------KVSATDADSGPNAEINYLLGPDAPPE------FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A087VXD3 (Protocadherin 9 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000056500 PE=4 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 3.692e-107
Identity = 288/916 (31.44%), Postives = 447/916 (48.80%), Query Frame = 1
Query:  388 TDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYS----IDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGN-IDLATVNVYVKDENNNRPLIDILYPTNRHIT------LLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFE-----------------------FDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA---------------ETFSFEIQENIIVNS-LVGQVLATDPDEGGAAVLQYSLLKTWS------------------------SRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD---EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQY-YLSLN-DPENEVATKY----------------------------FFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPP---MRTPIVLYVRV---------TGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNR 2769
            + ISIN ++ EET  +    S+R V+   S     F++      +D +  G +     LD E++C   + CCG +NC +   + + N  T      + + +++ D NDNKP F+ +  ++ IPE++++G  + L  A D D    N+V  Y+  E T TF L  D+  L +  L+LN  +D E++++Y+  L ACD   CT+  + + + D NDN P+     Y + + E++ +G TIL V A D D ++N + I+YS    +DP ++D     TF +  +TG++ L   L++KIR  Y F V A D   SE   N    A V V VKD N+N+P+I+I+ P    ++      + EN    +IA++ V D+D+G NS   CEL        F L +    LYS+ + + FD+E+E +    I+C DFGSPSLS+T+ + + I D NEY P F    + A V EN+P    ++ + A D D  + L +                        F+ L+ N Y  +D   G + T+   +DRE I  I+ VV VTD L +   TAT TV  ++ DENDN PVF                ++ +F ++EN    S L G++ A DPD      LQ+SL   W+                         RQ     +F +  +G IET  E DREL   + L +AV D   +P LA    +T++ +RI DENDN P W  P  S   IN+T+    G ++ +L A DVDA + GKV++  L LN  P   V+T                              F++N +TG + + ++L+    ++ L A D G        T +++ V++          G  +  L + ++  +IAVT IIS+ LIIAI+CVR+ P R
Sbjct:   18 SQISINFEIHEETEVNSTIGSIRDVVPTYSGTKTVFIYTGDFFNVDSQ-SGEVKVKTVLDRESLCQEHKQCCGTVNCTLTETVYVINAQTRNFMTPVQLRVKVNDINDNKPIFASSIQRVSIPENSEVGKSIGLRPATDADVDPRNKVTRYQWSEVTETFSL--DQTSLPAIRLRLNSPVDREVRSNYSGVLSACDIHSCTSTDVLIEIEDVNDNSPQLYKRRYGLEISESLAVGSTILHVNATDRDSAEN-ARIFYSFREPVDPDLVD-----TFEIVANTGEIRLRRPLDAKIRSSYEFSVTACDTVASECASNPTSNADVEVVVKDVNDNKPIIEIV-PAGESVSSSDDLVVPENYLPGQIAVVRVKDADIGENSRTTCELD---SHTTFELSHSGTGLYSLRTLRSFDFEQESILTTIIRCRDFGSPSLSSTQIITLRIFDVNEYPPEFQMRKFKASVSENSPPGVEVISLNAVDRDGQSELSYSLAPPPLQQGARENLYGVESLPNTFETLSFNAYFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDALTEPIFTATATVSIEVLDENDNSPVFVNPPPNIGLPFDQNDLQSHTFTVRENAPRYSHLSGRLEARDPDADQNGQLQFSLRSVWALKSVADSVGHSSGNIFDDLSGTSPGRQLVEQRIFQITPDGGIETLVEFDRELVAMYLLNVAVRDNGSQP-LA---TSTSLLVRILDENDNAPEWTFPTESARQINITTASPPGSLVARLQAFDVDADDAGKVEFQVLDLNGQPMPPVSTSRSLYNTPAQPSRLTSTVVQEELMGYRTGPFYLNGSTGEIIVADRLVPLNLKIRLRAIDCGQAQRLFTDTWMIINVKMDPNEFGGFLGGGRTGALNVTIILVMIAVTAIISLLLIIAIVCVRRKPGR 916          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A5K3FHZ7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 5.230e-107
Identity = 286/910 (31.43%), Postives = 445/910 (48.90%), Query Frame = 1
Query:  409 KVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIV--KIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDS---ENGGN-IDLATVNVYVKDENNNRPLIDILYPTNRH------ITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF--------------------------DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF---------------AETFSFEIQENII-VNSLVGQVLATDPDEGGAAVLQYSLLKTWS----------------------SRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD---EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENE--------------------------------VATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPP---MRTPIVLYVRV---------TGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNR 2769
            ++ EET  +    SLR  L         F++      ID  + G +     LD ET+C   +ICCG I+C +  K+Y+        I +  + VDL   D NDN+P F     ++ I E++++G Y+ L +A D D +  N+V+ Y+ IE T TF L  D+  L S  L+LN  +D E++ +Y+ TL ACD D CT   + + V D NDN P+F    Y +   E++ +G TIL + A D D   N   +Y   +P  +D ++  TF +  ++G+L L   L++KIR  YNF+VVA DS   E  GN    A + V VKD N+NRP+I+I+ P   +      + + EN P  +IA++ V D+D+G NS  ACEL      + F L   + DLY + + + FD+E+E V    I+C DFG+P LS+ +TL + +LD NEY+P F+Q  +   VREN+     I+ ++A D D  + LR++                           + +  N +  +D   G + T+   +DRE I  I+ VV VTD+      TAT TV  ++ DENDN PVF                ++++F ++EN      L G++ A DPD G    L +SL   W+                       RQ     +F +  +  IET  E DRE    + + +AV D   +P LA    +T++ + I DENDN P+W  P +S+  IN+T+    G ++ +L A D+DA   GKV++   + DP  +                                  T  F++N +TG + + ++L+    ++ L A D G        T +++ V++          G  +  L + ++  +IAVT IIS+ LIIAI+CVR+ P R
Sbjct:   32 EMQEETELNTTIGSLRENLSPYPGSKVAFMYSGDFFRIDC-HTGEVKVAVVLDRETVCQEHKICCGVIDCTLVDKVYLVYAESRDYIATILLKVDL--TDINDNRPVFGSHLQRVNILENSEVGRYIGLRSATDADVNPKNQVNRYQWIEPTGTFIL--DQNNLPSIRLRLNSPVDREMRANYSGTLSACDIDSCTTTDVFIEVEDVNDNSPQFYKRHYRLESPESLTVGSTILRLNATDADSGDNAKIVYSFREP--VDPDLADTFEIIANSGELRLRRPLDAKIRSSYNFKVVACDSVASECAGNDASSADIEVVVKDVNDNRPVIEII-PAGDYTSSTGDLVVQENFPAGQIAVVKVKDADIGENSRTACELDDHTSPSVFDLSQSAPDLYFLRTMRSFDFEQESVLTTTIRCRDFGTPPLSSVRTLTLRVLDVNEYAPEFHQRVFSTSVRENSQPGVDIITLSAIDRDGQSELRYKLAPPPLQHAEGEDIYSTAVSPSSTNSVETMGVNVHFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDSSTPPIFTATATVSIEVLDENDNSPVFLSPPANMGFPFHQNDIQSYAFTVRENAPRYTRLSGRLEARDPDAGRNGQLHFSLRSVWALKGASGSYRHPGSGFNDMRSTPGRQLVEQRVFQITPDNGIETLIEFDREQVGMYLVDVAVRDNGTQP-LA---TSTSLLVLILDENDNAPVWTFPADSSRQINITTADLPGTLVARLQAFDIDADEAGKVEF--QVLDPNGQPMPPVTLSRGLYNSPPTTPLPNSPSVQGELMGYRTGPFYLNGSTGEILVADRLVPVSLKIRLRAIDSGQAQRLYTDTWMIINVKMDPNEFGGFLGGGRAGALNVTIILVMIAVTAIISLLLIIAIVCVRRKPAR 927          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A068WWV1 (Protocadherin 9 OS=Echinococcus granulosus OX=6210 GN=EgrG_000056500 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 6.639e-107
Identity = 293/935 (31.34%), Postives = 458/935 (48.98%), Query Frame = 1
Query:  331 FILLTVLLAIISKLDLVYQTDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYS----IDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGN-IDLATVNVYVKDENNNRPLIDILYPTNRHIT------LLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFE-----------------------FDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA---------------ETFSFEIQENIIVNS-LVGQVLATDPDEGGAAVLQYSLLKTWS------------------------SRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD---EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQY-YLSLN-DPENEVA----------------------------TKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPP---MRTPIVLYVRV---------TGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNR 2769
            F +L +L A+ +       + IS+N ++ EET  +    S+R V+   S     F++      +D +  G +     LD E++C   + CCG +NC +   + + N  T      +++ +++ D NDNKP F+ +  ++ IPE++++G  + L  A D D    N+V  Y+  E+T TF L  D+  L +  L+LN  +D E++++Y+  L ACD   CT+  + + + D NDNLP+     Y + + E++ +G TIL + A D D ++N + I+YS    +DP ++D     TF +  +TG++ L   L++KIR  Y F V A D   SE   N    A V V VKD N+N+P+I+I+ P    ++      + EN    +IA++ V D+D+G NS   CEL        F L + +  LYS+ + + FD+E+E +    I+C DFGSPSLS+T+ + + ILD NEY P F    + A V EN+P    ++ + A D D  + L +                        F+ L  N Y  +D   G + T+   +DRE I  I+ VV VTD L +   TAT TV  ++ DENDN PVF                ++ +F I+EN    S L G++ A DPD      LQ+SL   W+                         RQ     +F +  +G IET  E DREL   + L +AV D   +P LA    +T++ +RI DENDN P W  P  S   IN+T+    G ++ +L A DVDA + GKV++  L LN  P   V+                            T  F++N +TG + + ++L+    ++ L A D G        T + + V++          G  +  L + ++  +IAVT IIS+ LIIAI+CVR+ P R
Sbjct:    5 FAVLLLLTAVHAS------SQISMNFEIHEETEVNSTIGSIRDVVPTYSGTKTVFIYTGDFFNVDSQ-SGEVKVKTVLDRESLCQEHKQCCGTVNCTLTETVYVINAQTRNLMTPMHLRVKVNDINDNKPIFASSIQRVSIPENSEVGKSIGLRPATDADVDPRNKVTRYQWSEATETFSL--DQTSLPAIRLRLNSPVDREVRSNYSGVLSACDIHSCTSTDVLIEIEDVNDNLPQLYKRRYGLEISESLAVGSTILHMNATDRDSAEN-ARIFYSFREPVDPDLVD-----TFEIVANTGEIRLRRPLDAKIRSSYEFSVTACDTVASECSSNPTSNADVEVVVKDVNDNKPIIEIV-PAGESVSSSDDLVVPENYLPGQIAVVRVKDADIGENSRTTCELD---SHTTFELSHSAPGLYSLQTLRSFDFEQESILTTIIRCRDFGSPSLSSTQIITLRILDVNEYPPEFQMHEFKASVSENSPPGVEVISLNAVDRDGQSELSYSLAPPPLQQGASEDFYGVGSLPNTFETLGVNAYFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDALTEPIFTATATVSIEVLDENDNSPVFVNPPANIGLPFDQNDLKSHTFTIRENAPRYSHLSGRLEARDPDADQNGQLQFSLRSVWALKSVAGSAGHSSGNIFDDLSGTSPGRQLVEQRIFQITPDGDIETLVEFDRELVAMYLLNVAVRDNGSQP-LA---TSTSLLVRILDENDNAPEWTFPTESARQINITTASPPGSLVARLQAFDVDADDAGKVEFQVLDLNGQPMPPVSISRGLYNAPAQSPRLTSTVVQEELMGYRTGPFYLNGSTGEILVADRLVPLNLKIRLRAIDCGHAQRLFTDTWMAINVKMDPNEFGGFLGGGRTGALNVTIILVMIAVTAIISLLLIIAIVCVRRKPGR 916          
BLAST of Protocadherin-9 vs. TrEMBL
Match: W6UEM3 (Protocadherin OS=Echinococcus granulosus OX=6210 GN=EGR_08610 PE=4 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.418e-106
Identity = 287/912 (31.47%), Postives = 446/912 (48.90%), Query Frame = 1
Query:  400 INVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYS----IDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD---SENGGN-IDLATVNVYVKDENNNRPLIDILYPTNRHIT------LLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFE-----------------------FDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA---------------ETFSFEIQENIIVNS-LVGQVLATDPDEGGAAVLQYSLLKTWS------------------------SRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD---EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQY-YLSLN-DPENEVA----------------------------TKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPP---MRTPIVLYVRV---------TGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNR 2769
            +N ++ EET  +    S+R V+   S     F++      +D +  G +     LD E++C   + CCG +NC +   + + N  T      +++ +++ D NDNKP F+ +  ++ IPE++++G  + L  A D D    N+V  Y+  E+T TF L  D+  L +  L+LN  +D E++++Y+  L ACD   CT+  + + + D NDNLP+     Y + + E++ +G TIL + A D D ++N + I+YS    +DP ++D     TF +  +TG++ L   L++KIR  Y F V A D   SE   N    A V V VKD N+N+P+I+I+ P    ++      + EN     IA++ V D+D+G NS   CEL        F L + +  LYS+ + + FD+E+E +    I+C DFGSPSLS+T+ + + ILD NEY P F    + A V EN+P    ++ + A D D  + L +                        F+ L  N Y  +D   G + T+   +DRE I  I+ VV VTD L +   TAT TV  ++ DENDN PVF                ++ +F I+EN    S L G++ A DPD      LQ+SL   W+                         RQ     +F +  +G IET  E DREL   + L +AV D   +P LA    +T++ +RI DENDN P W  P  S   IN+T+    G ++ +L A DVDA + GKV++  L LN  P   V+                            T  F++N +TG + + ++L+    ++ L A D G        T + + V++          G  +  L + ++  +IAVT IIS+ LIIAI+CVR+ P R
Sbjct:    1 MNFEIHEETEVNSTIGSIRDVVPTYSGTKTVFIYTGDFFNVDSQ-SGEVKVKTVLDRESLCQEHKQCCGTVNCTLTETVYVINAQTRNLMTPMHLRVKVNDINDNKPIFASSIQRVSIPENSEVGKSIGLRPATDADVDPRNKVTRYQWSEATETFSL--DQTSLPAIRLRLNSPVDREVRSNYSGVLSACDIHSCTSTDVLIEIEDVNDNLPQLYKRRYGLEISESLAVGSTILHMNATDRDSAEN-ARIFYSFREPVDPDLVD-----TFEIVANTGEIRLRRPLDAKIRSSYEFSVTACDTVASECASNPTSNADVEVVVKDVNDNKPIIEIV-PAGESVSSSDDLVVPENYLPGHIAVVRVKDADIGENSRTTCELD---SHTTFELSHSAPGLYSLRTLRSFDFEQESILTTIIRCRDFGSPSLSSTQIITLRILDVNEYPPEFQMHEFKASVSENSPPGVEVISLNAVDRDGQSELSYSLAPPPLQQGASEDFYGVGSLPNTFETLGVNAYFDLDPKTGVLRTSRVQLDREVIERITLVVTVTDALTEPIFTATATVSIEVLDENDNSPVFVNPPANIGLPFDQNDLKSHTFTIRENAPRYSHLSGRLEARDPDADQNGQLQFSLRSVWALKSVAGSAGHSSGNIFDDLSGTSPGRQLVEQRIFQITPDGDIETLVEFDRELVAMYLLNVAVRDNGSQP-LA---TSTSLLVRILDENDNAPEWTFPTESARQINITTASPPGSLVARLQAFDVDADDAGKVEFQVLDLNGQPMPPVSISRGLYNAPAQSPRLTSTVVQEELMGYRTGPFYLNGSTGEILVADRLVPLNLKIRLRAIDCGHAQRLFTDTWMAINVKMDPNEFGGFLGGGRTGALNVTIILVMIAVTAIISLLLIIAIVCVRRKPGR 895          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A068WDC6 (Protocadherin 11 OS=Echinococcus granulosus OX=6210 GN=EgrG_000583700 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.669e-101
Identity = 261/853 (30.60%), Postives = 415/853 (48.65%), Query Frame = 1
Query:  325 MGFILLTVLLAIISKLD-LVYQTDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCG-AINC----IVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLF-IPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGV-YNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNI---------------DLATVNVYVKDENNNRPLID-ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSP-SLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTE------NIIDREKISEISKVVYVTDTL-----------NKDS---KTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLV-GQVLATDPDEGGAAVLQYSLLKTW-SSRQKEVDNLF-LMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSN-------AIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQ------------------LMDARYRLTLEATDLGSPPMRTPIVLYVRVTGQIS 2664
            M F +  ++ A++  +D  + + ++ +N     E    +  +S  S  +E S++      ++  AL  ++ DG +   + +DLET+C  +++CC  +  C     V +  P   +I +I     N+ + I+D ND+ P+F + N ++  + E A IG  + ++ AVD D++  N++  Y L  S    + + D   L    L+L + +DYE Q+ +  TL ACD   CT   +T+++ D NDNLP F   + +N+++ E  P G  IL + A D D   N    +  +  +  D ++ STF L+  TG + L   L + +R+ Y+F+V  +++ +   +               D  +VN+ V+D N+  P I  ++ P +  + + EN     IA L V D DLG N L+ C L    +S  F L      +Y++HS + FD E E +  + I C D G+P   ST K + + I DENE+ P F +  Y A + EN P  + +LQ+ A D D++A L +      E  Y KID   G I+T E      + +DRE   E++  V V D              KDS    TA  TV  ++ DENDN P F +   F + EN   +S V G + A DPD+G    ++Y L   W SS      NLF L +T G +     +DRE    +TL +   D         + NVT+ + D NDN P W  P  S+         +N+T+    G ++ QL+A D DAG NG+V+Y  +L+DP ++VA   F VN+TTG V + N+                  L    +RL + A+D+G PP  +   L +RV G  S
Sbjct:    1 MMFAVCFIIAALLPAMDQAIKRNEVVMNASEGVEVGSTIGTLSSYSGGREASYL----GMVDGDALFSIERDGKVVVAKPIDLETLCREREVCCTYSKPCQLYYTVMVEDPRSEEIREI-----NLRIRIMDVNDHAPRFRQPNGQVVQVSEKAPIGTSIDIDPAVDGDWALENQIQRYALHGSDIQRYFEIDNSDLPRIQLKLREQLDYEKQSVFKGTLEACDRHNCTTAPLTINIIDVNDNLPFFHPPLEHNLTLPEDTPSGRVILRLNATDYDSPPNARMRFEFVGAE--DPSISSTFHLDPLTGAISLARRLQADVRLNYHFKVRVKETSDSAPVGVYGRPFHFNDIQRRDTVSVNIRVEDINDFAPDIRMVIPPESSEVWVPENSSPGRIATLKVEDRDLGDNGLVTCGLDGAGES--FELRQLVPSIYALHSRRSFDAEAEPIVFVNITCSDRGTPRPKSTQKHIVVRIDDENEFEPVFTKKEYSAKITENAPNNTFVLQVIARDGDQSAQLEYSLKGDGER-YFKIDPGTGKITTMERDMYHMSRLDREMTPEVTFFVLVKDAKPDRLVGGKGDSQKDSGVVHTAQTTVTVELIDENDNAPSFTDIGPFHLSENHPKHSKVNGHLHAEDPDQGLNGKVKYGLQDVWDSSNHVRKHNLFQLDETTGVLRALEPLDREQTAEYTLRVVACDMAPRDTRCTSVNVTVSVGDVNDNAPEWLFPVVSDEASAEFAECVNITTDAVAGQVVAQLVAHDRDAGQNGRVRY--ALHDPHSQVA---FSVNATTGRVTVANRYYTGLAESSGSQQQQQQTLQPGVHRLRIRASDMGQPPQFSDTWLTIRVVGASS 834          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 221.861 bits (564), Expect = 6.493e-59
Identity = 199/706 (28.19%), Postives = 327/706 (46.32%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAIN---CIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKN--SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +CS      G  N   C  +I +  L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++S + F L   +      + QL   + +D E +  + M +   D   P   +   + V V D NDN P F+     V+V E  P+G ++  + A D D   N + I++S   +I     +  F ++  TG + + + L+ +    +   V+A D         ATV V V D N+N P ID  Y   P N  + L EN PL  +IA++TV+D D  +N  + C    T     F L     D + + ++   DYE  +   ++I   D G P L+T+  + I I DEN+ +P F Q      + EN    + +++I A D D   NA + +       + +  ID  +G +S ++ + DREK  + S  V   D    +   + VTVK  + D+NDN P F    ++F + EN+ +   VG +  TD D G  A++  S++          DN  +    G I+     DRE   ++T ++   D   L        VTI + D NDN+P++ IP +  S  ++  T+ P  G ++ ++ A D D G N ++QY +    P        F ++ TTG + +Q ++ +A    +RL ++  DLG P
Sbjct:  130 RIDRERLCS------GVFNEKRCFYEIEVAVLPDEIFRL----VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSN-AQIHFSFSNQI-SPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDG--SATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGF-NIDPRSGILSVSKRL-DREKQEKYSFTVIARDN-GSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGK-------DNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDS-GLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNP--GSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-----LFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          

HSP 2 Score: 101.293 bits (251), Expect = 3.597e-21
Identity = 113/467 (24.20%), Postives = 205/467 (43.90%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSL----LNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNL---TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEG-GAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL      T  +I++ EN  +     + +  D D+G+N +   EL   K  ++F L      +      +   +  D E +   +++I+  D G+P  S+T  L +++ D N+  P F  S     V EN P  + + Q+ A D D   NA + F F N        +  ID+  G I T +  +DRE  + + K++ +    +     ATV V   ++D NDN P     +       +  + EN  +N+ +  +  TD D      V  Y+        +   ++ FL+      ET   +D E    + + I  +D      N  +  V I+I+DENDN P++  P+     +++      G  +I++ A D D+G+N  + Y L  + P+       F ++  +G + +  +L      +Y  T+ A D GS P+++ + + + V  Q
Sbjct:  162 LVKIRFLIEDINDNAPL---FQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYEL--VKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLI-TVKQPLDRES-NPVHKLIVLASDGSATPSRATVIV--NVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLL------ETAAPLDYETTREYAIKIVASDSGKPPLN-TSAMVLIKIKDENDNAPVFPQPEIQ---LSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDG------FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQ 603          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 222.246 bits (565), Expect = 8.747e-59
Identity = 199/706 (28.19%), Postives = 327/706 (46.32%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAIN---CIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKN--SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +CS      G  N   C  +I +  L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++S + F L   +      + QL   + +D E +  + M +   D   P   +   + V V D NDN P F+     V+V E  P+G ++  + A D D   N + I++S   +I     +  F ++  TG + + + L+ +    +   V+A D         ATV V V D N+N P ID  Y   P N  + L EN PL  +IA++TV+D D  +N  + C    T     F L     D + + ++   DYE  +   ++I   D G P L+T+  + I I DEN+ +P F Q      + EN    + +++I A D D   NA + +       + +  ID  +G +S ++ + DREK  + S  V   D    +   + VTVK  + D+NDN P F    ++F + EN+ +   VG +  TD D G  A++  S++          DN  +    G I+     DRE   ++T ++   D   L        VTI + D NDN+P++ IP +  S  ++  T+ P  G ++ ++ A D D G N ++QY +    P        F ++ TTG + +Q ++ +A    +RL ++  DLG P
Sbjct:  130 RIDRERLCS------GVFNEKRCFYEIEVAVLPDEIFRL----VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSN-AQIHFSFSNQI-SPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGS--ATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGF-NIDPRSGILSVSKRL-DREKQEKYSFTVIARDN-GSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGK-------DNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDS-GLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNP--GSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-----LFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          

HSP 2 Score: 100.523 bits (249), Expect = 5.576e-21
Identity = 114/471 (24.20%), Postives = 203/471 (43.10%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPL-----IDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSL----LNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNL---TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEG-GAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL     I+I  P N  I            + +  D D+G+N +   EL   K  ++F L      +      +   +  D E +   +++I+  D G+P  S+T  L +++ D N+  P F  S     V EN P  + + Q+ A D D   NA + F F N        +  ID+  G I T +  +DRE  + + K++ +    +     ATV V   ++D NDN P     +       +  + EN  +N+ +  +  TD D      V  Y+        +   ++ FL+      ET   +D E    + + I  +D      N  +  V I+I+DENDN P++  P+     +++      G  +I++ A D D+G+N  + Y L  + P+       F ++  +G + +  +L      +Y  T+ A D GS P+++ + + + V  Q
Sbjct:  162 LVKIRFLIEDINDNAPLFQSTVINISIPENTAIN-------NRYPVPSAFDPDVGINGIQHYEL--VKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLI-TVKQPLDRES-NPVHKLIVLASDGSATPSRATVIVN--VTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLL------ETAAPLDYETTREYAIKIVASDSGKPPLN-TSAMVLIKIKDENDNAPVFPQPEIQ---LSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDG------FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQ 603          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 214.542 bits (545), Expect = 8.936e-57
Identity = 203/726 (27.96%), Postives = 342/726 (47.11%), Query Frame = 1
Query:  616 CIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRL---IESTNTFHLKT---DKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS---TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHA-YVRENTPARSPILQIAAFDEDK--NATLRFEF--DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLM---DARYRLTLEATDLGSPPMRTPIVLYVRVTGQIS 2664
            C ++  + + + I +     I   +E+ D NDN PQF    L L + E+A +G    +  A D D +  N V +Y L    E++  F L+       KL    +  N  +D E++  Y +T+ A D   P   ++  + V + D NDN P+FE   Y   V E  P+GY++L VKA D D   N     TI+ + DP      V    ++ R TG + +   L+ +    + F V+A+D           V++ V D+N+N P ++I     R I L           E+ P+   +A++ VSD D G N+++ C        +L+P  DS   S+ NK +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ SP F+   +   +  EN P    +L + A D D   NA L +    D+ T   + +ID  +G +    + +DRE        V   D     S   T TV  ++ D NDN P F   ++SF + EN+   S VG V   D D+G  A +Q S+       + +V N  +    G I +    DRE + ++T  +   D  EP  + +YV   VTI + DENDN P+  + K SN+     S     D +++++ A+D+D G+N ++ Y ++  +P      + F+++ + G + +  +L       +RL ++ +D G P      ++++ V   IS
Sbjct:   95 CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGN--LDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP------VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEI-----RGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDS---SVDNKKK--YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEK-VLDVIALDADSGTNAELVYSIIADSSTRGLF-EIDPSSGEVR-ARSPLDREHKERYEFRVTAADK-GVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSV-------EPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRS-SYV--GVTINVLDENDNAPV--VTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPH-----ELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETIS 780          

HSP 2 Score: 77.7962 bits (190), Expect = 4.841e-14
Identity = 89/335 (26.57%), Postives = 144/335 (42.99%), Query Frame = 1
Query: 1717 YHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISE---------ISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL-SLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            YH  VRE  P  + I  +AA     ++   ++ +      YL++D   G I TTE  IDRE + +         +   V VTD +   S    +  + ++ D NDN P F +   +  +QEN  + +      ATD D     VL+Y L     S   E   LF ++       K       G +DREL D++ L I   D       Y +  + + I D NDN P +   + S+    V+    VG  ++Q+ A D D G NG+++Y +   +DP      K   +  +TG + ++  L     + ++  + A D G  P  +   + + VT Q
Sbjct:   27 YH--VREEQPPNTLIGSLAADQGLPDSGHLYKLE--VGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPR-LIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL-----SAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDG-GTPSRYSSALLRVVITDANDNAPQF---EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP----VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQ 343          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 215.312 bits (547), Expect = 1.363e-56
Identity = 203/726 (27.96%), Postives = 342/726 (47.11%), Query Frame = 1
Query:  616 CIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRL---IESTNTFHLKT---DKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS---TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHA-YVRENTPARSPILQIAAFDEDK--NATLRFEF--DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLM---DARYRLTLEATDLGSPPMRTPIVLYVRVTGQIS 2664
            C ++  + + + I +     I   +E+ D NDN PQF    L L + E+A +G    +  A D D +  N V +Y L    E++  F L+       KL    +  N  +D E++  Y +T+ A D   P   ++  + V + D NDN P+FE   Y   V E  P+GY++L VKA D D   N     TI+ + DP      V    ++ R TG + +   L+ +    + F V+A+D           V++ V D+N+N P ++I     R I L           E+ P+   +A++ VSD D G N+++ C        +L+P  DS   S+ NK +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ SP F+   +   +  EN P    +L + A D D   NA L +    D+ T   + +ID  +G +    + +DRE        V   D     S   T TV  ++ D NDN P F   ++SF + EN+   S VG V   D D+G  A +Q S+       + +V N  +    G I +    DRE + ++T  +   D  EP  + +YV   VTI + DENDN P+  + K SN+     S     D +++++ A+D+D G+N ++ Y ++  +P      + F+++ + G + +  +L       +RL ++ +D G P      ++++ V   IS
Sbjct:  131 CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGN--LDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP------VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEI-----RGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDS---SVDNKKK--YFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEK-VLDVIALDADSGTNAELVYSIIADSSTRGLF-EIDPSSGEV-RARSPLDREHKERYEFRVTAADK-GVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSV-------EPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRS-SYV--GVTINVLDENDNAPV--VTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPH-----ELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNETIS 816          

HSP 2 Score: 78.9518 bits (193), Expect = 2.736e-14
Identity = 89/335 (26.57%), Postives = 144/335 (42.99%), Query Frame = 1
Query: 1717 YHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISE---------ISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETK-------GEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL-SLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            YH  VRE  P  + I  +AA     ++   ++ +      YL++D   G I TTE  IDRE + +         +   V VTD +   S    +  + ++ D NDN P F +   +  +QEN  + +      ATD D     VL+Y L     S   E   LF ++       K       G +DREL D++ L I   D       Y +  + + I D NDN P +   + S+    V+    VG  ++Q+ A D D G NG+++Y +   +DP      K   +  +TG + ++  L     + ++  + A D G  P  +   + + VT Q
Sbjct:   63 YH--VREEQPPNTLIGSLAADQGLPDSGHLYKLE--VGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPR-LIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL-----SAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDG-GTPSRYSSALLRVVITDANDNAPQF---EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP----VPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQ 379          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 214.542 bits (545), Expect = 2.028e-56
Identity = 198/707 (28.01%), Postives = 325/707 (45.97%), Query Frame = 1
Query:  559 RLDLETICSTKQICCGAIN---CIVKIYIP-LKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIE-STNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY---PTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKN--SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            R+D E +CS      G  N   C  +I +  L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++     F L   +      + QL   + +D E +  + M +   D   P   +   + V V D NDN P F+     V+V E  P+G ++  + A D D   N + I++S   +I     +  F ++  TG + + + L+ +    +   V+A D         ATV V V D N+N P ID  Y   P N  + L EN PL  +IA++TV+D D  +N  + C    T     F L     D + + ++   DYE  +   ++I   D G P L+T+  + I I DEN+ +P F Q      + EN    + +++I A D D   NA + +       + +  ID  +G +S ++ + DREK  + S  V   D    +   + VTVK  + D+NDN P F    ++F + EN+ +   VG +  TD D G  A++  S++          DN  +    G I+     DRE   ++T ++   D   L        VTI + D NDN+P++ IP +  S  ++  T+ P  G ++ ++ A D D G N ++QY +    P        F ++ TTG + +Q ++ +A    +RL ++  DLG P
Sbjct:   90 RIDRERLCS------GVFNEKRCFYEIEVAVLPDEIFRL----VKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVG-INGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSN-AQIHFSFSNQI-SPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDG--SATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGF-NIDPRSGILSVSKRL-DREKQEKYSFTVIARDN-GSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIING-------KDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDS-GLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNP--GSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-----LFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 760          

HSP 2 Score: 98.2117 bits (243), Expect = 3.093e-20
Identity = 114/476 (23.95%), Postives = 201/476 (42.23%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPL-----IDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQF---------DYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNL---TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEG-GAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            L  +   ++D N+N PL     I+I  P N  I            + +  D D+G+N +   EL       K   L    D+       ++         D E +   +++I+  D G+P  S+T  L +++ D N+  P F  S     V EN P  + + Q+ A D D   NA + F F N        +  ID+  G I T +  +DRE  + + K++ +    +     ATV V   ++D NDN P     +       +  + EN  +N+ +  +  TD D      V  Y+        +   ++ FL+      ET   +D E    + + I  +D      N  +  V I+I+DENDN P++  P+     +++      G  +I++ A D D+G+N  + Y L  + P+       F ++  +G + +  +L      +Y  T+ A D GS P+++ + + + V  Q
Sbjct:  122 LVKIRFLIEDINDNAPLFQSTVINISIPENTAIN-------NRYPVPSAFDPDVGINGIQHYEL------VKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLI-TVKQPLDRES-NPVHKLIVLASDGSATPSRATVIVN--VTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLL------ETAAPLDYETTREYAIKIVASDSGKPPLN-TSAMVLIKIKDENDNAPVFPQPEIQ---LSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDG------FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQ 564          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 202.216 bits (513), Expect = 1.425e-53
Identity = 197/672 (29.32%), Postives = 306/672 (45.54%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES----TNTFHLKTDKLK--LKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIY---YSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI---DILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDE--DKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK----TATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLG 2607
            I V + + D NDN P F+   L + +PE+A  G   P++ A D D S  N V  Y L+ S     + F L   +     K  YL + K +D E +  Y M L A D   P    +  + ++V D NDN P F+    NV + E  P+G  ++ + A D D   N   +Y    S          +  FRL++++G + +N  LN +    Y   ++A D         ATV V V D N+N P I   DI+ P N  I + E   +   +A++TVSD D+G N  + C +   +   +   L    + Y + + +  DYE +   ++QI+  D G+ SLS T ++ I +LD N+ +P F +  Y   V EN      ++ ++A D   DKNA + + F          +D   G IS TE  +DREK     K  Y    L KD          TV   + D NDN+P F+   F F + EN+  +S VG V   D DEG    ++ S+L T + +   +D       +G I +    DRE    + L +  TD  EP  +    T  V I + D NDN PI  +P ++     V      G I+ ++ A D DA  N +++Y++   +P N      F ++   G + +   L +     +RL +  +D+G
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYP-NQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVY-FLGPDAPTMFHMDPETGIISLTEQ-LDREK-----KANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSID-----PESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSS---TVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHN-----LFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 89.7373 bits (221), Expect = 2.337e-18
Identity = 123/522 (23.56%), Postives = 223/522 (42.72%), Query Frame = 1
Query:  664 HSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSS----VNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD--PD-------------FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGD----LVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPI--LQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-----ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLL 2136
            HS S  + + + D NDN P F +  + + IPE++ +G ++    A D D  S    V R+        +     +  +L   S  + +N  ++ E    Y + +LA D  P+                + S T+ +RD    +    +GV  +S    + L   ++TV   D D   N +   Y  +P++        F+L + T      L   E L+ + + +Y  Q+ A D+         +V + + D N+N P+     PT + +++ EN  + + +  ++ +D D+  N+ +   L P  D+     ++    + S+  ++Q D EK+      I   D G P L    T+ +++LD N+  P F+ + +  YV EN P  S +  + +A  DE +N  +R             ID  +G I +     DRE+       V  TD   +  +++TV V   + D NDN P+        T+ F +    +  ++V +V A D D    A L+Y ++
Sbjct:  247 HSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD----IVAPVNGVIYISEASHVNLPVALITVS--DPDIGANGAVTCYIYNPEV-------PFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPV--FTEPTYK-VSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGP--DAPTMFHMDPETGIISL--TEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVG-FDREQRHYYVLEVQATDG-GEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRT-LPGTIVTEVSAVDNDAEINAELRYHIV 745          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.66 bits (483), Expect = 5.639e-50
Identity = 192/767 (25.03%), Postives = 332/767 (43.29%), Query Frame = 1
Query:  529 KYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHS-DSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSF--------------------------YLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKF-ESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLN--EFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDIL-----YPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELK-PTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAF--------NQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNL------TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-------FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKT----WSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDII-IQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQ---NQLMDARYRLTLEATDLGS 2610
            +  G +S   RLD E +C  +   C +   +  + +    K     +   ++V L + D ND+ P F   +L + I ES  +G  +PL  A+D D +  N +  YR+  ++       D L+L  F                           L+L + +D E    Y + L   D   P    +  +T+ V D NDN P F +     V + E   +G +++ ++A D D   N   I YS   K+  L  Q+   ++  TG + +   E L+ +    +   VVA+D          TV V + D+N+N P+ +++     Y  +  + ++EN P    + +++VSD DLG +  +   L+ PT   A+ +  NK +  + + +++  DYE+ Q   + +   D G+P LS    L IS++D N+ +P F        + + Y   +REN PA + +L + A D D   N  + F    L       E F L + T    ++T    +DREK       V   D  +   K A   V+  + DENDN P F          + F ++E   V + VG V  +D DEG  A +  +L++     W     +          G + T   +DRE    + L +   D   P L+    +  V+I + D NDN P+   P  ++   +V ++   G ++ + + A D+DAG+NG+  Y +   +P+       F +N+ +G + +    + L +  +RL +   D G 
Sbjct:   78 ELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPD-AGTNSIQHYRISAASG------DGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPN-GAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPT--GAELASPNKVQ--FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATP---LDREKRMRYELSVEACDGGSPQRK-ARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGD-------TPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALS---ASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKG-----IFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 2 Score: 103.605 bits (257), Expect = 1.226e-22
Identity = 139/593 (23.44%), Postives = 246/593 (41.48%), Query Frame = 1
Query: 1069 VKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKI--IDLNVQSTFRLNRDTGDLVLNEFLNSKI------------RIQYNFQVVAQDSENGG-NIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSL----IACELKPTKDSAKFSLLNKS------------------RDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAF-NQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFD----NLTENFYLKIDTVNGWISTTENI--IDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFE----------IQENIIVNSLVGQVLATDPDEGGAAVLQYSL-LKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYP-----KVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            V E + +GY I      DL +S      ++   P +  + L+  S   +N  +G+L +   L+ +                +  QV A     G  N+ L  V + V+D N++ P        + ++++ E++ + + + +    D D G NS+    I+           FSL+                     R L  +   +Q D E      L +   D G+P LS +  L I ++D N+ +P F +       + E++   + ++Q+ A D D   N  + + F     +L     L +D   G + T  N   +DRE +  + ++V V     + S++A+VTV  +++D+NDN PVF E  + +          I EN+   + V  +  +DPD G +  +   L   T +         FL+KT   ++     +     N ++L A    P L+      N+ I + D NDN P++  P +    + V           G +++ L+A D D+G NG + + LS      E   + F +N  TG + +   L      RY L++EA D GSP  +   ++ V V
Sbjct:   33 VDEEVLVGYVI-----GDLRQSNLLCVCFFPPAPHVSPLPLHTPSLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAP---AFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELR--EQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLV-TVRNAEKLDRETMP-VHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVF-EVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLD----YEEAQQYNVSVLAADRGTPKLSK---LLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLS-ELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTV 604          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 164.081 bits (414), Expect = 1.538e-41
Identity = 165/627 (26.32%), Postives = 274/627 (43.70%), Query Frame = 1
Query:  529 KYDGNMSFHERLDLETICSTKQICCGAINCIVK--IYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTN---TFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI--DILYPTNRHITLLENQPLQE--IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRF-----EFDNLTENFYLKIDTVNGWISTTENIIDREKISEIS-KVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE------TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDEN 2331
            + DG +S  E +D E      Q C  A +C+++  +   L   +  +    ++ ++E++D ND+ P F+++ + + I ES  +G  +PLE A D D    N +  Y L E+         +TD  K     ++    +D E + +Y + L A D   P       + + V D NDN P F     NV+V+E    G  +LT+ A D+D   N   +Y    P  +D  V+  F+L+  TG L L   L+ ++  +Y   + A+D           V V+V+D N+N P I  D +  +      +      E  + ++TVSD D   N L+AC L+       F LL   RD Y + ++   D E+     L ++  D G+P     +   + +LDEN+  P F++S Y A + EN    + +  + A+D D   N  + +     E    + + Y+ I+  +G I      +D E ++ ++ +V    D +      ATV+V+  I DENDN PV         T    +  +  +  LV  V A D D      L Y ++      Q    NLF +   G     GE+       FT   +VTD    A  +   ++ + +RD  
Sbjct:   79 EADGTVSAREVIDRE------QQCGQAPSCVIRFDVLCTLPRGLFQL----VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGG-NALRAYHLDENERFGLALRARTDGAKYAELVVK--SRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSP--VDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR---GHPHFKLL-PYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRP-LDYEAMTSLTFQVQARDDGVPPLVTNATVSVR--IVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIV------QGNERNLFRINRLG-----GEV-------FTNAASVTDAAASATRH---SLVVMVRDRG 662          

HSP 2 Score: 104.375 bits (259), Expect = 6.672e-23
Identity = 130/573 (22.69%), Postives = 236/573 (41.19%), Query Frame = 1
Query: 1006 VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDT-----GDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-PLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFN-----QSHYHA-YVRENTPARS--PILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIP--KNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYI-QNQLMDA-----RYRLTLEATDLGSPPMRTPIVLYVRV 2649
            V + D ND+ P F     +V + E++ LG  +    A DLD   N    Y+      +D N +    L   T      +LV+   L+ +   +Y  Q+ A D  +        V + V D N+N P   +   T+ ++T+ E+  P   +  L  +D D G N  +        D+    L         +    Q D+E      + IQ  D G  S+     + + + D N+ +P        QS     +V E     S   ++ ++  D  +N  +         +F L +   + ++  T + +DRE++++   V+  +D      + A      ++ DENDN+P F   T+   + EN    + V  V A D D     ++ Y+++++  +       + +  ++GAI     +D E   + T  +   D+  P L  N     V++RI DENDN P+   P  +N   ++ +     +G ++  + A+D D+  NG++ Y +   +  N      F +N   G V+     + DA     R+ L +   D GSP +     + +RV
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYH------LDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP---VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRG-HPHFKL-LPYRDDYVVVTNSSLDREQMADYFLVLEASDG-GTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTN---ATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN-----LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 3 Score: 77.7962 bits (190), Expect = 1.047e-14
Identity = 105/449 (23.39%), Postives = 176/449 (39.20%), Query Frame = 1
Query:  397 SINVKVMEETSPDVVFISLRSV-LKEN-------SFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQ------FSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL-NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQE-----IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISI 1674
            S NV V E+ +P  V ++L +  + E        SF       + R   +D K  G +S   +LD E            +N   +I I  ++           V + + D NDN P+             +F+ E A    ++ L    D D +      E  L+      H     L  +  Y+ + N  +D E   DY + L A D   P     +  TV + DENDN P+F    Y  S+ E    G  + TV A D D   N    Y  ++ ++   +V +   +N  +G +     L+ +      FQV A+D      +  ATV+V + DEN+N P+  + +P  R+ T +   P        + ++   DSD   N  ++  +    +   F +     ++++  +S            L +   D GSP+LS T  + I +
Sbjct:  249 SCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKT-GKLSLKGQLDHE------------LNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSA------ENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPV--VTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 3.885e-40
Identity = 186/682 (27.27%), Postives = 296/682 (43.40%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTN-LKLFIPESAKIGFYLPLEAAVDHDFS--SVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL---ATVNVYVKDENNNRPLIDILY--PTNRHITLLEN-QPLQEIAILTVSDSD-LGVNSLIACELKPTKDSAKFSLLNKS-RDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSP-SLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            V + + D NDN P F +   +++   E A +G  + L+ AVD D     VN  H Y+++       L   +   K  +L L     +D E    YA+ + A D   P       + V V+D NDN P FE   Y  SV E  P+G  +  +    L R +    + +  DPK               TG +   + L+ + R QY   + A D   GGN  L   AT  + + D N+N P I  +Y  P  R  ++ E+  P    A++TV+D+D    N  ++  +    +   F L       L  +  + Q D E+  +  L I   D G P + S T +L + + D N+++P F  S Y A + E  PA S +  + A D D   NA LR+   +  +  +  +D   G + TT+  +DRE  S +   +   D      KTA  ++   + D ND  P+F +T +     EN +    V  V A D D G    ++Y+      ++ +E+    L    G + T   +DRE  + + L++   D   P L     T  VT+ + D NDN P+++  +   +I+   + P     +  + A D D G NG V+Y L+  D         F VN+ TG V  +  L     A Y+L + A D G    R+P ++ + V 
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNH-HAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDL----LHRGRGPLAVPF--DPK---------------TGMVSTRQPLDFEARRQYTLSLRAAD---GGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLV-TTDGKVDREVASSVVLNISAQDQ-GAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREM--FRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGS---TAKVTVVVGDLNDNHPVFYPVQYFASILE--NEPGG-TAVTTVTATDPDRGANGTVRYQLTAGD------AARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVA 649          

HSP 2 Score: 156.762 bits (395), Expect = 8.042e-39
Identity = 153/591 (25.89%), Postives = 267/591 (45.18%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKI------SEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            +D E +  Y + + A D      +S   +T+ V D  D  P F    Y+  V E +  G  + +V A  LD + N + +  S D +        +F +    G +     ++ + +  Y  +VVA    +GG    A+V+V V D NN+ P+ D     +  +++ E++P+      +  +D D G N  +  E+       KF +    +    ++   + D E  +   L +   D G   LS++ T+N+++LD N+  P FN S Y  +  E     S +  + A D D   N  + + F+    NF  ++D+  G I++   + DRE +      +  S  V  TD           TV+  + D NDN P FA++ +   + E+    + + +V A+D DEG    L+Y++ +     +  VD      + G I   G +DRE   ++TL+++ TD    +    +  V +++ DENDN P +     S   ++     +VG+++I L A D D G +G V+Y +      N  AT  F ++ +TG V++  +L       YRL + A D G PP  +  +L V V
Sbjct:  616 LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQR-------GSFSIEWSGGRIFTANAIDREEQAFYQLRVVAN---SGGVAGEASVSVLVHDVNNHAPVFDR---ASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQ----LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNF--ELDSETGRIASLR-VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVD-----ASTGQITLLGSLDREETASYTLVVSATDS-GTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAG---NTHAT--FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHV 1172          

HSP 3 Score: 144.05 bits (362), Expect = 6.843e-35
Identity = 164/666 (24.62%), Postives = 286/666 (42.94%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNK-------FIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQE-IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEK------EQVCMLQIQCHDFGSPS-LSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAA--FDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYV----YIQNQLMDARYRLTLEATDLGSP 2613
            V + + D  D  P F++ +    + E+   G             + V  V    L  + N  +L     +  SF ++ +         ID E Q  Y + ++A         S++V V D N++ P F+   Y VS+ E  P+     +V+A D D  KN    Y     +I + N    F +  D G L +   L+ + R +Y+  V A D+         TVNV V D N+N+PL +    ++      E Q +   +  +  +D+D G N  +    +  K    F L +++  + S+   + FD E              +   D G P  L    T+ + + D N+  P F +S Y A V E+    + +L++ A   DE  N  LR+  +   E     +D   G I T    +DRE+ +  + VV  TD+       A+ TV  Q+ DENDN P F E+  S +  E+  V  L+  + A+D D G +  ++Y+++   +     +D     ++ G++     +D E    + L ++  D      +  T  + + +RD NDN P  F+P +  A I + + P +G  +I + A+D DA  NG++ Y ++   P       +F ++  +G +     I  ++    + +T+ ATD   P
Sbjct:  644 VTITVADAQDTPPTFARDDYSFVVFENVAPG-------------TLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKY-----EIGEGNGGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNS---SSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE--KPQVNFELDSETGRIASL---RVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQI-TLLGSLDREETASYTLVVSATDS-GTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAID-----RSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATI-LVVHVRDFNDNPPA-FLPGDVFASI-MENIP-IGTRVITVTARDPDADVNGELHYSIARQFPPG----AHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIP 1267          

HSP 4 Score: 142.124 bits (357), Expect = 3.060e-34
Identity = 144/536 (26.87%), Postives = 235/536 (43.84%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYL-QLNKFIDYEIQTDYAMTLLACD---PDFCTNQS-ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFD---NLTENFYLKIDTVNGWISTTENIIDREKISEISKV-VYVTDTL--NKDSKTATVTVKFQISDENDNKPVFAETFSFEIQE-NIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF-LMKTNGAIETKGEIDRE 2229
            S S+ V++ ++D NDNKP F+ ++      E  ++G  +    A D D  S   V  Y   +    F L ++  ++ S  +      I       ++ +++A D   P    +++ + V V+D NDN P+F   VY  SV E+      +L V A D+D   N   + Y+I+    + N    F ++  TG + L   L+ +    Y   V A DS         TV V V DEN+N P   + L      +  LE+  + E+ I LT SD D G +  +   +      A F++    R   S+  +++ D+E +++  L +   D G P  S+   L + + D N+  PAF      A + EN P  + ++ + A D D +      +          +  ID  +G I T    IDRE    + +V V  TD        ++A   V   ++DENDN P F    +  +        S+VG + A+DPDE   A ++Y++         +   LF L +  G IET  E+DRE
Sbjct:  843 SSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGV-TYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVN-GALRYAIN----EGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLL----SVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAI---DRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAE-IDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTG------GDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 5 Score: 140.969 bits (354), Expect = 5.742e-34
Identity = 173/712 (24.30%), Postives = 296/712 (41.57%), Query Frame = 1
Query:  481 MPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAIN---------------CIVKIYIPLKNKITDIHSDSI---------NVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKE-TIPLGYT----ILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI--DILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGS-PSLSTTKTLNISIL--DENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTE-----------NFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFI-PKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQY 2469
            MP  +LFL  H  +D + +G + F       T+        G IN               C+  ++  L + + D  + S           V++ + D NDN P F+   ++L + E+   G  +   +A D D    N +  Y ++  +    +    +   S  L+ ++ +D E +  Y +T+ A D    T+  ++V VRD NDN P+F    Y+  V E   P G T    I TV A D D S  F  + Y++ P          F L+  TG L +   L+ + R  Y  +  A D   GG    A + V V D N+N P +  D L          +  P   +  ++ +D D GVN+ +   +       +F++ N  +    +  ++  D E++    L ++  D    P    +  + +S++  D N+ +PAF  S   A   E++P  + +  + A D D       E+   T+                ++TV G +      +DRE     +  V   D   +   T+T T+   + D NDN P F    +   I E+    + V ++ A DPDEG    L+Y +     +    +D +      G +     +DRE   ++ L +   D   P  +D   T +V + + D ND  P + + P   +A  N T  P V  +I+Q++A+D D G++G+V Y
Sbjct: 1419 MPSSYLFLRHH--LDWEPEGQLVFF------TLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDAD-QGQNALVTYSVLSGSEGAFV----VDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDAD-SGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATD--GGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPE----DAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQ----LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRE-LDREARQSYALTVLAVDK-GRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVL-----GTLAVARPLDRERTASYELAVRARDGGGPARSD---TASVRVTLSDVNDCSPAFQLSPYTVHAREN-TQGPPV--LILQVVARDDDLGSSGQVTY 2092          

HSP 6 Score: 137.502 bits (345), Expect = 7.682e-33
Identity = 143/570 (25.09%), Postives = 239/570 (41.93%), Query Frame = 1
Query:  976 PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRH---ITLLENQPLQE------IAILTVSDSDLGVNSLIACELKPTKDS----AKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK--TATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLL---KTWSSRQKEVDNLFLMKT-NGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSP 2613
            P   +   + + V D NDN P F      + V+E    G  I T+ A D D+ +N    Y  +         +  F ++  +G L  +  L+ + R  Y   V A D   G +   A ++V V+D N+N P        +RH     + E+           I  +   D+D G    +   L P++DS      F L   +    +++ ++  D E     +L+ +  D G   L+ T  L +++LD N+ +P+       A V E+ P  + +L+I+A D+D+      EF   + +   +    N    +    +DRE+ S  + VV V+D         ++ V V   ++D NDN P F    S    E+  V ++V  V A DPD G  + ++Y+L    +            F + T  G +    E+DRE   ++ L +   D+  P L     T  + + + D NDN P  F  +   A I     P  G  +++L A D D G NG+++Y ++  DP     T  F ++   G + +   L     A Y L + A D G P
Sbjct: 1494 PPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLS------GSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD---GTHATDARLSVAVRDANDNSPRF------SRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVT---GALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTS---TATLAVTVGDANDNAP-RFPRREYEAAIAEDEPP--GTEVLRLSAWDPDEGANGELRYDIASGDP-----TGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGP 2032          

HSP 7 Score: 128.257 bits (321), Expect = 5.328e-30
Identity = 175/740 (23.65%), Postives = 308/740 (41.62%), Query Frame = 1
Query:  490 DFLFLNRHALIDVKYD---GNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQ-----FSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSF-YLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSIT----VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-PLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            D L   R  L  V +D   G +S  + LD E   + +Q    ++        PL  + T +        ++++D NDN P               + ESA  G    L    D D  + N      ++      H       +     L++   +D E    Y +T+LA D      +S T    V+V D ND+ P+F    Y  ++ E  P G  +  V A+D D   N + + YSI    +  N    F ++  TG +  +  ++ ++       + AQD          ++ V + D N+  PL      T    T +EN  P   +  ++ +DSDLG N  +     P   +    +         + + K  D E+ +   L +Q  D GSP L +T  + + + D N+  P F    Y A + EN P  + +  + A D D+  N T+R++     +    +++ V G +ST  + +DRE+ +     V   D  +  +++  + V   ++D  D  P FA + +SF + EN+   +LVG V A+  D    A + Y ++   S  Q+   +  +  + G I T   IDRE +  F  L  V +   +A      +V++ + D N++ P++     ++  +++     V      + A D D+G NG+V+Y +     E     K+       G +Y++ +L       Y LT+ A D G  P+ + + + V V
Sbjct:  157 DLLHRGRGPLA-VPFDPKTGMVSTRQPLDFE---ARRQYTL-SLRAADGGNPPLSGRATAV--------IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLN-AKLRYSI----VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPL---FTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL-TAGDAARFQVNAVTGAVSTRVS-LDREERAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLN--ANVTYLIV---SGDQR--GSFSIEWSGGRIFTANAIDRE-EQAFYQLRVVANSGGVAGE---ASVSVLVHDVNNHAPVF---DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIG----EGNGGEKFGIF--PDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTV 852          

HSP 8 Score: 117.087 bits (292), Expect = 1.233e-26
Identity = 134/564 (23.76%), Postives = 235/564 (41.67%), Query Frame = 1
Query:  664 HSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAK---------IGFYLPLEAAVDHDFSSVNRVHEYRLIESTNT-FHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPD-FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSI---DPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLAT---VNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEI-AILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSS-------KQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNS-LVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD 2268
            H+    + + + D NDN P+FS+      + E A          IG  L    A D D      V  Y L  S ++ +      L   +  L + + +D E +  Y +   A D         + V+V D NDN P  ++      V E  P G ++L + A D D   N + + +SI   DP       +  F +  D G L +   L+ + +  YN  V   D        L++   V++ + D N+N P     + + R     E+ P+  + A +   D D G NS +   L  T               +++++        ++ D E  Q   L +   D G P L++T TL +++ D N+ +P F +  Y A + E+ P  + +L+++A+D D+  N  LR++  +       ++D V G ++     +DRE+ +     V   D     +++ T +V+  +SD ND  P F    ++   +EN      L+ QV+A D D G +  +      T+++        F +  +G +     +DRE      L+I  TD
Sbjct: 1597 HATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEV-TYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVN-AELEFSISSGDP-------EGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPA----FTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALA-TDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARP-LDRERTASYELAVRARDG-GGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQV------TYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 9 Score: 84.3445 bits (207), Expect = 1.335e-16
Identity = 89/345 (25.80%), Postives = 146/345 (42.32%), Query Frame = 1
Query: 1627 FGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENII-----VNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF-LMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGS-PPMR 2622
            F  P +S+   + IS+ D N+  P F        V ENT     I  ++A D D  +NA + +   + +E  ++ +D  +G +  +   +DRE+ +     V  +D  +      +V V+    D NDN P F+   +SF++ E+         +++G VLA D D G    + Y+L  +  S     D  F L    GA+     +DRE    + L    TD   LA    T  + + + D NDN P     +N +    V      G  ++++ A D D G N ++++ +S  DPE        F     G + +   L   R   Y L +  +D    PP R
Sbjct: 1491 FIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFV-VDAASGVLRASRR-LDREERASYLLTVRASDGTHATDARLSVAVR----DANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDS--DWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLA---ATARLYVNVLDANDNAPSV---QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR------FAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPAR 1815          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.303 bits (399), Expect = 2.991e-39
Identity = 164/677 (24.22%), Postives = 276/677 (40.77%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD----PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKN----FS-----TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENF--YLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYR---------------LTLEATDLGSPPM 2619
            V + + D NDN P+F    L+  +PE A IG  + L  A D D + +N +  YRL      F +     ++ +        +D E +  Y + + A D    P   ++ ++ V V D ND+ P+F +  Y      + P G  +  V A D D   N    FS     +  +S+DP+   ++     +  RD  DL L       +R+         D        + TV V  +D            P  R  +  E+QP      +  + S       ++  L    +      ++      S+H  +  D+E +    L ++  D G P  S    L + +LD N+ +P F+ S + A V ENTP R+ I+ + A D+D     + ++  +  N     +++  +G I +  + +DRE ++     V  TD     ++  TV V   ++DENDN P F + FS  ++E+  V   V +V   D DEG  A + +SLL              +  + G I     ++RE    + + +  +D        V+T+VTI + D NDN P +       A       P  G+ ++  + A D D G NG+V +++          T+ F V   +G ++    L   RYR                 + A D G PP+
Sbjct:   12 VTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDAD-AGLNAIISYRLRGGDGHFSVNPSTGQIIT-----TASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRD--DLTLT------VRVS--------DGGAPPRSAVTTVTVRFRDAGE----FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGP-VSYHLASGGNLGDVFAVDPQSGEVSVH--RALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRT-IVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSV-STLDRENVASYELTVKATDR-GSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLP-------FSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWT----VSTDVTIVVDDVNDNAPRF----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFM-------RSQTENFRVGRDSGEIHSVRPL---RYRDPAGGGSGANLNKYSFVVTAMDRGRPPL 631          

HSP 2 Score: 142.895 bits (359), Expect = 1.696e-34
Identity = 162/667 (24.29%), Postives = 280/667 (41.98%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIES--TNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQE-IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVC---------MLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF-LMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEA 2595
            + ++++++D NDN P+FS +     +PE+      + L  AVD D S +N   +Y +I+    N F +  +  +++S        +D E    Y +T+ A D    T      + + V DENDN P+F   +++  V+E   +G+ +L V  +D D   N +  +  +DP +        F ++  TG++ ++  LN + R  Y  +V A D     + D   V + V D N+N P       T  +I   E    +  +A ++ SD+D G N  +   ++   ++ +       RD   IHS +   Y                  +   D G P LS+  T+ I+I+  N  +P F +  Y   V     A + IL ++A D D++   +  +  +  N   + D   G        +  +  S  S  V   D   +   ++  T    +++EN   P FA       + EN    S + +V ATD D G    + YS+     S       LF + + +G +   GE+D E +  + L +   D    A     + V+I + D NDN P+         IP+N+ +          G  ++ + A D D+ +N    Y  SL+D E ++    F +N  TG +  Q  L       Y LT+ A
Sbjct:  320 LKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKD-SGINGQVDYSIIDGNIGNVFRVNPNSGEIRSV-----STLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQ-IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSL-------PFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTD---VTIVVDDVNDNAPRFGQ---TAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRV-----GRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDR-GRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGS------GLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTEC-SGVSISVTDVNDNPPMLNASDYYPVIPENAPS----------GTTVLVMDAVDADSPSNAVTMY--SLDDGEADL----FVLNQKTGVLTTQGFLDYETKQTYELTVRA 936          

HSP 3 Score: 140.969 bits (354), Expect = 6.664e-34
Identity = 168/678 (24.78%), Postives = 296/678 (43.66%), Query Frame = 1
Query:  673 SINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSF----YLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLV-LNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDRE--KISEIS-KVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYV-TTNVTIRIRDENDNKPIWFIPKNSNAIIN--VTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSPPMRTPIVLYV 2643
            S +V + + D NDN P+F +T   +  PE ++    +   +A D D  +  +V  + +   T  F +  D  ++ S     Y              Y+  + A D   P   ++ ++T+++   N N P+F    Y+  V  T+  G  IL + A+D DR  N   I YS+      +   ++ R + D G  + L   L       ++  V A+D         AT  + V +EN   P     +P    ++L EN P    +A +T +D+D GVN  I   +     S  F +   S D+  +    + DYE E++  L +   D G  + +    ++IS+ D N+  P  N S Y+  + EN P+ + +L + A D D   NA   +  D+   + ++ ++   G + TT+  +D E  +  E++ +     DT +     +T  V  QI+  N+  P F +  ++F + E+  V + VG V ATD D G    + Y L     S+   V+     +  G I    ++DRE + + TL +   +   +    V    V + I D ND  P++     S+A+ +  V+    VG  ++ + A D D+    +   +L     ++  A + F +N+ TG + + + L       Y LT+ A D+G PP     V+ V
Sbjct:  522 STDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVF-FFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVN-GQIAYSV------VGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRF--AHPP-LELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLV---GELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFV-LNQKTG-VLTTQGFLDYETKQTYELTVRAFNYPDTFHY----STAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVN-----EHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVF-----SSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLI----QSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVV 1164          

HSP 4 Score: 133.265 bits (334), Expect = 1.528e-31
Identity = 156/645 (24.19%), Postives = 268/645 (41.55%), Query Frame = 1
Query:  673 SINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQS-TFRLNRDTGDLVLNEFLNSKIRI---------QYNFQVVAQDSENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENI-IDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL 2562
            ++ V + + D NDN P+F++      + E A +GF +   + +D D    N    + L++ +  F +     ++      +++ ++ E ++ YA+ + A DP +  +  +T+ V D NDN P+F    Y +   E       +  V A D D   N    ++        +  Q+  FR+ RD+G++     L  +            +Y+F V A D         ATV + +   N N P  +   Y T    T+        I  ++  D D  VN  IA  +     S +F +         +H       +   +  + ++  D G P LS+  T  IS+ +EN+Y+P F        + EN PA S + ++ A D D   N  + +   +   +    I   +G +     +  + EK+  +S  V   D     +KT    V   ++D NDN P+  A  +   I EN    + V  + A D D    AV  YSL         E D   L +  G + T+G +D E    + L +   + P    +Y T  V ++I   N+  P  F+ +  N +++ ++   VG  +  + A D DAG +G V Y L       E  +K F VN  TG + + +QL
Sbjct:  423 TVKVLISVTDENDNSPRFTQI-FSAHVREDAAVGFPVLRVSTLDAD-EGPNAAITFSLLDPSLPFSIHPSTGEIT-----VSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFF--------MRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGT---RILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGG----FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLS--VCAADG-GWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSL------DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTF-HYSTAQVHVQITGVNEYFP-RFVQREYNFVVSESA--PVGAPVGSVFATDRDAGIDGTVFYMLF-----GESRSKGFSVNEHTGEIIVSSQL 1027          

HSP 5 Score: 122.094 bits (305), Expect = 4.175e-28
Identity = 163/658 (24.77%), Postives = 266/658 (40.43%), Query Frame = 1
Query:  538 GNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDF-----CTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGS-PSLSTTKTL-NISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLR-FEF----DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPD-EGGAAVLQYSLLKT---WSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIR--DENDNKPIWFIPKNSNAI---INVTSYPKVGDIIIQLIAKDVD 2442
            GN S    +D       +    G    I  + +  +++     S      + + + N   P+F+   L+L +PE+   G  L    A D D + VN    Y +     +      +    S  + L   +DYE +  Y +++ A D  +     C+  SI+  V D NDN P   +  Y   + E  P G T+L + A+D D   N  T+ YS+D    DL     F LN+ TG L    FL+ + +  Y   V A +  +  +   A V+V +   N   P  +   Y    +  + E+ P+   +  +  +D D G++  +   L     S  FS+   + +   I  S Q D E+E    L++   + GS       + L N++I D N+  P F+ + YH  V E     + ++ ++A D D     R F F     N    F +   T  G I    + +DRE +   +  V   D + +   T T  V   + D NDN P F  T S ++ EN      V  + A DPD         + LL +   W          F + ++G ++T   IDRE    F L +A+ D        +T+ VT+ +   D+NDN      P  +  +   +N    P  G  I  +  +D D
Sbjct:  693 GNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTD-AGVNGAIVYSIASGDGSGLFDISR---ASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSIS--VTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTM-YSLDDGEADL-----FVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREY----NFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGE---IIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHT--GLI-VVASPLDRESVPLYNLTVVAVD-MGEPPATGTTVVVVALEDVNDNGP-FLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWR-------GYFSLSSSGLLKTARPIDREQKPEFHLPVAIADA---GSPPLTSTVTLHLSVLDQNDN------PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD 1309          

HSP 6 Score: 119.783 bits (299), Expect = 2.054e-27
Identity = 155/686 (22.59%), Postives = 278/686 (40.52%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLY------SIHSSKQF-DYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREK-ISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDE-GGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVD-AGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVTGQ 2658
            S    V + I+  N N P+F +      +  + + G  +   +AVD D   VN    Y ++    +     D       +L L   +  +  + +++T+ A D   P   +  +  + V +EN   P+F      +S+ E  P G ++  V A D D   N + +Y      I   +    F ++R +GD++L   L+ +    YN  V A D       + + V++ V D N+N P+++    ++ +  + EN P    + ++   D+D            P+     +SL +   DL+       + +++ F DYE +Q   L ++  ++      +T  +++ I   NEY P F Q  Y+  V E+ P  +P+  + A D D   + T+ +     + +    ++   G I  +   +DRE+  S   +V+       +      V V   I+D ND  PVF+   +   + E   V + V  V A D D   G     + +    + R   ++        G I     +DRE    + L +   D  EP       TT V + + D NDN P         +   VT     G  ++ L A D D   N G   + L  +DP    A + +F  S++G +     +       + L +   D GSPP+ + + L++ V  Q
Sbjct:  632 SSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPD-RDVNGQIAYSVVGGNASRRFDVD----AGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVY-----SIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNA---SDYYPVIPENAPSGTTVLVMDAVDAD-----------SPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQ-LDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSIN-----AHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATG---TTVVVVALEDVNDNGPFLL-----TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDP----AWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQ 1274          

HSP 7 Score: 114.775 bits (286), Expect = 6.455e-26
Identity = 136/541 (25.14%), Postives = 231/541 (42.70%), Query Frame = 1
Query:  967 ACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD-SENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQEIAILTVS--DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF---DNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL 2562
            A +P      ++TV V DENDNLP+F +     +V E  P+G  +  V A D D   N + I Y +            F +N  TG ++    L+ + R  Y  +V A D     G    AT+ V V D N++ P  ++  Y     +    +      A+  V+  D+D G N  +   L  +  SA FS ++  R +  IH+++     ++ +  L ++  D G+P  S   T+ +   D  E+ P F         RE+ P  + I  +AA    +   + +      NL + F   +D  +G +S     +D E       VV   D+      +A + ++  + D NDN P F+ + F  ++ EN    ++V  + A D D G    + YS++         + N+F +  N G I +   +DRE   ++ L +  TD       + T  V I + DENDN P +          +V     VG  ++++   D D G N  + +  SL DP     +  F ++ +TG + +  +L
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLN-AIISYRL------RGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPY-----VAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA-SAGFS-VDPRRGV--IHAARALQGPRDDL-TLTVRVSDGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVF--AVDPQSGEVS-VHRALDHEYQHHYELVVEARDS-GFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIV-VLTAVDKDSGINGQVDYSII------DGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDR-GSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITF--SLLDP-----SLPFSIHPSTGEITVSRRL 500          

HSP 8 Score: 98.5969 bits (244), Expect = 6.269e-21
Identity = 117/459 (25.49%), Postives = 200/459 (43.57%), Query Frame = 1
Query: 1324 ATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFG-SPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDT-LNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKP------IWF-IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
             TV V V+DEN+N P             + E+ P+  ++A++  +D+D G+N++I+  L+       FS+ N S     I ++   D E  +  +L++   D G +P LS++ TL +++ D N+++P F  + Y AY   + PA + +  + A D D   N  LRF     + +    +D   G I     +  +    +++  V V+D      S   TVTV+F+ + E    P FA    SF  +E+    + +  V A      G   + Y L    +S     D   +   +G +     +D E   ++ L++   D            + + + D NDN P       W  +P+N+         P+    I+ L A D D+G NG+V Y +   +  N      F VN  +G +   + L     A Y LT++ATD GSP     + + + VT
Sbjct:   10 GTVTVLVEDENDNLPRFGA---AELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLR--GGDGHFSV-NPSTG--QIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSG-SASAGFSVDPRRGVIHAARAL--QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE---FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGP--VSYHL----ASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDS-GFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTP--------PRT---IVVLTAVDKDSGINGQVDYSIIDGNIGN-----VFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVT 431          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 193.741 bits (491), Expect = 4.950e-50
Identity = 185/671 (27.57%), Postives = 311/671 (46.35%), Query Frame = 1
Query:  679 NVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI---DILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            N  + ++D NDN P F+  +    + E+  IG  +    A D D     +V     +  T+ F +        +  +   + +D E Q  Y++ + A D   P      +IT+ + D NDN P+F    Y ++V E    G  IL V A D D   N    Y      II  N  + FR++  TG + +   ++ +    YN  + A+DS     +  A V + V DEN+N P+    +  Y  +  +++        +A++T +D D G N+ +   +    D++ F++ N    + ++   K+ + E      L I+  D GSP +++ K L + + D N+  P FN   Y   VREN+   + +L +AA D D   NA LR+   +  +    KI++ +G I TT   +D E+ S+    V  TD+      TA   V  ++ + ND  P F +  ++  ++EN   ++ V +V A+D D  G+  L YS++       K+ D   + + +G I T   +DREL   + + + VTD   P L++    T VTI+I DENDN P +     S++I+   S P       +L A D D G N ++ Y LS ND         F + +++G + +   L     + Y L ++A D G+PP  + I + V V
Sbjct: 1084 NATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNP-----ATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTY-----SIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIG-----SRVAVVTATDRDEGSNAQVFYSIV-RGDTSAFAI-NAMNGVLTVK--KEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTT-TPLDFEEKSQYGLEVTATDS----KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS--LSYSIVG-----GKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSN---LTWVTIKILDENDNSPKFDSSSYSSSILE-NSAPS--SFSFKLAATDADEGTNARITYNLSRNDA--------FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTV 1709          

HSP 2 Score: 188.348 bits (477), Expect = 2.622e-48
Identity = 187/701 (26.68%), Postives = 314/701 (44.79%), Query Frame = 1
Query:  538 GNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENF--YLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAII-NVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATD 2601
            G +S    LD ETI S   +   +         P ++    IH       + ++D NDN P+F K+     I E A +   +      D D  S   +      E ++ F + +    L    L      DYE    Y +T+ A D   P       + + + + NDN+P F S     S+ E + +   ++ + A D D +         +   I++ N  S+F++++ +G + + + L+ +    Y   V A ++ + G        + V D N+N P   +  P +   +L EN P+ Q +A +T +D D G N+ +  EL    D++KF + N +  L  + + +  D E +    L++   D G PS S    + ++I D N+ SP F+QS Y   V ENT   S IL++ A D D  A  R  +  ++ N     +ID+  G I T   ++DRE ++  +  +   D+       +T  V   ++DENDN P+FA    S+ I E + + S V  V ATD DEG  A + YS+++  +S         +   NG +  K EI+RE    +TL I  +D   P +  +     +T+ + D NDN P++    NS + I +V         ++ + A D D G N  ++Y +   + E     K F +NST+G +     L     ++Y L + ATD
Sbjct:  844 GILSVRSTLDRETIPSYTLVVKAS-----DAGSPQQSITASIH-------VSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKTPL------DYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP--------LTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP---VFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELS-VGDTSKFEV-NPATGL--VTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRI-TVVGVVDREALASYNLTISAKDS-GVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA------FAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSD---KELTVVVNDVNDNPPVF----NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE-----KRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD 1491          

HSP 3 Score: 187.578 bits (475), Expect = 4.751e-48
Identity = 179/662 (27.04%), Postives = 299/662 (45.17%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLT--ENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKT-----ATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSP 2613
            +D+ ++ + + D NDN P FS +  +  + E+   G  +   +A D D SS N    + +I+  +      D     +  + + K  DYE +T Y +T+ A D   P       +T+ + D ND+ P F    Y+  + E+  +G T++TV A DLD        Y     ++I  NV+  F ++ ++G + ++  L+ +    Y+ QV A+D  +        V + ++D N+N P+    Y          + P  +I  +  +D+D   N  +   L    D   FS+ N S  L ++ +  Q DYEK+   M+ +   D G+PS S+   + + + D N+  P F +S Y   V EN  A   +  + A D D  A  +  +  L+  EN    +D   G I TT   +DRE I+  S       T+N D  +     A  TV   I+DENDN+P F     F I E+    + VGQ+ ATD D G    + Y+++        ++D       +G +  +  +DRE   ++TL++  +D        +T ++ + + D NDN P +     S  I    S   V   ++Q+  +D D G+NG +   LS    +N       F   +TG+V  +  L     A Y+LT+ A D GSP
Sbjct:  357 TDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRD-SSTNGALVFGIIKGNDDGVFTIDG---STGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEY-----RLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPY---VFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD--VFSI-NTSTGLITLKT--QLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEI-TTRVPLDRETIASYSL------TINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLD-----PRSGILSVRSTLDRETIPSYTLVVKASDAGS-PQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDAS---VHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-------FTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSP 975          

HSP 4 Score: 176.407 bits (446), Expect = 1.121e-44
Identity = 187/682 (27.42%), Postives = 300/682 (43.99%), Query Frame = 1
Query:  664 HSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNF---------STIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTV--SDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYS--IHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            H     V +++ D NDN P+F   +    I E+      + +  A D D S  N    Y L    N F + +   ++++        +D+E +  Y M + A D    T   + + V D NDN P F   VY   V E + +G  +  + A+DLD   N           T Y+++D + +   +++    +R+T             +  Y   + AQD  +      ATV + + D N+NRP+    + + ++   ++       A++TV  SD D G N+ +         +  F+L     D  +  +  S+  D+E+     L +   D GSP L+ T  L I++ D N+  P F+ S Y + V+ENTPA +   Q++A D D   N  L F      ++    ID   G IS  ++  D E  +     V   D      K  T  V   I D ND+ PVF+ + +S +I E+ ++ S V  V ATD D G    L+Y L+         V   F +  N G+I    E+DRE   +++L +   D         +T VTI ++D NDN PI+  P     +  V+     G  I Q+ A D D  +NG V+Y LS N       T  F +N++TG + ++ QL      +Y +T+ A D G+P   +  V+ V V
Sbjct:   50 HKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRD-SGTNAAITYSLFSGENKFMMNSKTGEIRTVTP-----LDHETKDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGV---IRTKGAFDRET-------------KASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPV----FSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTL-----DAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKS-PDYENKTRYDLTVQARD-RGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLI------SGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIFQGPY----VFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDN-------TDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMV 675          

HSP 5 Score: 172.555 bits (436), Expect = 1.854e-43
Identity = 179/665 (26.92%), Postives = 287/665 (43.16%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPD---FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-------DILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKP------TKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTG---YVYIQNQLMDARYRLTLEATDLGSPP 2616
            V + + D NDN PQF+K+     + E+   G  +    A D D S  N    Y ++          D+   +   +     +D E    Y++T+ A D     F    ++ + + DENDN P F +G    ++ E  P G  +  + A D D   N +  Y      II  N  ++F+L+  +G L +   L+ +    Y   V A D+ +      A+++V V D N+N P         +I    + H T+L+         + V D D G N  I   L        T DS  F L           S    DYE      L +   D GSPS S T  + I+I++ N+  P+F        + E+    + ++++ A D D    L F+          KID  +G IS  +  +DRE  +  + VV  T+T ++  ++       ++ D NDN PVF   +++  + EN+ +   V +V ATD DEG  A + Y L    +S+        +    G + TK  +DRE   +++L +   D    + + V   +T+ I D NDN P +     S   + VT     G  I++++A D DAG NG+V Y +   +  N      F ++STTG    V + ++   A Y LT+ A D G PP
Sbjct:  671 VKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDAD-SGANGKISYSILSGNENMAFAMDRFTGE---ITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTY-----AIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQ---------VKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVL-----------SKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD-GTPLTFDIVEGNAGSSFKIDQSSGLISVAKR-LDRETTANYTLVVRATETGSQ-GESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK------FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAA-ITLTINDLNDNSPQF---SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA-----FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPP 1287          

HSP 6 Score: 172.555 bits (436), Expect = 1.935e-43
Identity = 179/593 (30.19%), Postives = 280/593 (47.22%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVD 2442
            V + + D NDN P F+       I E   IG  + +  A D D  S  +V    +   T+ F      +   +  L + K I+ E    Y +T+ A D   P   +++ +TV V D NDN P F S  Y  SV+E      ++LTV A D D   N + + YSI    I  N +  F++N  +G ++    L+ + + QY  +V A DS+       A  NV ++  N N  +       N   ++ EN P    +++ VS SD      ++  +   KDS KFS+  +S     I ++   D E   +  +Q++  D G+P LS    + I ILDEN+ SP F+ S Y + + EN+   S   ++AA D D+    R  + NL+ N    I   +G I T    +DRE  S     +   D      + +++T++  + D ND++P+  + +    ++EN    + V ++LA+D D G  A L +SLL   S+  K V    L  T G I TK  +DRE    +TL I V D+  P L+      +V I + DE+DN P  F P   N  I+  S P+ G  I+Q+ A+D+D
Sbjct: 1294 VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAF-----AINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGAN-AVLRYSI----ISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKY-----TAKTNVTIRVINLND-ITPAFTQQNYTASVRENSPTS-TSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSG---IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITY-NLSRNDAFMIGASSGVI-TLAQPLDRENKSTYDLAIQARD-HGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLL---SNEHKSV--FTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSS---VADVIIDVIDEDDNCP-RFQPTEYNVTIS-ESLPR-GASIVQVTARDID 1852          

HSP 7 Score: 150.599 bits (379), Expect = 1.026e-36
Identity = 179/678 (26.40%), Postives = 295/678 (43.51%), Query Frame = 1
Query:  628 IYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVC--MLQIQCHDFGSPSLSTTKTLNISILDENEYSPAF-NQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPK---VGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGS 2610
            + +  +++   +  D+  V + I D ND+ P FS +N    IPES  IG  +    A D D     R+ EYRLI          D     S  ++++  +D E    Y++ + A D       ++  +T+ ++D NDN P F+ G Y   V E+   G+ I  V A D D S N    Y   D   +       F +N  TG + L   L+ + + QY   V A+D        L  V V V D N+N P     LY      T+ EN      +  +T +D+D G N  I+  +    ++  F++     D ++   + +   ++E +    L I   D          T+NISI DEN+  P F   S ++  + E++P  + + Q+ A D D   N  + +   +  +    ++D  +G +S   + +DRE I   + VV  +D      ++ T ++   + D NDN P F ++ FS EI+E+  V+S V QV   D DEG    +  SL    S      DN F + + G + +K  +D E    + L +   D    + +  T  V I I + NDN P +  P        VTS P+   +   +++L A D D          L+ +  E    +  F ++ ++G + +  +L     A Y L + AT+ GS
Sbjct:  446 LTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRL-EYRLISGNVKGAFNIDA---NSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ-GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV-------FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLY----TCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAM-----DRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFN--ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILS-VRSTLDRETIPSYTLVVKASDA-GSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGS------DN-FTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKS-ATAQVKITIINVNDNVPSFVSPA------QVTSIPEDVAINTHVVKLNATDSDG-------TPLTFDIVEGNAGSS-FKIDQSSGLISVAKRLDRETTANYTLVVRATETGS 1076          

HSP 8 Score: 124.02 bits (310), Expect = 1.730e-28
Identity = 127/489 (25.97%), Postives = 224/489 (45.81%), Query Frame = 1
Query: 1174 IIDLNVQSTFRLNRDTGDLVL-NEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHI-TLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLT-ENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSP 2613
            I+D N Q  F ++  TG +       + +   +Y   V+AQD+ N  +     V + VKDEN+N P     +P N ++  + EN P  ++AI+T +D D G N+ I   L   ++  KF + +K+ ++ ++      D+E +    ++I   D       TT    I++ D N+ +P F  S Y   V E+    S + Q+ A D D     R  +  ++ +  Y  +D+  G I  T+   DRE  +     +   D     S++   TV+ +I D NDN+PVF+   ++  + E++ + + +  V A+D D G  A L+YS     ++    +D +      G +     +D E   ++ L ++VTD   P L D   T+++ I + D NDN P+ F P    + +   +         Q+ A D D+  NG + + +   + +       F ++ +TG + I          RY LT++A D G P
Sbjct:    3 IMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAP----EFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGEN--KFMMNSKTGEIRTV---TPLDHETKDSYTMRISAFD----GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDS-QGVIR-TKGAFDRETKASYQVALRAQDG-GSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAV-----TGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTD---TSHLLINVNDINDNPPV-FSPSAYQSRVKENTPAGT-----QVSATDRDSSTNGALVFGIIKGNDDG-----VFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVP 456          

HSP 9 Score: 106.301 bits (264), Expect = 4.117e-23
Identity = 100/358 (27.93%), Postives = 158/358 (44.13%), Query Frame = 1
Query: 1564 SSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPM 2619
            + ++FD E E    L +   D  +        + I + DEN+ +P F  + Y   +RENTPA + +  + A D D   NA + +   +    F +   T  G I T    +D E     +K  Y       D K  T      + D NDN P FA   +   + E++ V S+V Q+ A D D G  A L YSL+   +S        F + + G I TKG  DRE   ++ + +   D    + +   T V I I D NDN+P++    ++    +V     +G  ++ + A D D GNN  ++Y  +  +  +      F +++ TG V +   L     + Y L L  TD GSPP+
Sbjct:   24 TGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKT--GEIRTV-TPLDHE-----TKDSYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS-------YFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQAT-VEIEILDVNDNRPVF---SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA-----FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPL 356          

HSP 10 Score: 53.9138 bits (128), Expect = 4.017e-7
Identity = 42/170 (24.71%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  628 IYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLD 1128
            + I  ++  T   + SI + + +ID ND++P  + ++L+  + E+     ++    A D D + +N    + L+ +    H     L   +  +     +D E Q  Y + +   D   P   +   + + V DE+DN P+F+   YNV++ E++P G +I+ V A D+D
Sbjct: 1687 LAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDAD-TGLNAELTFSLLSNE---HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 191.815 bits (486), Expect = 1.720e-49
Identity = 198/664 (29.82%), Postives = 298/664 (44.88%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKF-IDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILY--PTNRHITLLENQPL--QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDD--NFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQY-YLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLG 2607
            I+V +++ D NDN+P+F      L I ES  +    P+  A D D  + N   +Y +   ++T TF L T      S    + K  +D E    Y + + A D   P       I + + DEND+ P F    Y  S+ E    G +IL V A D D   N   I Y+ID   I  N  S F L+  TG +   + L+ +++  Y F V+A D       DLATV + V D N+N P + I Y  P N    +     L    IA + V+D D   NS    ++    D   F +  +    Y I   K  D E      L +   D G PS ST   + I + D N+ SPAF  + Y A + E     S +LQ+ A D D+  N T+ +      +  + ++D  +G + TT   +DRE++S ++  +   D      KT + TV   I D NDNKP F + ++   I E   + + V QV ATD D G    + Y +    SS   +V+ LF + T  G + TK ++DRE     +FT+L     +P L     +  V + I D NDN P+++ P    A I     P     ++Q+ A D D G N  + Y  +  N+  N      F ++S+TG +     L   ++  + L + A D G
Sbjct:   79 ISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGN-NGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSN-GDIKYAIDWDAIQSN--SIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKV--EFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLV-TTAKPLDREQVSSVTITITAQDH-GSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEI----SSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMS---SVKVELTISDINDNAPVFY-PVEYFASIMENEPPGK---LLQVTATDADEGTNAVISYDIIGGNNNGN------FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGG 717          

HSP 2 Score: 165.236 bits (417), Expect = 3.629e-41
Identity = 162/663 (24.43%), Postives = 296/663 (44.65%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFC---TNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADN-YVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDA---RYRLTLEATDLGSPPMRT--PIVLYVR 2646
            +++ D NDN P F+       I E A+ G Y+    A D D    N    Y +    +    + D    +S  +   K +D E  +   +T+ A D        + ++TV + D NDN P+F    Y  ++ E   +G T+L V A D+D   N   I Y I     D  V   F LN  TG L     L+ + +  Y+F V+A+D  +   +    V + + D N+N P   + YP     +++EN+P  ++  +T +D+D G N++I+ ++    ++  FS+ + +  + ++ S    D+E E+   L I   D G+   + T  +N+++L++ +  P F    Y+  V EN P  + + ++ A  +DKN ++ +   +        +D+  G I    ++   EK   +  V+    T+   S  ATV +  ++ D NDN P F+  +   +I    +V  +V    A D D G   +++Y L             L++  T+G I+   ++    +  +T+ +  +D      +  +T ++T+ I     N P  F    S+ + +V +   +      ++A D D+G NG++ Y +   + E        F     G +YI+  L+ A    Y L + ATD G P      P+ +Y++
Sbjct:  413 IDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGD-NGTVSYSITGGNDLGWFQVD---FQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDN-GRITYEISSS--DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAP---VFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLAS---LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNI--EVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGL------LWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSI-----NHPPKFTL--SSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEG------LFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQ 1041          

HSP 3 Score: 144.821 bits (364), Expect = 7.314e-35
Identity = 149/602 (24.75%), Postives = 260/602 (43.19%), Query Frame = 1
Query:  907 LQLNKFIDYEIQTDYAMTLLA----CDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHIT-LLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLY---SIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTD--------TLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            +++N  +D E +  Y + ++A      P      ++ + V D NDN P+F +    V +  T  +G  +    A+DLD  KN    Y       +  N +    +N  +G + L   L      QY  QV+A DS  G     +T+ +++    N+ P   +    + ++T +L +QPL  +   +   D D G N  +   +    +   F +    + LY   S+  + +  Y+      L ++  D G PS S +  + I I D N++   F  + +   V EN+   + +  + A   D + T    +  ++   +  +D  +G I+T   +   E I      VY+          T+ +D     VTV    +D NDN PVF+   ++  + E  +  S V ++ A D DEG  A   YSL+         +D  F+  + G +     +DRE   ++ L++  TD  + A+ Y T  + I + D ND +P++     S+  +N+T    +G ++I L A D D G NG ++Y +S     N      F V S TG + +   L       Y LT+ A D G  P+ + + + V V
Sbjct:  796 IKINGDMDREEKAQYLLAVIARVGTVKP-LSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQ------LTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDS--GSPPQHSTMTIHITLSINHPPKFTL----SSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGK-LYIRKSLLQALKGSYD------LIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTV----TDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTG-----MDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASN-ANLYSTAKIEITVGDSNDQRPVF---PESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS-----NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNV 1359          

HSP 4 Score: 134.806 bits (338), Expect = 6.960e-32
Identity = 192/777 (24.71%), Postives = 331/777 (42.60%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS-ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLAT---VNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLG-----VNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNI-SILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLT----ENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYV----YIQNQLMDA---RYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQ---QTPD-----FLTLIGSDNPNNTLQTSML 2922
            V++E++DRNDN PQFS +++ + I  +  +G  +   AAVD D +  N +  Y+L  +          +   S  ++L + +    +T Y + +LA D       S +T+H+    ++ PKF    Y   V  + PL Y    V A+D D  KN   ++YSI P+  +  +   F      G L + + L   ++  Y+  V A D   GG    +    V +Y++D N++R L   +  T R      + P   +  L     D       V SLI+ E     D     +  + R    +   +        V ++Q +   +   ++   K + I ++ D N+ +P F+++ Y   V E +   SP+ +I A D D+    +F +  ++    + F++   T    +S T   +DRE  S  + VV  TD  N +   +T  ++  + D ND +PVF E+ ++  I E+ ++ SLV  + A+D D G   +++YS+     +   +V++       G +     +D E    + L I   D   L     T NVT+ + D NDN P++         + V      G  + +  A D D G N  + + +    P     +K F VNS T  +     I  + M A    ++L + ATD GSP + T   + V+VT +   +     V+   A  G      +  +    + P+R S      +I    + Y  L  S   +Q   Q PD      LT+  SD    + QT  +
Sbjct:  830 VNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLD-AGKNGLVRYQLTSNAEGLLW----INSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKN-GQLFYSI-PQGNEEGLFGIFP----GGKLYIRKSLLQALKGSYDLIVRATD---GGVPSFSASVPVTIYIQDSNDHRSL--FVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVR----LDREELIKNTGSNVYIMQAEAM-YNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKT---LDRETTSSYNLVVKATDASNAN-LYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVES-----ATGRLIVAKSLDFETTQLYELTITAQDH-GLIPLSSTVNVTVNVLDVNDNAPLF---PTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTP-----SKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSP--GFVSPPAAAAG----SSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTV 1561          

HSP 5 Score: 129.798 bits (325), Expect = 2.546e-30
Identity = 172/675 (25.48%), Postives = 284/675 (42.07%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLP--LEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKS-FYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS---ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRH-ITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKI----SEISKVVYVTDTLN-KDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDN---FTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAII--NVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPEN--EVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRT 2625
            S S+ V + I D ND++  F     +  + E++  G  +   +  A+DH   S  +   Y LI S + F +     ++ +   L   + I       Y M   A   D    +    + V V D NDN P F   VY ++V E    G  +  +KA+D D   N    Y  +    +D      F +N  TG+L L++ L+ +    YN  V A D+ N      A + + V D N+ RP+    +P + + + + E+  +  + I L  SD D+G N LI   +     +A F + + +  L     +K  D+E  Q+  L I   D G   LS+T  + +++LD N+ +P F        VREN     P+ +  A D D   NA + F   + T +    +++    I TT   ID E +         VV  TD  + K S   ++TV  Q++DENDN P F    +     ++ V ++     A DPD      + YS++   +          L  + G +    ++  ++ DN   + L I  +D    +     T   + +  E    PI   P  S+A    +VT     G  ++ ++A    +  NG ++YYL+ +  +   EV      V +T G   I  + M A + L + A D   P  RT
Sbjct: 1031 SASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDH---SRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMD-----KFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPV----FPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIV---AKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEI-TTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITV--QVTDENDNSPGFVSPPAAAAGSSLNVMTIT----AEDPDRNSNGKVTYSIISGNNGY------FNLHPSTGQL----QMIHQIPDNPTIYQLTIQASDGGQPSRQ---TQTVVSVFKEG---PIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRG---IDREGMGASFNLVVYAVDKQGPSART 1664          

HSP 6 Score: 125.946 bits (315), Expect = 4.005e-29
Identity = 152/612 (24.84%), Postives = 273/612 (44.61%), Query Frame = 1
Query:  907 LQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPK---IIDL-NVQSTFRLNRDTGDLVLNEFLNSKI---RIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLID-ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSK---TATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDREL----DDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQY-YLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD--ARYRLTLEATDLGSPPMRTPIVLYVRVTGQIS 2664
            L + K +   ++  Y + + A D   P F  +  +T++++D ND+   F +  +  +V E    G  + T+ A  LD S+    +Y  I  +    +D+ + Q T R+  D  +L+ N   N  I      YN   + +D         A V V V D N+N P+    +Y        L   P+  I  +   D+D G N+     L       KF + + + +L   H SK  D E      L ++  D  + +L +T  + I++ D N+  P F +S Y   + E+    S ++ + A D+D  +N  +++   N        +++  G +     I+ +    E +++  +T T         ++TV V   + D NDN P+F  +  +  ++EN+     VG+  A+D D G  A + +S+     S+   V++         I T   ID E      D+F L++  TD+  P L+      ++T+++ DENDN P +  P  + A  ++         ++ + A+D D  +NGKV Y  +S N+        YF ++ +TG + + +Q+ D    Y+LT++A+D G P  +T  V+ V   G I 
Sbjct: 1002 LYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDK--------AIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAM---DADEGDNAKFFYSLVSGTGMDKFFINSSTGEL---HLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRL-----IVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATC-----EITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLS---TRKSITVQVTDENDNSPGFVSPPAAAAGSSLN--------VMTITAEDPDRNSNGKVTYSIISGNN-------GYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIG 1571          

HSP 7 Score: 123.635 bits (309), Expect = 2.307e-28
Identity = 164/627 (26.16%), Postives = 265/627 (42.26%), Query Frame = 1
Query:  511 HALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKI---TDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFY--LQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDL-ATVNVYVK--DENNNRPLIDILYPTNR-HITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVC----MLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLT-ENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRE-LDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDEN 2331
            H  +DV+  G ++   RLD E +           N    +YI     +   T I  D   V + + D NDN P FS+    + + E +  G  +    A+D D    N    Y L+  T       DK  + S    L L+K +D E  + Y + + A D    +  +   I + V D ND  P F    Y V++ E   +G  ++ + A D D  +N   I YSI     + N+ + F +   TG L++ + L+ +    Y   + AQD    G I L +TVNV V   D N+N P    L+PT    +T+ EN      +   T SD D G N+ IA  +     S  FS+ + + ++ +I +    D E          L +   D GSP LST K++ + + DEN+ SP F      A       +   ++ I A D D+N+  +  +  ++  N Y  +    G +     I D   I +++  +  +D      +T TV   F+        P F+   +   + EN +  + V  VLA  P       ++Y L    S    EV     +K+ G ++T   IDRE +  +F L++   D+   +    +  VTI ++D N
Sbjct: 1095 HFAVDVR-SGQITTRVRLDREELIK---------NTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGD-NAKFFYSLVSGTG-----MDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQN-GLIKYSIS----NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDH---GLIPLSSTVNVTVNVLDVNDNAP----LFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAA---IDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAA-----AGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLT--IQASDGGQPSRQTQTVVSVFK-EGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEV-----VKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 8 Score: 110.538 bits (275), Expect = 2.337e-24
Identity = 131/491 (26.68%), Postives = 215/491 (43.79%), Query Frame = 1
Query: 1201 FRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEI-AILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYS---IHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRF--EFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNA-IINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPP 2616
            F  N +TG +     ++ +   Q + Q+   +  N       +V V V D N+N P    LY T R   + E+  +     I T +D D G N  +   +    ++A FSL   +    S   + + K  D E      L I   D G+P+L     +NI+ILDEN+++P F Q+ Y   + ENT     IL+++A D D   N  +++  ++D +  N    +D+  G I T +N+    K S    V+     +   +  ATVT+   + D NDN P    T+            EN ++N+ +  +L TD D    +  +  +         +V+ L        I+ +  +DREL   + L + VTD+  +        V I + D NDN P +     SNA   N++   + G  ++QL A D D G+NG V Y ++     N++   +F V+  +G V     L     +   +T+ A D GS P
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQISLQLRTLNPSN----QPISVQVQVDDINDNEPRFPTLYYTLR---IRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTIN--VLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFY----FIQLQKPLDRELVPFYNLTLNVTDK-GVPSRSTLGFVLIDVTDVNDNSPAF----TSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGG---NDLG--WFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAP 509          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 183.341 bits (464), Expect = 9.126e-47
Identity = 201/677 (29.69%), Postives = 322/677 (47.56%), Query Frame = 1
Query:  706 NDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQ-------LNKFIDYEIQTDY-----AMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSI---DPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS--DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDN-LTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKV--GDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            ND  P F K+   + + ESA  G  +    A D D   +N +  Y    S+N    K        FY+        ++  +D E +  Y     A  ++A   D  T   ITV   D  D+ P F S    V + E   +G  +  + A+D D      TI YSI   DP  +       F ++  TG++     L+ +   QY   V A+DS N  + DL  V V V+D N+N P+  +   T   I   E  P +  +IL V   D+D+G N+ +   +   ++   +  +N    + S+ SS Q D E E+     I+  D G PS S+T ++ I ++D N+ SP FN + Y+AYVREN PA +P+L + A D+D   NA L +     L   F +  DT N    TT   ++RE+    +  +   D+  + ++  T  V   ++D ND+ P F ++ ++F ++E++ V   VG+V  TD D    A ++Y +    +S    V+     +T G I T   +DRE + ++TL+I   D   P L  N   T+V I I D NDNKP++     S ++ NVT    V     ++Q+IA D D G NG+  Y ++  D ++      F++++ TG + I+ +L     + Y LT+ A DLG+PP+     + + V+
Sbjct: 1083 NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRD-EGINAIIFY----SSNGAEAK--------FYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITV--TDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGD---TISYSIANGDPYGL-------FTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVS-DLLKVVVQVEDVNDNPPVFSMPGYT---IEYWEESP-EGTSILQVKAIDADIGDNAAVLYSI--VENVTDYVTVNAITGVISLGSS-QLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGN---ITTREPLNREETGSYTLTLRAVDSAIR-AREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVN-----ETTGIISTTSTLDREQNASYTLIITAKDHGIPALESN---TSVMITIEDVNDNKPLF-----SKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDD-----VFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVS 1704          

HSP 2 Score: 145.976 bits (367), Expect = 2.805e-35
Identity = 170/682 (24.93%), Postives = 293/682 (42.96%), Query Frame = 1
Query:  634 IPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFS-----SVNRVHEYRLIESTN-TFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEF-LNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTE--------NIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAII-NVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQ-------NQLMDARYRLTLEA 2595
            +   N +      +  V + + D  D+KP F+ ++L + + E+A IG  +    A+D D       S+     Y L    N T  ++T     +    Q   F+  +   +    LL           + V V D NDN P F    Y +   E  P G +IL VKAID D   N + +Y  ++      NV     +N  TG + L    L+ ++   +NF + A DS        A+V + + D N+N P+ +    T+ +  + ENQP    + ++T SD D+G N+ ++  L        ++      D  +I + +  + E+     L ++  D    +   T  + I++ D N++ P F QS Y   VRE+      + ++A  DED N       DN    +Y+     +   S  E        + +DRE+ +  + ++   D     +  +  +V   I D NDNKP+F+++ ++  ++E++ + + V QV+ATDPDEG      Y +         + D++F +  N G I  K ++D E    + L ++  D   P L        V I + D +DN P++  P+ S  +  NVT     G  +I + A D+DA  + K  YY      E+      F +   +G + +        N+   ARY L + A
Sbjct: 1162 VTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLL----------KVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVE------NVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFN---NTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLS----GVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDIN-------DNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDH-GIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITA------GDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACF---VEIHVSDVDDNAPVFHKPRYSAELYENVTR----GHHVITVNATDIDAEASHKRVYYRI----ESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAA 1795          

HSP 3 Score: 144.05 bits (362), Expect = 1.426e-34
Identity = 180/719 (25.03%), Postives = 289/719 (40.19%), Query Frame = 1
Query:  652 ITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQS--ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD-SENGGNIDLATVNVYVKDENNNRPLIDI-----------------------------LYPTN--------------RHITLLENQ-PLQE-----------------IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIE-TKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQ---NQLMDARYRLTLEATD 2601
            I+D  S ++ V + + D NDN PQF   N +  + E+A+ G  +   +A D D     +V  Y + +       + +KL     + + N               + C    C+ +   + ++V D NDN P F    Y   V E  P G  +L V A D D+  N    Y     K+ + N    F +N  TG++ +   ++ +    +   V A+D  E       A V + VKDEN+N P                                 L P +              R ITL+ ++ PL E                 I  +T +D D G+N++I       +  AKF +   SR    I      D E + V +L +   +  + +  TT  ++I++ D  +  P FN S     + EN    + + +I A D+D   T+ +   N        ID V G I T    +DRE +++    V   D++N  S    V V  Q+ D NDN PVF+   ++ E  E     + + QV A D D G  A + YS+++  +      D + +    G I     ++DRE+++ F   I  TD   +     T +V I++ D NDN P++    N++    V      G  ++ + A D D G N K+ Y LS       V    F ++  TG +  +   N+     Y LTL A D
Sbjct:  803 ISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVI-YNITDGDENRKCEVEKLVRHYNWHKKN--------------CVLCKESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITY-----KLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAE--AKFYV---SRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAE-LDRENVTQYELFVQAKDSVNLVSDLLKVVV--QVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVT------DYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDS-GVPSKSSTASVAIKLVDINDNSPVF---NNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLS------GVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVD 1477          

HSP 4 Score: 138.272 bits (347), Expect = 6.672e-33
Identity = 175/701 (24.96%), Postives = 297/701 (42.37%), Query Frame = 1
Query:  700 DRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSF--YLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPT-----------------KDSAKFSLLNKSRDLY---SIHSSKQ----FDYEKEQVCMLQIQCHDFG--------------SPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKN--ATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAK-DVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR----YRLTLEATDLGSPPMRTPIVLYVRV 2649
            D NDN P F++      I E+A++G  +   +A+D D S  N   +Y+   +T T   +T    L S    L L   +D+E+   Y + ++A D   P   +  ++ + V D +D  P+F    Y   ++E  P+G T++TV+A D D   N   +Y     +II  N    F ++ +TG + +N  ++++    +   V A +  +  +    TV V V D N+NRP                   LQ + I  V +       +++ +L+ T                  DS KF++   S  LY   ++   KQ    FD+E+             G              S   S   ++ +++++ N+  P F +S Y+  + E     + I  I A D D      L +E     +  Y  ++  NG IS  + I+D + + +    + V D      + A  TV   + D NDN P F    ++ +I EN+   ++V QV ATD D G    L +++         +    F +  +G + T  E+DRE    +TL ++  D   ++  +    +T+ + DENDN P   I        N++     G +++  IA  D DAG+NG++ Y +S  D         F +NS TG + I    +D      Y L +  TD GSPP      ++V +
Sbjct:   38 DYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDAD-SGTNSQVQYKFSNATAT---QTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILY-----EIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAF-----------------LQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRG-GQAAYFSVNADNGTISAAQ-ILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNI------SAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDH-GVSSRHKHVQLTVNVLDENDNTPQ--ITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSR-------FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTI 694          

HSP 5 Score: 121.324 bits (303), Expect = 1.035e-27
Identity = 152/599 (25.38%), Postives = 240/599 (40.07%), Query Frame = 1
Query:  865 FHL---KTDKLKL--KSFYLQLNKFIDYEIQTDYAM-----------------------TLLACDPD----FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGG---NIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQS-HYHAYVRENTPARSPIL-QIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVF-------AETFSFEIQENI-IVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDREL---------DDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLND 2487
            +HL    +DK  +   S  L +NK +DYE Q ++                          ++A + D    F  N S+T+ + + NDN P F    YN ++ E I  G  I  + A D D    F  + Y +          + F +N D G +   + L+     QY F +V +D   GG    I +ATV V ++D N+N P    + Y ++    + EN P   I   +T +D D G N  ++  +    D   FS+         + ++++ D E      L +  +D G  S      L +++LDEN+ +P           + E     + +L  IAA D D  +  +  +     +    +++  G +  +   +DRE       ++ VTD       T + TV   I D NDN P F         T+   + E    +N  +  + ATDPD      + YSL         E     L    G +  + E+DRE          D  F L I  TD+  P       T  V+I +RD NDN P  F  +N    ++  + P  G  +IQ+ A D D    GKV Y ++  D
Sbjct:  298 YHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLG-TFGALTYELRG-----GQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDG--GGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSD----IAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGL----VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDN-GSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL------SGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSP-QFQSQNYETRLSEAARP--GSNVIQVSATDQDLEYKGKVIYNITDGD 870          

HSP 6 Score: 113.235 bits (282), Expect = 3.954e-25
Identity = 166/687 (24.16%), Postives = 291/687 (42.36%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRV-HEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ----SITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVR-----ENTPA--RSPILQIAAFDEDKNATLRFEFD-NLTENFYLKIDTVNGWISTTENIIDRE--KISEISKV-------VYVTD--TLNKDSKTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF----LMKTNGAI--ETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR----YRLTLEATDLGSPPMR 2622
            S + +V L +I+ NDNKP F+K++    + E    G ++    A D D  +   + +E R  ++   F +  D   + +      + +DY+    Y  +L+  D      +    ++TV ++D NDN P+F    Y   + E +P G  +  V A D D  +N   + ++I       +    F +N  +G +     L+ +    Y   V A D           + V V DEN+N P I        +I+         ++ +   D D G N  +   +  +   ++F+ LN +     I S    D E +    L I   D GSP  + + T++++ILD N+ +PAF+ +   +        +  P      ++ I A D D +A  +  +  +  E+ + ++D V G +S  +  +DRE  ++S  ++        +  TD  T   D K+ATV V   + D NDN P F ++ +   + E     S V QV ATD D      + Y++     +R+ EV+ L       K N  +  E+K  ++R                        T V I + D NDN P++     S    +V      G  ++++ A D D G NGK+ Y L+  + ++      F +N+ TG + +   ++D      + LT++A D G P  R
Sbjct:  370 SANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAA-YFSVNADNGTISAA-----QILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGEN-GRLSFNISAG----DDGGHFSIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM--SGGDSRFT-LNSATGRLQI-SPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKE-LDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCSVER------------------------TYVVIYVDDVNDNDPVF---NQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDA-----FSINNVTGEITVAG-VIDREAVHTFVLTVQAEDQGEPSSR 1006          

HSP 7 Score: 110.923 bits (276), Expect = 1.881e-24
Identity = 129/536 (24.07%), Postives = 235/536 (43.84%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNS---LIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTL---NISILDENEYSPAFNQSHYHAYVRENTP--ARSPILQIAA--FDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF---------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRE 2229
            + + D ND+ PQF+++     + E  K+G  +   A  D D +   RV  Y  I S NT  + +  +   +  +     +D E    Y + + A D   P   +N S+ + + D NDN P F   VYNV+++E++ L   ++ V A D D   N    Y     KI   +    F ++ +TG + +   L+ +    YN  V AQD           V ++V D ++N P    ++   R+   L     +   ++TV+ +D+   +    +   ++     + F L+ +   + +++ +      +E     ++Q       +L+  K+L    I++LD N+ +P F+   Y   V E+T     + IL + A   DE ++  + F   +  EN   ++D   G ++ T   +DRE  S  S VV   D   + + +++VTV   + D NDN P+              +F ++EN+     VG V A D D         +L+  + +  +E     L +T+G + T+  +DRE
Sbjct: 1491 ITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYY--ISSGNTSLMFS--VNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTY-----KITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAP----VFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMF-LIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRP-LDREDTSFYSLVVMAEDK-GEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLD-------TKNLIYYYITNTEEQKYFILNETSGELRTRITLDRE 2003          

HSP 8 Score: 108.997 bits (271), Expect = 7.361e-24
Identity = 160/599 (26.71%), Postives = 250/599 (41.74%), Query Frame = 1
Query: 1012 VRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQST--FRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQE-IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENT--PARSPILQIAAFDEDKNATLR-------------FEFDNLTENFYL--------KIDTVNGW----ISTTENIIDREKISEISKVVYV-TDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIW-FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRV------TGQISQTLKI 2679
            V D NDN P F    Y   + E   +G TIL + AID D   N    Y     K  +     T  F LN   G+L L   L+ ++   Y   V+A+D          TV + V D ++  P  +   Y       + EN P+   +  +   D D+G+N+ I  E+        F+ ++ +  + +++ S   D EK  V  + ++  +   P+ +TT T+ ++++D N+  PAF QS Y   VRE+   P R    Q+   D DKN   R             F  D  +   Y+        +I+    W     S   +  D     E  KVV   TDT  K S  A+VT    + + NDNKP+FA+ ++++ + E I   + +  + ATD D G    L Y L      R  +     +   NG I     +D +    +   + V D            VT+ ++D NDN P +  +P  S+   N+ +    G I+ Q+ A D D+G NG++ + +S  D        +F +N  +G V    +L     A Y LT+ A D G       + L V V      T QI+  L I
Sbjct:   36 VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQY-----KFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKE----IEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFT-IDSNTGVITVNGS--IDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVT--LTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL------RGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPA----GTIVFQVTATDKDSGENGRLSFNISAGDDGG-----HFSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTI 604          

HSP 9 Score: 102.064 bits (253), Expect = 8.176e-22
Identity = 112/430 (26.05%), Postives = 185/430 (43.02%), Query Frame = 1
Query:  679 NVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLN----EFLNSKIRIQYNFQVVAQDSEN-GGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTV--SDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFN--------QSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKIS 1908
            +V + I D NDNKP FSK+   + + ES  +   +    A D D    N    Y++   ++ + F++  +     +  + +   +DYE  + Y +T+ A D   P       + +HV D +DN P F    Y+  + E +  G+ ++TV A D+D   +   +YY I+      N  S F +   +G + LN      LN +   +Y  QV A    N      L    + V D N+N P  D    +     L +  P+ +  ILTV   D D G +  I   +    ++  F + NK+  L     ++  D E      L +   D G P+LS++ T+NI++LD N+  P           +      V+EN  A  P+  +AA D D    + +   N  E  Y  ++  +G +  T   +DRE  S
Sbjct: 1593 SVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPD-EGANGQFTYKITAGDTDDVFYIDAN-----TGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESG----NTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFD--SESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVL---TRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYITNTEEQKYFILNETSGELR-TRITLDREDSS 2006          

HSP 10 Score: 101.679 bits (252), Expect = 1.259e-21
Identity = 141/586 (24.06%), Postives = 241/586 (41.13%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQ---SITVHVRDENDNLPKFESGV-YNVSVKETIPLGYTILT-VKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLN-EFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDI--LYPTNRHITLLENQPL---QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVC---------MLQIQCHDFGSP---SLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTD------TLNKDSKTAT--VTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKP 2343
            V + + D NDN P+F+       I E+   G  +    A D D     R+  + +    +  H   +   L +   +L    D E    Y +T+ A D    +      +TV+V DENDN P+   G+    ++ E    G  +L+ + A+D D   N   + YS+          S F LN  TG L ++   L+ +++  Y+  +   D+ +  N +  TV+V + D N+N P  D         ++  ++  P    + +  +  +D D   N  +A  L  + D   F  L+      S+   K+ D E  Q+          +L I   D  +P     S T  ++I++ D N+ SP F   +Y   + E     S ++Q++A D+D     +  + N+T+                    D  +  E+ K+V   +       L K+SK +     V   + D NDN PVF ++ ++ ++ EN    + V +V A+D D+G    + Y L     +   + D   +    G I   G IDRE    F L +   D+   +       V I ++DENDN P
Sbjct:  480 VTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRL-SFNISAGDDGGHFSINGSGLVTTAREL----DRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSN-GQLTYSMSGG------DSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSL--SGDEHGFFRLDPVTGELSVR--KELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIY-NITDG-------------------DENRKCEVEKLVRHYNWHKKNCVLCKESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKL-----TNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFP 1024          

HSP 11 Score: 87.4261 bits (215), Expect = 2.391e-17
Identity = 132/506 (26.09%), Postives = 214/506 (42.29%), Query Frame = 1
Query:  676 INVDLEIIDRNDNKPQFSKT-NLKLFIPESAKIG-FYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTN-QSITVHVR--DENDNLPKFES------GVYNVSVKETI-PLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFL---------NSKIRIQYNFQVVAQDSENG-GNIDLATVNV--YVKDENNNRPLIDILYPTNRHITLLEN--QPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDE-NEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDE 2103
            + + + ++D NDN PQ +    +   I E A  G   L   AAVD D  S N    Y +    + F L +   +L+     L    D E++  Y + +   D     N  S TVHV   D NDN P F+         Y ++V E    +  T++ + A D D   N   + YS+       +    FRL+  TG+L + + L         N++   ++   + A D      +   ATV V   V+D N+N P     + +  + T L    +P   +  ++ +D DL     +   +    ++ K  +    R          +++ K+  C+L   C +      S  +T  +  +D+ N+  P FNQS Y A V EN+P  +P+L++ A D D+  N  + ++  N  ++    I+ V G I T   +IDRE +      V   D     S+     V   + DENDN P F+ T +  EI E    NS VG  +   PD+
Sbjct:  582 VQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGS-NGQLTYSMSGGDSRFTLNSATGRLQISPTGL----DRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADAN-GKVAYSLSG-----DEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQ----FQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVR---------HYNWHKKN-CVL---CKE---SKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEI-TVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAE----NSPVGSTITMVPDQ 1051          

HSP 12 Score: 64.3142 bits (155), Expect = 3.161e-10
Identity = 113/488 (23.16%), Postives = 189/488 (38.73%), Query Frame = 1
Query: 1258 IRIQYNFQVVAQDSENGGNIDLATVNVY---VKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVS--DSDLGVNSLIACELK-PTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLV--GQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTL----------------------LIAVTDEPHLADNY-VTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGS 2610
            I+  Y F V  +D  NGG +       +   V D N+N P+    +    ++  +         IL +S  D+D G NS +  +    T     F  LN      ++      D+E  +  ML +   D G P L +  T+ I + D ++  P F QS Y   + ENTP  S ++ + A D D   N  + +E  +   +    ID+  G I T    ID EK       V  ++  + +S T    V   +   ++        + F+++E++ +   V   Q+  TD D+    V +  L     +   + D   +  T+G +     +D E   NFT                          V  E   ++ +    +VT+ + + NDNKP+ F   + N  ++    P  G  I  + A D D G  G + Y L            YF VN+  G +    Q++D     +Y+ +L   D G 
Sbjct:    5 IQDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPV----FTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTL--GGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVI-TVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKN--PVFRRVLYHLVGA---DSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPM-FAKSSYNYTMDEEITP--GTHIADITATDADLGTFGALTYELRGGQ------AAYFSVNADNGTISAA-QILDYDTLRQYQFSLVVKDGGG 470          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 183.726 bits (465), Expect = 9.744e-47
Identity = 177/666 (26.58%), Postives = 304/666 (45.65%), Query Frame = 1
Query:  694 IIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFD-EDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE---PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDA-GNNGKVQYYLSLNDP------ENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            ++D ND  P+FS++     + E A IG  +    A D D    N    Y ++          ++   K+  + ++  +D E    Y + + A D  F +   + + + D NDN P     +Y   +KE  PLG T+LTV A D D   N + + YS+  +        TF ++++     L E L+ + R  YNF V A D   GG    + +++++ D N+NRPL      ++    + E+ PL+++ + +   D+D+GVN  +   L    D+     +     + S+   K  + E ++   L ++  D G+P LS+  T+ I +L+ N+  P F+ S YH  V E+ P  + ++++ A   E  N  + +      ++    ID  NG I      +D E     +  V  +D        +T  V+  ++D NDN P F+E  +S ++ EN  + + V QV ATD D G  A ++YS+ +   +++ ++     ++  G I+  G+IDRE   ++ L +   D+   P +AD    T V I + D NDN P  F   N   +++ +S P     +I L   D DA GN    Q+ L   D        N + TK   V+ +           D +YRL +   D G PP  T + + V++ 
Sbjct: 2853 VLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDL---NTELYYFILSGDPQARFGIER---KTGVIFVHGSLDRESVGSYDLNISASDGLFTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVN-AELTYSVFGQGF-----GTFAVDKNGKMTNLVE-LDRETRPFYNFMVSAADI--GGQACYSNISIHLDDVNDNRPL---FSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSL--VTDAGGTFTIETGTGIISLE--KPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGTIHVNRK-LDYETTKLYTLTVEASDA-GPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKI-----VEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVAD----TVVDIEVTDVNDNSP-EFSSTNLTTVLSESSLPNAA--VIHLRPHDRDALGNGAPYQFTLISGDASRFKLHSNGLITKIGDVSHS-----------DGQYRLRVLVADNGHPPQSTEVSITVKIA 3471          

HSP 2 Score: 134.806 bits (338), Expect = 9.215e-32
Identity = 179/711 (25.18%), Postives = 308/711 (43.32%), Query Frame = 1
Query:  604 GAINCIVKIYIPLKNK---ITDIHSDSIN------VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSIT---VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQEIAILTV--SDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSK------QFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTE-NFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDE--PHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD---ARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            G +  I ++   ++N+   I + +  +IN      V ++++D ND  P+F        IPE+  IG  +    A D D S  N +  Y L+        K D +   + ++     +D E Q  +   + A D       S+T     V D ND  PKF    +  SVKE   +G ++ T+ A D D +        S DP       Q+ F + R TG + ++  L+ +    Y+  + A D   G     A + + ++D N+N P+    +Y    HI   EN PL    +LTV  +D+D+GVN+ +            +S+  +    +++  +       + D E        +   D G  +  +   ++I + D N+  P F+QS Y   V E+ P +  +LQ+ A D D     +  +  +T+      I+T  G IS  E  ++RE     +  V V D       ++  TV+ ++ + ND  P F+ + +   + E+  + + V +V A    E    V+ Y++L+   S    +D     + NG I    ++D E    +TL +  +D   P L     T+ V I + D NDN P  F  K  +A ++  S   +G  ++Q+ A D D+G N +++Y ++    E   A K+  V  T G + +   +     A YRL + A D G PP     V+ + VT
Sbjct: 2707 GRVRVIGRLDYEIRNRYVMIVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLD-SGSNGMVTYALVSKDKLVKEKFD-IDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDLNTELYYFILSGDP-------QARFGIERKTGVIFVHGSLDRESVGSYDLNISASD---GLFTSFAQMKIDIEDANDNPPICTQSIYV--EHIK--ENTPLGS-TVLTVGATDADVGVNAELT-----------YSVFGQGFGTFAVDKNGKMTNLVELDRETRPFYNFMVSAADIGGQACYSN--ISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGIISL-EKPLNRELKENYTLNVEVMDG-GTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVS-RESSNDVITYAILRGADSGLFSID-----RKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRS---TSYVRISVTDSNDNGP-EFSEKRYSAKVDENS--ALGTFVLQVFATDRDSGTNAQIKYSIA----EGNDAKKFKIVEET-GVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVT 3368          

HSP 3 Score: 134.42 bits (337), Expect = 1.408e-31
Identity = 147/560 (26.25%), Postives = 247/560 (44.11%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI-ESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD--PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRP-LIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDE-GGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKP 2343
            ++I D NDN P  +++     I E+  +G  +    A D D   VN    Y +  +   TF +  DK    +  ++L    D E +  Y   + A D     C + +I++H+ D NDN P F    Y  +V E  PL   +L VKA D D   N    Y  +       +   TF +   TG + L + LN +++  Y   V   D        +ATV + V + N+  P     +Y    H  + E+ P+    +   + S    N +I   +    DS  FS+  K+    +IH +++ DYE  ++  L ++  D G P L +T  + IS+ D N+  P F++  Y A V EN+   + +LQ+ A D D   NA +++      +    KI    G I  + + IDRE+++     V   D      + A   V  +++D NDN P F+ T  +  + E+ + N+ V  +   D D  G  A  Q++L+   +SR       F + +NG I   G++    D  + L + V D  H   +    ++T++I +   + P
Sbjct: 2951 IDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVG-VNAELTYSVFGQGFGTFAV--DKNGKMTNLVEL----DRETRPFYNFMVSAADIGGQACYS-NISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLV------TDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIY----HGNVSEDAPIGNEVVRVRAVSRESSNDVITYAILRGADSGLFSIDRKNG---TIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGD-IDREEVASYRLKVRAQDQ-GLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASR-------FKLHSNGLITKIGDVSHS-DGQYRLRVLVADNGHPPQS-TEVSITVKIAESKTHPP 3478          

HSP 4 Score: 133.265 bits (334), Expect = 2.944e-31
Identity = 164/605 (27.11%), Postives = 277/605 (45.79%), Query Frame = 1
Query:  925 IDYEIQTDYAMTLLACDPD---FCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLAT---VNVYVKDENNNRPLID----ILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLY---SIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYS---PAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFY-------LKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLAT--DPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTN-GAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL--MDARYRLTLEATDLGSPPMRTPIVLYVRVTG 2655
            +D+E+   Y +T+ A D +     TN  + +++ D ND  P F    Y   + E +P G +++ V A D D     S + Y+I       N Q+ F ++  +G +     L+ + + +Y   V A D   GG   ++T     V + DEN+N+P       ++    R  T       Q +A    +D D+G N+ +   +       KF + ++S +++   S+   + +D        L I   D G P LST+  + I ++  N+ S   P F    Y A ++E+    S +L I A D D        FD +T N           ID   G+I T  + +DRE+ S  S  V  TD  N    TA+V V   I D NDN P  A     E + ++  NS VG ++ T  DPD G    ++Y +++T    + E  +LF ++++ G I T   +D E      L I  +D   +       +V + + D ND+KP +  P   + + +V++  K G  I+++IA D D G N K++Y +   +       K   V+  +G V +  +L  +  +Y L +++TD G PP++T + + V+V G
Sbjct: 1062 LDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSGG--SLLRYTITKG----NEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASD---GGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVA----TDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGESYD--------LTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD--------FDQITYNIASGNHGNKFTIDRYGGFI-TVAHSLDREEKSFYSLRVEATDGYN----TASVPVTINILDVNDNSPQPARR---EYRAHVAENSDVGTLVTTVKDPDAGVNGEVEYCIVQTA---KAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDR-GIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEV-DVSA--KAGTAILRVIATDKDDGTNSKLKYSIVSGN-----TNKSLSVDQNSGVVKVAGRLSTLVHQYALKVQSTDGGEPPLKTQVDVKVKVRG 1617          

HSP 5 Score: 125.946 bits (315), Expect = 5.487e-29
Identity = 170/667 (25.49%), Postives = 287/667 (43.03%), Query Frame = 1
Query:  673 SINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPD----FCTNQSITVHVRDENDNL-PKFESG-VYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHY--HAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVK-FQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRT 2625
            S +V + ++D NDN P        + + E   +   +    A D D      + E+ L EST  F++ +     KS  ++L + +D+E ++ Y +T+   D      F   + +   +    ++L P F  G +   S+ E  P+G  +++ KA D D         + +   IID      F ++ DTG +     L+ ++   Y   V A+D E+        V + + D N+  P      P+  +  L EN P    +  +T  D D G  SL+   +    +   F +  +S  + ++   +  D E +    L +   D G+P +ST  T  + I DEN+  P F +  Y    + R+ T     + Q+ A DED   NA LR+       +    ID+ +G I T  +++D E  S    +V   + L K S +  V +   Q +  + N PVF  + +S +IQE+  +NS V  + A DPD      + Y++       +  +D     +  G I     +DRE    ++L +  TD      N  +  VTI I D NDN P    P       +V     VG ++  +  KD DAG NG+V+Y + +   + E A+  F + S +G +     L       + LT++A+D G P   T
Sbjct:  879 STHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEI-EFSLPESTRKFNIDS-----KSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQDS--------WYLKYAIIDGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPY---FAPSTYYPVLAENLPSGSSVVQVTAKDPDSG-GSLLRYTITKGNEQNNFVIDPQSGLITTL---RPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGE--SYDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD---FDQITYNIASGNHGNKFTID-----RYGGFITVAHSLDREEKSFYSLRVEATD----GYNTASVPVTINILDVNDNSP---QPARREYRAHVAENSDVGTLVTTV--KDPDAGVNGEVEYCI-VQTAKAESAS-LFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRET 1503          

HSP 6 Score: 125.561 bits (314), Expect = 7.194e-29
Identity = 165/673 (24.52%), Postives = 295/673 (43.83%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLL--ACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSI---DPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHI---TLLENQPLQEIAILTVS--DSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKN--ATLRFEFDNLTENFYLKIDTVNGWISTTENI-IDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDN--FTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            V +++IDRNDN+P F  +   + +      G  +    A D D  S N    Y LI     +      +  K+  + + + +D +++     TL+  A D  F T   + + V D+    P F+   ++  + E  P+G  + +V A    RS N + I YSI   DP        + F ++  TG + L   L+ + R +Y   V A D+    + D+A                D+    NR +   T+ E+ P+ + A++TV   D D G+N  I   ++       F  ++K   +  +  +K  DYE   V  + I   D G PSL+    + + ++D N+ +P F++S Y A +  +      + +I A D D+     LR+         + +ID+ +G I+ +  + I + K+  +   V V+D+++     +T  V+  I D ND+ P+F+E  +     EN    + V  V ATD D G  A L YS+    + R+  +D       +G + ++   DRE       ++ I  TD       +    V + + DENDN+PI+ + KN +  I+ +    +G  ++   A D DA +N  + Y +             F +N+ TG + +  +     Y   +   D G+P +R+  +  V++T
Sbjct: 2021 VHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGS-NANLRYDLIGGDPGYF----SISRKTGEVVVRRTLD-DVKVPRLFTLMVEATDGLFRTEAVVKIKVVDKE--TPVFDQLSFSKVLAEDTPIGSEVTSVTA----RSPNGAGILYSITGGDP-------VNQFSIDFKTGVVTLVSSLDYETRTKYKLVVRATDARTSSHSDVAVDVTVTDVN-------DVAPAFNRSLYLATISESTPV-DTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGV--VFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLD--VEVSDSVH----VSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRKFRID-----ADSGMLYSRLMFDRENSSQAIMSVPIRATDG---GGRFGFCVVEVHLIDENDNQPIFEL-KNYDTTISRSV--TMGTPVLMTSASDPDASSNAALTYVIV-----GHQTPPVFTINAATGVIQVSREPEVKSYNFFVLVKDGGNPLLRS--IASVKIT 2640          

HSP 7 Score: 120.553 bits (301), Expect = 2.181e-27
Identity = 142/559 (25.40%), Postives = 243/559 (43.47%), Query Frame = 1
Query: 1021 ENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHD--FGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDN-KPVFAETFSFE--IQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKV------GDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
             N + P F S   N+ + E+ P+   +    A D D+  N   +Y      I++ +V S F +N  TG+L +   L+ +    Y   + A D           +NV + D N+  P+ D    T   +TL EN  + Q +  +  SD D G N  I  ++    D      +N+   + S+      DYE++++  ++IQ  D    +  + +T  + +++LD N+ SP      ++  V+E+    + +  I A D D       EF          ID+ +G I   + + D E+ S  +  V VTD  +    T    V   +    ++  PVF+     E  I EN  V ++V    ATD D   +  L+Y+++         VD   +    GAI T GE+D E+ D++ L +   D       Y    V I I D ND  P +F P         T YP +      G  ++Q+ AKD D+G +  ++Y ++  + +N      F ++  +G +     L     + Y+LT+ A+D G+PP+ T +   V++T
Sbjct:  679 HNRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLY-----SIVEGDVDSVFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFD---KTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQI--VNDFGGKFRVNRISGVVSV--GDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVI-VTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRL-DFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILETSINENSPVGTVVISPKATDQD---SWYLKYAIIDGTG-----VDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYP-LYTNIPVLINIVDLNDEAP-YFAPS--------TYYPVLAENLPSGSSVVQVTAKDPDSGGS-LLRYTITKGNEQNN-----FVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKIT 1199          

HSP 8 Score: 120.168 bits (300), Expect = 3.416e-27
Identity = 159/671 (23.70%), Postives = 287/671 (42.77%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI--ESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTI----LTVKA---IDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHI-TLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFE-IQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQ---NQLMDARYRLTLEATDLGSPPMRTPIVLYVRV 2649
            V++ +ID NDN+P F   N    I  S  +G  + + +A D D SS N    Y ++  ++   F      +   +  +Q+++  + +    + +     +P   +  S+ + V + +  +  F    Y+V+V E   +G  +    L V     +D+D    +  I  + D       V ST R+       V+   L+ +IR +Y   +V  +      I    V V V D N+  P     + ++ ++ ++ EN  +  ++  +   D D G N ++   L  +KD       +  +    I +    D EK+     Q++  D G+  L++  T+   +LD N+  P F+QS + A V+E+      +  I A DED N  L +   +        I+   G I      +DRE +      +  +D L     T+   +K  I D NDN P+  ++   E I+EN  + S V  V ATD D G  A L YS+              F +  NG +    E+DRE    +  +++  D   +      +N++I + D NDN+P++     S+    V     +  +++Q+ A D D G N K+ Y L  +      A   F + + TG + ++   N+ +   Y L +E  D G+PP+ +   + ++V
Sbjct: 2535 VEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASS-NAALTYVIVGHQTPPVF-----TINAATGVIQVSREPEVKSYNFFVLVKDGGNPLLRSIASVKITVLERDARILHFGKSKYDVTVGENAEMGQIVTGLNLVVPGGNPVDVD----YRIIKGNNDNNDRKFGVDSTGRVR------VIGR-LDYEIRNRY-VMIVEANVSAINQIARTVVVVQVLDINDVTPK----FVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALV-SKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDLNTELYYFILSGDPQARFGIERKTGVI-FVHGSLDRESVGSYDLNISASDGL----FTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGF-------GTFAVDKNGKMTNLVELDRETRPFYNFMVSAAD---IGGQACYSNISIHLDDVNDNRPLF---SQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTD------AGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKV 3158          

HSP 9 Score: 111.309 bits (277), Expect = 1.484e-24
Identity = 160/671 (23.85%), Postives = 283/671 (42.18%), Query Frame = 1
Query:  706 NDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQST----FRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKS-RDLYSIH-------SSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLF-LMKTNGAIETKG--EIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR----YRLTLEATDLGSPPMRTPIVLYVRV 2649
            ND+KP+F     +  +  SAK G  +    A D D    N   +Y ++       L  D+    S  +++   +   +   YA+ + + D   P   T   + V VR    N   FE   Y VS+ E  P    I TV             +Y  I P    +  +S     F + R +G ++  +  +++       ++ A  ++  G      V V ++D+N+N+P+ +    T  H+T  E  P Q  A+L    S L     +A +   + D   + ++  S RD++SIH       ++K  DYE       +I+  D G+P LS    + I + D N+ +P F+ S YHA V   + A + +  + A D D  A L F         +  ++ + G ++ +   + R     I        T++  + TA   V+ +  +   +   F+ + +S  ++E + V+S +  V A          L Y +  T +        LF ++ + G +  +   ++DRE  D + +++   D+  +  N     V +++ D NDN+P++    NS   I +      G II Q  A D D G+N  ++Y L   DP       YF ++  TG V ++  L D +    + L +EATD      RT  V+ ++V
Sbjct: 1515 NDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKD-DGTNSKLKYSIVSGNTNKSLSVDQ---NSGVVKVAGRLSTLVH-QYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNF-AFEKPKYEVSLPENSPPDQAIATV-------------VYNGILPVYEIVPGRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTD--GQHSSTLVIVTIQDKNDNQPIFEHARITG-HVT--EGSP-QGTAVLDHKGSQL---VAVATDQDISGDKLTYEIVETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSAANLTFSLARQDTELF-AVNPLTGVVTVSNAALLRRDTYTIKL------TVSDGNHTAHARVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRA----------LGYPIGSTITYTIINPSELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDD-SVPPNVAQAAVHVQVIDRNDNQPVFI---NSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDP------GYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATD---GLFRTEAVVKIKV 2127          

HSP 10 Score: 110.538 bits (275), Expect = 2.682e-24
Identity = 163/657 (24.81%), Postives = 277/657 (42.16%), Query Frame = 1
Query:  748 FIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFY---LQLNKFIDYEIQTDYAMTLLACDPDF---CTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVN----VYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLI-ACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCM-LQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDS-KTATVTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRE--LDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL--MDARYRLTLEATD-LGSPPMRTPIVLYVRVTG 2655
            FIPE   IG   P++  +     S N V ++ +I          D  ++  F    ++ +K ++ E    Y + ++  D           + + V D NDN P F    Y  ++ E IP+  +I  ++A+D D   N   IYYS   K       ++F +N  +G + + + L++  RI +   VVA+D     +   ++ N    V V+  N   P   +     +   + E       A L + D D G N  I   E+        FS+ +   D Y++   K  D E       + +  +D G+P  + +  L +++LDEN+ +P FNQS Y   + E  P  +P+L++ A D+D   N  + +      E    +I++  G I T  + +D E        V   D +   S K +TV V   I D ND+ P F A  +  ++ E++   + V  V A D D GG   ++YSL     +  + V    +    G I T   +DR+  L +   L +  +D          T V +R+++ NDN P+    K     I V     VG +I  + A D+D  +  +   Y S          K F ++  TG +     L  +   + L ++ATD +   P   P++L + + G
Sbjct:    4 FIPEITPIG--TPVKCDLKMGVYSKNHV-DFIIISGNEQGMFSVDSRQVSDFNFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPN-GLIYYSFKEKT------TSFAINPISGVVSVAQKLSNSARI-HRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSV---KTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKSSPND-YAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGD-LDYESRQRFDLTVAALDGVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSL-----ANLRPVP-FEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVL---KQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTG----KAFSLDPKTGELRTARSLRGLQREFTLIIKATDGIQESPDTHPVILKISIVG 631          

HSP 11 Score: 93.2041 bits (230), Expect = 5.426e-19
Identity = 142/659 (21.55%), Postives = 275/659 (41.73%), Query Frame = 1
Query:  706 NDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRL--IESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI-DILYPTNRHITLLENQPLQE-IAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDRE-KISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAV-LQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLA--DNYVTTNVTIRIRDENDNKPIWF-------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGS 2610
            ND  P F+++     I ES  +   +    A+D D S +N+   Y +  +     F  K DK   KS  + + K +DYE +  + M ++A D   P       + V + D NDN P+F+  +Y  S+  +   G  +  + A D D   +   + YS    I     +  F+++  +G + L+  +  K    Y   V   DS    ++  + V V + D N++ P+  + +Y     ++  EN P    + +++ +D D G  + +   +       KF +   S  LY   S   FD E     ++ +               + + ++DEN+  P F   +Y   +  +    +P+L  +A D D   NA L +            I+   G I      + RE ++   +  V V D  N   ++   +VK  + + +     F ++ +   + EN  +  +V  +    P  GG  V + Y ++K  +      D  F + + G +   G +D E+ + + +++    E +++  +    T V +++ D ND  P +        IP+N +          +G  ++++ A+D+D+G+NG V Y L   D   ++  + F ++  TG++  +  L       +   + ATD G+
Sbjct: 2230 NDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGD-SGINKEINYFIQNVSRVGAF-FKIDK---KSGVVFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEG-DAKKLRYS----ITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDSV---HVSTSKVRVIIGDTNDHSPIFSEDVY----KVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRKFRIDADSGMLY---SRLMFDRENSSQAIMSVPIRATDGGGRFGFCVVEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVFTINAATGVIQ-----VSREPEVKSYNFFVLVKDGGNPLLRS-IASVKITVLERDARILHFGKSKYDVTVGENAEMGQIVTGLNLVVP--GGNPVDVDYRIIKGNNDNN---DRKFGVDSTGRVRVIGRLDYEIRNRYVMIV----EANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENID----------IGSKVLRVFAEDLDSGSNGMVTYALVSKD---KLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGT 2840          

HSP 12 Score: 84.3445 bits (207), Expect = 2.662e-16
Identity = 157/687 (22.85%), Postives = 282/687 (41.05%), Query Frame = 1
Query:  667 SDSINVDLEIIDRNDNKPQFSKTN--LKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDEND---NLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNR--HITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWS---SRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAV--TDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIII-----QLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            S  +   ++I D NDN+P+F +    + +F  ++    F L    A D D  S N    Y + +       + +K  + S   ++   +       Y +T++A D   P   T+ ++ + V   N    N P F +  Y+  ++E   +   +L + A D D    F  I Y+I       N  + F ++R  G + +   L+ + +  Y+ +V A D  N  ++ + T+N+   D N+N P      P  R     + EN  +  + + TV D D GVN  +   +  T  +   SL         I + K  DYE  Q  +L I+  D G P   T  ++ +S+ D N++ P F    + + V  +  A + IL++ A D+D   N+ L++   +   N  L +D  +G +     +     + + +  V  TD      KT  V VK ++     N       +   + EN            + PD+  A V+   +L  +     R     +  + + +G I +K   D E   +  L I    TD  H      +T V + I+D+NDN+PI+   +++    +VT     G  ++     QL+A   D   +G    Y  +     +V    F ++  TG +     L   +  +Y   ++ TD G+P +     + + VT
Sbjct: 1189 STDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGS-NADLRYSITKGN-----RDNKFIIDSRSGEIFTNVSLVDGESYDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD----FDQITYNIASG----NHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATDGYNTASVPV-TINIL--DVNDNSP-----QPARREYRAHVAENSDVGTL-VTTVKDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGRL--STLVHQYALKVQSTDGGEPPLKTQ-VDVKVKVRGIVKNFAFEKPKYEVSLPEN------------SPPDQAIATVVYNGILPVYEIVPGRSPCWRDFTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTDGQH-----SSTLVIVTIQDKNDNQPIF---EHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDV----FSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVT 1825          

HSP 13 Score: 82.4185 bits (202), Expect = 1.010e-15
Identity = 146/687 (21.25%), Postives = 264/687 (38.43%), Query Frame = 1
Query:  655 TDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYL-------PLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS-------TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSS------KQFDYEKEQVCMLQ--IQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFF-VNSTTGYVYIQNQL-MDAR--YRLTLEATDLGSPPM 2619
            TD    S  V + I D+NDN+P F    +   + E +  G  +        +  A D D S     +E     + + F +        +  +   K +DYE+   YA  +   D   P       + +HV D ND  P F +  Y+ +V      G  +  V A D D + N +       T  ++++P    + V +   L RDT                Y  ++   D  +       T +  V+    N P  D+ +    +   +      +  ++TV      + S I            ++++N S   + + S+        FD ++E +   Q  +Q  D   P       +++ ++D N+  P F  S Y   ++      + I Q  A D D   NA LR++     +  Y  I    G +     + D +     + +V  TD L +        VK ++ D+    PVF + +FS  + E+  + S V  V A  P+  GA +L YS+       Q  +D     KT G +     +D E    + L++  TD      ++    V + + D ND  P +     S  +  ++    V   ++ + A D D+G N ++ Y++     +N      FF ++  +G V++   L  ++R  + + + A D G P +
Sbjct: 1700 TDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHP-----ATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSAANLTFSLARQDTELFAVNPLTGVVTVSNAALLRRDT----------------YTIKLTVSDGNH-------TAHARVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRALGYPIGSTIT-----------YTIINPSELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIG-GDPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDGLFR----TEAVVKIKVVDK--ETPVFDQLSFSKVLAEDTPIGSEVTSVTARSPN--GAGIL-YSITGGDPVNQFSID----FKT-GVVTLVSSLDYETRTKYKLVVRATDA--RTSSHSDVAVDVTVTDVNDVAPAF---NRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFI-----QNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPSL 2322          

HSP 14 Score: 76.6406 bits (187), Expect = 5.234e-14
Identity = 178/770 (23.12%), Postives = 301/770 (39.09%), Query Frame = 1
Query:  556 ERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD-------PDFCTNQSITVHVRDENDNLPKF--ESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDP-KIIDLNVQSTFRLNRDTGDL---VLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHIT-LLENQPLQEIAI-LTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLS---TTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAA--FDEDKNATLRFEFDNLTE-NFYLKIDTVNGWISTTENIIDREKISE-ISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAE-TFSFEIQENIIVNSLVGQVLATDPD-EGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD---------------------EPHLADNYVTTNV--------TIRIRDENDN----KPIWF-----------IPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            +RL+ E++ S +      +N +V+      +K T    D   V++ + D NDN+P F K      IPE   +   +    AVD D    N +  Y   E T +F +        S  + + + +    +  + +T++A D       P    N  + V+V+  N   P+F  ++ + NVS   +   G    T+  ID D+  N       ID  +I   N+   F +     D    V+           YN  + A D           + V V DEN+N P  +     +R+IT L E  P+    + +  +D D G N  I   +    +  KF + +K+  +Y   +    DYE  Q   L +   D G P  S   +T  + ++ILD N++ P F    Y   + E+    + +  ++A   D   N  +R+   NL    F ++ DT  G I TT N+     + E I+  V  +D      +     VK ++ + NDN PV  +   +  +  N  V  L+  V A D D       L Y    T+ +  K      L    G + T   + R L   FTL+I  TD                     +     N+V+T           ++I+ E  +    +P+ F           + ++ +  I+++    +  ++ Q +A D D G NG V Y +   D ++      F +N  TG + +   L     + Y L + A D G        +L V++T
Sbjct:   61 KRLNRESVASYE------LNVVVQ------DKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGP-NGLIYYSFKEKTTSFAINP-----ISGVVSVAQKLSNSARI-HRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSEGTS---GIVYATLGIIDKDKGSNG-----DIDRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFN----QSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIY---TKGDLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDT--GIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYK--STFGNTGKA---FSLDPKTGELRTARSL-RGLQREFTLIIKATDGIQESPDTHPVILKISIVGGRQARKLQNHVSTKCVDSPLYAKALKIKQEQKSYSSLQPLIFATAKLHNRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDS-----VFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKIT 782          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO33360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF3])

HSP 1 Score: 171.014 bits (432), Expect = 1.169e-45
Identity = 141/473 (29.81%), Postives = 233/473 (49.26%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLL---ACDPDFCTNQS--ITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTK--TLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED---KNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTA-TVTVKFQISDENDNKPVF-AETFSFEIQENIIVNS 2067
            + I+D NDN+P+F +   K+ I E  +    +    A D D S +N    Y ++ +T+      D     +  L+ ++ +D E  T+Y +T+    + DP     Q   +++ V DENDN+P F+  VY+VS+ E I +G  IL + A D D   N    Y+     + D  V   F +N  TG + + + ++ + R  Y+F+V A D         ++V + + D N+NRP      PT  ++ L+EN  +   +  LT SD D  +N  +   +       KFS+    ++   + ++K  DYE      L IQ  D G P L++++   L++S+++ N+ SP F+Q  Y A + ENT     IL++ A D D    ++ L +   N T N    +D   G + T++  +DRE ++E +  + V D+ +     A T TV   + DENDN PVF  E +S  I ENI V +
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDAD-SGMNAKLVYSILNTTSNGTFTVDP---HTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYF-----LKDAIVSKRFSMNDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPY---FLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGKFSI---DQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHVILRVQATDRDHVNSSSILVYSILNTTSNGTFTVDPHTGVLRTSQR-LDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFDQEVYSVSIPENITVGA 457          

HSP 2 Score: 131.339 bits (329), Expect = 2.838e-32
Identity = 130/459 (28.32%), Postives = 217/459 (47.28%), Query Frame = 1
Query: 1006 VHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENG--GNIDLATVNVYVKDENNNRPLIDI-LYPTNRHITLLENQPL-QEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLK--IDTVNGWISTTENIIDREKISEISKVVYVTDTLNKD-SKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDE-GGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW 2349
            + + D NDN PKF      + + E       ILT++A D D   N   +Y      I++     TF ++  TG L  ++ L+ +   +Y   +   DS +        A V++ V DEN+N P+ D  +Y     +++ EN  +   I +L   D D GVN+ I   LK    S +FS+ + +     I   +  DYE+      ++   D G   L+ + ++ I+I+D N+  P F  + Y+  + EN    + + Q+ A D D +   +  F  L  N   K  ID   G ++T +++ D E ++E + V+  TD  +   + +    +   + + NDN PVF++  +S  I EN  V  ++ +V ATD D    +++L YS+L T S+    VD        G + T   +DRE    +TL I V D  +P L +   T  V+I + DENDN P++
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVY-----SILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVFDQEVY----SVSIPENITVGAHILLLNARDKDEGVNAEIRYFLKDAIVSKRFSMNDTTG---QITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGKFSIDQNTGVVTTNKSL-DYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHVILRVQATDRDHVNSSSILVYSILNTTSNGTFTVD-----PHTGVLRTSQRLDRETVTEYTLTITVHDSGDPML-NAAQTATVSITVLDENDNVPVF 440          

HSP 3 Score: 112.464 bits (280), Expect = 4.558e-26
Identity = 104/340 (30.59%), Postives = 167/340 (49.12%), Query Frame = 1
Query: 1666 ISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTAT-VTVKFQISDENDNKPVF-AETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRT--PIVLYVRV 2649
            ISILD N+  P F Q +    + E T   + IL + A D D   NA L +   N T N    +D   G + T++ + DRE ++E +  + V D+ +     A    V   + DENDN PVF  E +S  I ENI V + +  + A D DEG  A ++Y L     S++  +++     T G I  K  +D E   +++  +  +D  E  L     +++V I I D NDN+P +F+P  +   + +     +G  + QL A D+D+  NGKV + +   + + +     F ++  TG V   N+ +D      Y L ++ATD G PP+ +  P +L+V V
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSILNTTSNGTFTVDPHTGVLRTSQRL-DRETVTEYTLTITVHDSGDPMLNAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKDEGVNAEIRYFLKDAIVSKRFSMND-----TTGQITIKQAVDYEERSSYSFEVFASDGGEARLTG---SSSVRITIIDVNDNRP-YFLP--TRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLFSILEGNSDGK-----FSIDQNTG-VVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSV 322          

HSP 4 Score: 95.1301 bits (235), Expect = 2.052e-20
Identity = 97/377 (25.73%), Postives = 175/377 (46.42%), Query Frame = 1
Query:  682 VDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQD-------SENGGNIDLATVNVYVKDENNNRPLID-ILYPTNRHITLLENQPLQEIAILTVSDSD---LGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSL--STTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPIL 1764
            V + ++D NDN P F +    + IPE+  +G ++ L  A D D   VN    Y L ++  +   K   +   +  + + + +DYE ++ Y+  + A D        + S+ + + D NDN P F    Y V + E + +G T+  + A DLD S N   ++      I++ N    F ++++TG +  N+ L+ +   +Y   + A D       S   G + ++ VN+     N+N P+    +Y      ++ EN  +  + IL V  +D   +  +S++   +  T  +  F++   +  L    +S++ D E      L I  HD G P L  + T T++I++LDEN+  P F+Q  Y   + EN    + IL
Sbjct:  106 VSITVLDENDNVPVFDQEVYSVSIPENITVGAHILLLNARDKD-EGVNAEIRYFLKDAIVS---KRFSMNDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLDSSLNGKVLF-----SILEGNSDGKFSIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNI-----NDNSPVFSQKIYSA----SIDENTTVGHV-ILRVQATDRDHVNSSSILVYSILNTTSNGTFTVDPHTGVL---RTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFDQEVYSVSIPENITVGAHIL 460          

HSP 5 Score: 86.6557 bits (213), Expect = 1.074e-17
Identity = 73/242 (30.17%), Postives = 119/242 (49.17%), Query Frame = 1
Query:  673 SINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLAC---DPDFCTNQSITVHVR--DENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENG--GNIDLATVNVYVKDENNNRPLID 1377
            S +V + IID NDN+P F  T   + + E+  IG  +    A D D SS+N    + ++E  +      D+    +  +  NK +DYE  T+Y + + A    DP   ++Q   +HV   + NDN P F   +Y+ S+ E   +G+ IL V+A D D   + S + YS    I++     TF ++  TG L  ++ L+ +   +Y   +   DS +        ATV++ V DEN+N P+ D
Sbjct:  208 SSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTTVTQLTASDLD-SSLNGKVLFSILEGNSDGKFSIDQ---NTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKIYSASIDENTTVGHVILRVQATDRDHVNSSSILVYS----ILNTTSNGTFTVDPHTGVLRTSQRLDRETVTEYTLTITVHDSGDPMLNAAQTATVSITVLDENDNVPVFD 441          

HSP 6 Score: 75.0998 bits (183), Expect = 6.080e-14
Identity = 76/250 (30.40%), Postives = 120/250 (48.00%), Query Frame = 1
Query: 1981 FQISDENDNKPVFAETFS-FEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIW-------FIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMD----ARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVV 2688
              I D NDN+P F + ++  EI E    ++++  + ATD D G  A L YS+L T S+    VD        G + T   +DRE    +TL I V D  +P L +      V+I + DENDN P++        IP+N            VG  I+ L A+D D G N +++Y+L     ++ + +K F +N TTG + I+ Q +D    + Y   + A+D G            R+TG  S +++I ++
Sbjct:    1 ISILDINDNRPKFPQPYNKIEITEGTRESTMILTLQATDADSGMNAKLVYSILNTTSNGTFTVD-----PHTGVLRTSQRLDRETVTEYTLTITVHDSGDPML-NAAQPAIVSITVLDENDNVPVFDQEVYSVSIPENI----------TVGAHILLLNARDKDEGVNAEIRYFL-----KDAIVSKRFSMNDTTGQITIK-QAVDYEERSSYSFEVFASDGGE----------ARLTG--SSSVRITII 216          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 212.616 bits (540), Expect = 5.794e-56
Identity = 197/712 (27.67%), Postives = 330/712 (46.35%), Query Frame = 1
Query:  553 HERLDLETICS---TKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYP---TNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFD-NLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN--SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATK--YFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            + R+D E +CS   T++ C   I   V     L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++S   F L   +      + QL   + +D E +  + M +   D   P   +   + V + D NDN P F+     VSV E  P G ++  + A D D   N + I+++   +I   + +  F +N  TG + + + L+ ++   +   V+A D   G     ATV V V D N+N P ID  Y     N  + L EN PL  +IA++TV+D D  +   +AC    T     F L     D + + ++   DYE  +   ++I   D G+P L+T+  + I I DEN+ +P F Q      + EN    + +++I+A D D   NA + +    +  + F+  ID  +G +S  + + DREK    S +V   D        + VTV+  + D NDN P F    ++F + EN+ +   VG +  TD D G  A +  S+L          DN  +    G I+     DRE   ++T ++   D  +P  +       VTI + D NDN+P++ IP +  S  ++  T+ P  G ++ ++ A D D G N ++QY +  +       +    F ++  +G + +Q +++ A    +RL ++  DLG P
Sbjct:   88 NHRIDREKLCSGVFTEKRCYYEIEVAV-----LPDEIFRL----VKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVG-INGIQNYELVKSVTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSN-AQIHFAFSNQI-SSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDG--GSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFH--IDRRSGILSVGKRL-DREKQERFSFIVIARDN-GSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGK-------DNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSS---YAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTP--GAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQP 766          

HSP 2 Score: 103.605 bits (257), Expect = 6.689e-22
Identity = 117/459 (25.49%), Postives = 200/459 (43.57%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSL----LNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNL---TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI---AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRT 2625
            L  +   ++D N+N PL      T  +I++ EN  +     + +  D D+G+N +   EL   K   +F L      +      +   +  D EK    +++I+  D G+P  S+T  L ++I D N+  P F  S     V EN P  + + Q+ A D D   NA + F F N    +   +  I++  G I T +  +DRE ++ + K++ +          ATV V   ++D NDN P     +       +  + EN  +N+ +  +  TD D      +          R K V ++ FL+      ET   +D E    + + I  +D      N  +  V I+I+DENDN PI+  P+   +I      P+  D   QLI   A D D+G+N ++ Y L  + P+       F ++  +G + +  +L      R+   + A D GS P+++
Sbjct:  122 LVKIRFLIEDVNDNAPL---FQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYEL--VKSVTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLI-TVKQPLDRE-VTPVHKLIVLASDGGSTPSRATVIV--NVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFNDQFLL------ETAAPLDYETTREYAIKIVASDRGTPPLN-TSAMVLIKIKDENDNAPIFPQPEIQLSI------PENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDG------FHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQS 552          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 212.231 bits (539), Expect = 9.937e-56
Identity = 198/712 (27.81%), Postives = 332/712 (46.63%), Query Frame = 1
Query:  553 HERLDLETICS---TKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQL--NKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYP---TNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFD-NLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKN--SNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATK--YFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSP 2613
            + R+D E +CS   T++ C   I   V     L ++I  +    + +   I D NDN P F  T + + IPE+  I    P+ +A D D   +N +  Y L++S   F L   +      + QL   + +D E +  + M +   D   P   +   + V + D NDN P F+     VSV E  P G ++  + A D D   N + I+++   +I   + +  F +N  TG + + + L+ ++   +   V+A D   G     ATV V V D N+N P ID  Y     N  + L EN PL  +IA++TV+D D  +   +AC    T     F L     D + + ++   DYE  +   ++I   D G+P L+T+  + I I DEN+ +P F Q      + EN    + +++I+A D D   NA + +    +  + F+  ID  +G +S  + + DREK    S +V   D        + VTV+  + D NDN P F    ++F + EN+ +   VG +  TD D G  A +  S+L          DN  +    G I+     DRE   ++T ++   D  +P  + +Y    VTI + D NDN+P++ IP +  S  ++  T+ P  G ++ ++ A D D G N ++QY +  +       +    F ++  +G + +Q +++ A    +RL ++  DLG P
Sbjct:   88 NHRIDREKLCSGVFTEKRCYYEIEVAV-----LPDEIFRL----VKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVG-INGIQNYELVKSVTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSN-AQIHFAFSNQI-SSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDG--GSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACY---TDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFPQPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFH--IDRRSGILSVGKRL-DREKQERFSFIVIARDN-GSTPLQSNVTVRLIVQDLNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGK-------DNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTS-SYA--KVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTP--GAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQP 766          

HSP 2 Score: 102.834 bits (255), Expect = 1.014e-21
Identity = 117/459 (25.49%), Postives = 200/459 (43.57%), Query Frame = 1
Query: 1321 LATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQ-EIAILTVSDSDLGVNSLIACELKPTKDSAKFSL----LNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDED--KNATLRFEFDNL---TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-------SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEV-DNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI---AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQL---MDARYRLTLEATDLGSPPMRT 2625
            L  +   ++D N+N PL      T  +I++ EN  +     + +  D D+G+N +   EL   K   +F L      +      +   +  D EK    +++I+  D G+P  S+T  L ++I D N+  P F  S     V EN P  + + Q+ A D D   NA + F F N    +   +  I++  G I T +  +DRE ++ + K++ +          ATV V   ++D NDN P     +       +  + EN  +N+ +  +  TD D      +          R K V ++ FL+      ET   +D E    + + I  +D      N  +  V I+I+DENDN PI+  P+   +I      P+  D   QLI   A D D+G+N ++ Y L  + P+       F ++  +G + +  +L      R+   + A D GS P+++
Sbjct:  122 LVKIRFLIEDVNDNAPL---FQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYEL--VKSVTEFGLDIIETPEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLI-TVKQPLDRE-VTPVHKLIVLASDGGSTPSRATVIVN--VTDVNDNVPAIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHDVPFRLKPVFNDQFLL------ETAAPLDYETTREYAIKIVASDRGTPPLN-TSAMVLIKIKDENDNAPIFPQPEIQLSI------PENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDG------FHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQS 552          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 207.223 bits (526), Expect = 4.301e-54
Identity = 196/700 (28.00%), Postives = 316/700 (45.14%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEI-------------QTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDN--LFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSPPMRTPIVLYVRV 2649
            +E++D NDN PQFS   L L IPE+   G    +  AVD D S  N V EY L    +   L         F LQ+ + +D +I             +  Y + +   D   P   ++  + + V D+NDN PKFE   Y   + E  P G+++L V+A D D   N   I YS+        VQ   R++R TG + +   ++ +      F VVA+D         A V + +KD+N+N P I+I     R I L+          E+ P+   +A++ VSD D G N+++ C        +L+P  +SA     N  +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ +P+F+ +       E+      ++ + A D D   NA L +     +     +I++  G I    N +DRE +      V   D     SKT T  V   + D NDN P F    +SF + EN+   + VG V  +D D+G  +  Q +L         E DN    +    G I +    DRE +  +T  +   D  +P  + +YV   VTI + DENDN P    P NS+      S P   D  ++++ A+D+DAG N ++ Y ++  +P        F ++  +G + +           +RL +  +D G PP  T  +++V V
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRD-SGSNGVAEYALSAGPDANQL---------FGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGAN-GDIDYSL--HQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEI-----RGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESA-----NDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIR-VRNQLDREDVERYEFGVAAADK-GVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENS--QVTLF-------VEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRS-SYV--GVTINVLDENDNAPYVTKPANSSYTHLKPSSPP--DTPVEVVKAEDIDAGVNAELYYTITGGNPHG-----LFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          

HSP 2 Score: 128.642 bits (322), Expect = 1.462e-29
Identity = 124/485 (25.57%), Postives = 213/485 (43.92%), Query Frame = 1
Query:  619 IVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLF--------IPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLK----TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-PLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSP----AFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDN 2007
            ++K Y+  +++  +  S    V + I D+NDN P      + L         I E   IG  + L    D D      V    ++     F L+    +   + + ++LQ    +DYE   DY + ++A D   P   +  S+ V V D NDN P F   +  V+  E    G  ++ V A D D   N   +Y      II+ +  S F +N +TG++ +   L+ +   +Y F V A D         A V + V+D N+N P   +   +    ++ EN  PL  + ++TVSD+D G NS +   ++P  D+ KF + N +    +I SS  FD EKE     +++  D G P  S+   + I++LDEN+ +P      N S+ H  ++ ++P  +P+  + A D D   NA L +       +   +I   +G I   +    + K   + ++V       K  +  T  V   +++  +N
Sbjct:  335 LLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVV--TCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVY-----SIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFML---SGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEP--DNGKFIIQNGTG---TILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTH--LKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHK--GLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 74.3294 bits (181), Expect = 5.515e-13
Identity = 93/353 (26.35%), Postives = 152/353 (43.06%), Query Frame = 1
Query: 1666 ISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF-----DNLTENFYLKI-DTVNGWISTTENI--IDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPK-----NSNAIINVTSYPKVGDIIIQLIAKDVDAGNN--------GKVQYYL-SLNDPENEVATKYFFVNSTT-GYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            I +LD N+ +P F+       + ENT   +      A D D  +    E+      +  + F L++ + V+  I     I  +DREK       + V D   K  + ++  ++  ++D+NDN P F +  +  E+ EN      V QV A D D G    + YSL +   + Q+    L + ++ G I  KG +DRE +DN      V  +           VTI I+D+NDN P   I       + N + N++    +G  +  +   D D G N        G V + L   ++  N+   KYF   +T   Y  I++      YR+ + A D G+P + +   L V+VT
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDG-GKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRL---LRIDRSTGIIYVKGLVDRE-EDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKD------YRIEIVAVDSGNPALSSTNSLKVQVT 480          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 206.453 bits (524), Expect = 4.781e-54
Identity = 196/700 (28.00%), Postives = 316/700 (45.14%), Query Frame = 1
Query:  688 LEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEI-------------QTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDN--LFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLI-AKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR---YRLTLEATDLGSPPMRTPIVLYVRV 2649
            +E++D NDN PQFS   L L IPE+   G    +  AVD D S  N V EY L    +   L         F LQ+ + +D +I             +  Y + +   D   P   ++  + + V D+NDN PKFE   Y   + E  P G+++L V+A D D   N   I YS+        VQ   R++R TG + +   ++ +      F VVA+D         A V + +KD+N+N P I+I     R I L+          E+ P+   +A++ VSD D G N+++ C        +L+P  +SA     N  +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ +P+F+ +       E+      ++ + A D D   NA L +     +     +I++  G I    N +DRE +      V   D     SKT T  V   + D NDN P F    +SF + EN+   + VG V  +D D+G  +  Q +L         E DN    +    G I +    DRE +  +T  +   D  +P  + +YV   VTI + DENDN P    P NS+      S P   D  ++++ A+D+DAG N ++ Y ++  +P        F ++  +G + +           +RL +  +D G PP  T  +++V V
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRD-SGSNGVAEYALSAGPDANQL---------FGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGAN-GDIDYSL--HQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEI-----RGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESA-----NDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIR-VRNQLDREDVERYEFGVAAADK-GVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENS--QVTLF-------VEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRS-SYV--GVTINVLDENDNAPYVTKPANSSYTHLKPSSPP--DTPVEVVKAEDIDAGVNAELYYTITGGNPHG-----LFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          

HSP 2 Score: 128.257 bits (321), Expect = 1.612e-29
Identity = 122/483 (25.26%), Postives = 212/483 (43.89%), Query Frame = 1
Query:  619 IVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLF--------IPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLK----TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQ-PLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAY--VRENTPARSPILQIAAFDEDK--NATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDN 2007
            ++K Y+  +++  +  S    V + I D+NDN P      + L         I E   IG  + L    D D      V    ++     F L+    +   + + ++LQ    +DYE   DY + ++A D   P   +  S+ V V D NDN P F   +  V+  E    G  ++ V A D D   N   +Y      II+ +  S F +N +TG++ +   L+ +   +Y F V A D         A V + V+D N+N P   +   +    ++ EN  PL  + ++TVSD+D G NS +   ++P  D+ KF + N +    +I SS  FD EKE     +++  D G P  S+   + I++LDEN+ +P   +    +Y  ++ ++P  +P+  + A D D   NA L +       +   +I   +G I   +    + K   + ++V       K  +  T  V   +++  +N
Sbjct:  335 LLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVV--TCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVY-----SIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFML---SGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEP--DNGKFIIQNGTG---TILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHK--GLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 74.3294 bits (181), Expect = 5.490e-13
Identity = 93/353 (26.35%), Postives = 152/353 (43.06%), Query Frame = 1
Query: 1666 ISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEF-----DNLTENFYLKI-DTVNGWISTTENI--IDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAET-FSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPK-----NSNAIINVTSYPKVGDIIIQLIAKDVDAGNN--------GKVQYYL-SLNDPENEVATKYFFVNSTT-GYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVT 2652
            I +LD N+ +P F+       + ENT   +      A D D  +    E+      +  + F L++ + V+  I     I  +DREK       + V D   K  + ++  ++  ++D+NDN P F +  +  E+ EN      V QV A D D G    + YSL +   + Q+    L + ++ G I  KG +DRE +DN      V  +           VTI I+D+NDN P   I       + N + N++    +G  +  +   D D G N        G V + L   ++  N+   KYF   +T   Y  I++      YR+ + A D G+P + +   L V+VT
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDG-GKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRL---LRIDRSTGIIYVKGLVDRE-EDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKD------YRIEIVAVDSGNPALSSTNSLKVQVT 480          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 203.371 bits (516), Expect = 3.617e-53
Identity = 203/756 (26.85%), Postives = 348/756 (46.03%), Query Frame = 1
Query:  562 LDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLI---ESTNTFHLK-TDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACD---PDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFS---TIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLL----------ENQPLQ-EIAILTVSDSDLGVNSLIAC--------ELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHA-YVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLK----IDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTD--EPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSN--AIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLM---DARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIA 2703
            +D ET+   + +  G   C ++  + + + + +     I   +E+ D NDN PQF  + L + +PE+  +G    +  A D D S  N V +Y L    ++   F L+  D    K   L +   +D E++  Y +T+ A D   P   +   + V V D NDN PKFE   Y   V E  P+G+++L VKA D D   N     +++ ++DP      V    R++R TG + +   L+ +     +F VVA+D           V + V D+N+N P ++I     R I L+          E+ P+   +A++ VSD D G N+++ C        +L+P  DS      NK +  Y + ++   DYE+ +   ++I   D G+P+LS+T +L + + D N+ SP F+ + +   +  EN P  + IL + A D D        F N+  + Y+K    ID   G +      +DRE        V   D  +   K  T TV  ++ D NDN P F    +SF + EN+   S VG V   D D+G  A +  S+       + +     +    G I +    DRE + ++T  +   D  EP  + +YV   VTI + DENDN P+   P NS+   +  V S     D++    A+D+D+G N  + + ++  +P      + F ++ ++G + +  ++       +RL +  +D G PP     ++++ V   IS    +++V +++ 
Sbjct:   79 IDRETLRDCRSLVKGK-PCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP------VPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEI-----RGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSD---NKRK--YFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGET-ILDVTATDADSGTNAEL-FYNIVGDSYIKGLFEIDPNTGEVK-ARTPLDREHKERYEFRVTAADKGSPVHK-GTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSV-------EPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRS-SYV--GVTINVLDENDNDPVVTKPSNSSFRQLSPVASPDSHVDVV---EAEDLDSGPNADLVFSIAGGNP-----YQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISN---VSLVEALVG 791          

HSP 2 Score: 80.4925 bits (197), Expect = 7.061e-15
Identity = 75/266 (28.20%), Postives = 114/266 (42.86%), Query Frame = 1
Query: 1837 YLKIDTVNGWISTTENIIDREKISEISKVVY-----------VTDTLNKDSKTATVTVKFQISDENDNKPVFA-ETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSL-----------LKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLN-DPENEVATKYFFVNSTTGYVYIQNQL 2562
            YL++D   G I TTE  IDRE + +   +V            VTD L   S    +  + ++ D NDN P F     +  + EN I+ +L    LATD D     V  Y+L           L+    R  ++  L ++         G +DREL D++ L I   D  +    Y    + + + D NDN P +  P        V+    VG  ++Q+ A D D G NG+++Y L    DP      K   ++ TTG +Y++  L
Sbjct:   62 YLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPR-LIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVL---------GNLDRELKDSYDLTIKAVDGGN-PQRYSQALLRVVVTDANDNSPKFEHPSYE---AEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP----VPKLLRIDRTTGIIYVKGPL 309          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000020691.1 (SMESG000020691.1)

HSP 1 Score: 1983.76 bits (5138), Expect = 0.000e+0
Identity = 978/986 (99.19%), Postives = 984/986 (99.80%), Query Frame = 1
Query:  325 MGFILLTVLLAIISKLDLVYQTDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYSASPFIQTGMYPHSCFSLPENSVISQISDDMLIGNSYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLY 3282
            MGF+LLTVLLAIISKLDLVYQTDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDEND+LPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNR+TGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSL NKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQI AFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKD+KTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLG+PPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGIISIFLIIAIICVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYSASPF+QTGMYPHSCFSLPENSVISQISDDMLIGNSYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLY
Sbjct:    1 MGFVLLTVLLAIISKLDLVYQTDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDHLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRNTGDLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLQNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQITAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDAKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGNPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGIISIFLIIAIICVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYSASPFMQTGMYPHSCFSLPENSVISQISDDMLIGNSYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLY 986          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000020691.1 (SMESG000020691.1)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 365/367 (99.46%), Postives = 367/367 (100.00%), Query Frame = 1
Query: 2182 MKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYSASPFIQTGMYPHSCFSLPENSVISQISDDMLIGNSYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLY 3282
            MKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLG+PPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGIISIFLIIAIICVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYSASPF+QTGMYPHSCFSLPENSVISQISDDMLIGNSYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLY
Sbjct:    1 MKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGNPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGIISIFLIIAIICVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYSASPFMQTGMYPHSCFSLPENSVISQISDDMLIGNSYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLY 367          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000079318.1 (SMESG000079318.1)

HSP 1 Score: 471.085 bits (1211), Expect = 1.828e-147
Identity = 336/979 (34.32%), Postives = 533/979 (54.44%), Query Frame = 1
Query:  346 VLLAIISKLDLVYQTDISINVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSEN-GGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAF-NQSHY-HAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETF-SFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSR-QKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTT--NVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYL-------SLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLTL----------IGSDNP--NNTLQTSMLSP--------------CQRHINEYLDADSGDSGNGPSEEGISSHYL-NDGKVF------LRSMNQPTINYSASPFIQTGMYPHSCFSLPENSVI 3141
            +   +I  ++ V+     I++++ EE  P+    S+ S +  N        F+       V  +G +   + +DLET+CS  ++CCG   CI+K  I L NK  ++ S S+ + ++I+D+ND+ P F     K+ I E ++IG  + L +A D D SS  R+  Y+L E TN+F L  D  +L S +L+++K +D+E +  Y   L ACD D CT Q++ +H++DENDN P FE+  YN+++KE + +G  I  VKA D D S  F TI YSI     D ++QSTF +   +G + L + L++  R +Y F++VA+DS+       L +V + V+D N+++P I I+   +  + + E  P + I  L + D D G N ++ C L P  + + F L N+S+D+YS+ S ++FD+E EQ     + C D G PSL + K + I I D NE+ P F ++S Y   +V EN+   + ++ + A D+DK+A L+++ DN     Y +ID  +G I  T N+IDRE++S IS  V+V D+ + + KTA+V VK  + D NDN P+F+     F I EN   + LVGQ+ ATD D+   A++ +SL  +W+    +  DN F +   G IET  ++DRE+ D + L I  +D        +T+  N+T+R+ DEND  P W  P N+  I+N+T   + GD ++QL A D D G NGKV++ +         +   N+ +++YF VNS+TG ++I   L      L   A+D G P   +   L + + G  S  L + ++A +I VT +IS+FLI+AIICVR+ P +    S  S+I  KE             Q  PD++ L           G+ +P   N+ + S + P              C +   E +D DSGDSG GPSEEG + H++  +G+ +      +R   +P +   ASP  ++G Y   C+ LPE ++I
Sbjct:    2 IWFIVIFCVNTVFALSDKISIQMHEEIPPNSEIGSILSAIPHN-LRSTSLEFITESDFFIVTEEGKILVRKLIDLETLCSQYKLCCGEPVCILKANILLNNKEKEVVS-SVEIQVQILDKNDHNPIFETPETKIVISEFSQIGISISLTSATDKDHSSQYRIQNYKLDEPTNSFIL--DISQLPSIFLKVSKKLDFEEKKQYHAKLKACDEDNCTTQNLIIHIKDENDNQPIFETETYNLTIKEDVQIGSIIGQVKANDRD-SGLFGTIKYSIRTD-FDTDIQSTFYVETLSGRIKLKKKLSTFTRSRYPFRIVARDSDPINPKQSLCSVTILVEDVNDHKPEIRIIADLSS-LKIQEEIPSKLITTLQIVDQDKGPNGIVYCHLDPVCEGS-FELQNRSKDIYSLRSVRKFDHEVEQKIDAIVICKDQGEPSLESRKIIPIIITDLNEFRPTFKDKSQYLLGHVWENSEFGTKVMTVKAQDQDKSAVLKYQIDNYGAE-YFEIDQNSGLIRCTNNLIDRERVSSISFTVHVMDS-DTEPKTASVEVKITVLDANDNSPLFSTNLPQFSIIENTGPSQLVGQINATDADQDENALISFSLRNSWNGNTMQRHDNYFNVLPTGHIETLLKLDREICDLYILEIMASDSAKSPQIPLTSIVNITLRVLDENDESPTWTHPDNN--ILNITDTMRPGDHLLQLQATDRDVGANGKVRFEIIKQYRKEDGSSSFNQGSSQYFIVNSSTGALWISQMLHSGTVILLFRASDYGQPAKYSDHKLVINIFGDESGNLNMTIIAVMITVTAVISLFLIVAIICVRRKPPKYH--SPTSSILTKE-------------QPVPDWIGLNSDESLLAYPSGNKSPYITNSHRASFIPPMNDGTIPMRTYAPNCAQF--EPIDGDSGDSGKGPSEEGSNPHHMPQEGQNYYTIRQPVRGPFRPCVPIPASPS-RSGCY---CYVLPEETII 947          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000002712.1 (SMESG000002712.1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.196e-140
Identity = 314/931 (33.73%), Postives = 502/931 (53.92%), Query Frame = 1
Query:  403 NVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKY-----DGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSE-NGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHP-NRRSETSCGSNI----------TDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDA-DSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYS-ASPFIQTGMYPHSCFSLPENSV 3138
            N+ V EE  P+    +++  L      P+   F +    +D ++     +G+++  +R+DLET+C    ICCG   C ++  + + ++   I  DS+ V+L+I D NDN P FS     + + ES  + + + LE+A D DFS+ NR+  Y+L +S+N F L T K    S  L+L   +DYE +  Y +TL ACD D CT++ + + V+DENDN P F    Y VS+ E    G  ++TV A D D S +   + Y+ID    DL++  TF +N ++G++ L   L +  R  Y F VVA+DS+ N    +   V + V+D NN  P+I IL  TN  + + EN     +  + VSD+D+G+NS + CEL+ T+    F LL K  +LYS+ S + FD+E  QV    I+C D GSP  ST +++ + I D NEYSP F Q  Y   +RENT   + +LQ+ A D D  A++R+  D   + F+ KID ++GWI T   ++DRE I  I    +  D    D  TAT  +   I DENDN P+F     F ++EN+I   L+G++ ATD D+G  + +++ LLKT  +R++EV  +F +   G IET   +DRE  +++TL + V D+        +TNVT+++ DENDNKP W  P   N   N+T      ++++ + A D DAG NG+++Y   +++P+       F ++  +G + +  +L   +  LT+ A+D  + P    + L +    +++ +  ++V+  +I+VTG ISI L+++IICVRK P     + SC + +          T +++   K K  ++Y  Q  D+        P   + +S      R   E +DA +SGDSG GPSE+  ++ YL+  ++F R  N   + +   SP   T       + LP+ S+
Sbjct:   24 NLTVKEEFKPNQFIGNIKYAL------PDKLKFSSLKFNVDSQFLQINDNGDVTLKKRIDLETLCQNSNICCGQFLCFIQTKVLVNDRNDFI--DSLTVNLQINDLNDNTPLFSTIEQTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQIS--LRLKSELDYETRKQYRLTLKACDRDSCTDKELIIDVQDENDNKPIFTKNFYKVSILENTDTGSLVVTVNAYDKD-SGDLGLVMYNIDAPN-DLDLIQTFGINSNSGEIRLERRLAANQRKLYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAIL-STNERVEVRENTLPGNLITIKVSDNDIGMNSKVNCELQ-TESKIDFQLLKKKENLYSLASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVLVHITDMNEYSPEFKQLIYEVSLRENTATNTKVLQLNATDRDGAASIRYSLDEKGKAFF-KIDHMSGWIKTKNVVLDREVIETIVFNAFAHDAY-VDPFTATTKIIVTIEDENDNAPIFGVIPEFTVKENMISTRLIGRLTATDADKGNNSQVEFVLLKTL-ARKQEVQKIFSVSKEGFIETLQSLDRETFESYTLEVGVRDKGKYP-MATSTNVTVKVLDENDNKPQWMNPNPINPEYNITRIINKNELVMTVQAFDTDAGENGRIKY--RIHNPKPNSKQPVFSLDEDSGEIRLVKELDFDQIELTIIASDSATKPKMVMLKLIINNHSRVASSPSVSVIIILISVTGFISIVLVVSIICVRKRPIGTGIKYSCPNALDLGKTNMAEWTFQDNSIYKQKPGIHY--QLNDYQL------PTQNVASS------RTSYEPIDAEESGDSGKGPSEDIRNAPYLDQNQIFAR--NYANMQWKIPSPIPSTACNGRQLYMLPDRSM 918          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000002712.1 (SMESG000002712.1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.310e-140
Identity = 314/931 (33.73%), Postives = 502/931 (53.92%), Query Frame = 1
Query:  403 NVKVMEETSPDVVFISLRSVLKENSFMPEDFLFLNRHALIDVKY-----DGNMSFHERLDLETICSTKQICCGAINCIVKIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIGFYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKFIDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVKETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTGDLVLNEFLNSKIRIQYNFQVVAQDSE-NGGNIDLATVNVYVKDENNNRPLIDILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKFSLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISILDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNLTENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVTVKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQYSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEPHLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQLIAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDARYRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGXXXXXXXXXXXCVRKHP-NRRSETSCGSNI----------TDKEDCYLKLKSSMNYVQQTPDFLTLIGSDNPNNTLQTSMLSPCQRHINEYLDA-DSGDSGNGPSEEGISSHYLNDGKVFLRSMNQPTINYS-ASPFIQTGMYPHSCFSLPENSV 3138
            N+ V EE  P+    +++  L      P+   F +    +D ++     +G+++  +R+DLET+C    ICCG   C ++  + + ++   I  DS+ V+L+I D NDN P FS     + + ES  + + + LE+A D DFS+ NR+  Y+L +S+N F L T K    S  L+L   +DYE +  Y +TL ACD D CT++ + + V+DENDN P F    Y VS+ E    G  ++TV A D D S +   + Y+ID    DL++  TF +N ++G++ L   L +  R  Y F VVA+DS+ N    +   V + V+D NN  P+I IL  TN  + + EN     +  + VSD+D+G+NS + CEL+ T+    F LL K  +LYS+ S + FD+E  QV    I+C D GSP  ST +++ + I D NEYSP F Q  Y   +RENT   + +LQ+ A D D  A++R+  D   + F+ KID ++GWI T   ++DRE I  I    +  D    D  TAT  +   I DENDN P+F     F ++EN+I   L+G++ ATD D+G  + +++ LLKT  +R++EV  +F +   G IET   +DRE  +++TL + V D+        +TNVT+++ DENDNKP W  P   N   N+T      ++++ + A D DAG NG+++Y   +++P+       F ++  +G + +  +L   +  LT+ A+D  + P    + L +    +++ +  ++V+  +I+VTG ISI L+++IICVRK P     + SC + +          T +++   K K  ++Y  Q  D+        P   + +S      R   E +DA +SGDSG GPSE+  ++ YL+  ++F R  N   + +   SP   T       + LP+ S+
Sbjct:   23 NLTVKEEFKPNQFIGNIKYAL------PDKLKFSSLKFNVDSQFLQINDNGDVTLKKRIDLETLCQNSNICCGQFLCFIQTKVLVNDRNDFI--DSLTVNLQINDLNDNTPLFSTIEQTITLRESLPVNYSMSLESAFDRDFSAENRIESYKLEDSSNKFELDTSKFPQIS--LRLKSELDYETRKQYRLTLKACDRDSCTDKELIIDVQDENDNKPIFTKNFYKVSILENTDTGSLVVTVNAYDKD-SGDLGLVMYNIDAPN-DLDLIQTFGINSNSGEIRLERRLAANQRKLYTFHVVAKDSDFNNPQKEKVPVEITVEDINNYYPVIAIL-STNERVEVRENTLPGNLITIKVSDNDIGMNSKVNCELQ-TESKIDFQLLKKKENLYSLASVRSFDFESGQVKSASIKCTDSGSPPKSTDRSVLVHITDMNEYSPEFKQLIYEVSLRENTATNTKVLQLNATDRDGAASIRYSLDEKGKAFF-KIDHMSGWIKTKNVVLDREVIETIVFNAFAHDAY-VDPFTATTKIIVTIEDENDNAPIFGVIPEFTVKENMISTRLIGRLTATDADKGNNSQVEFVLLKTL-ARKQEVQKIFSVSKEGFIETLQSLDRETFESYTLEVGVRDKGKYP-MATSTNVTVKVLDENDNKPQWMNPNPINPEYNITRIINKNELVMTVQAFDTDAGENGRIKY--RIHNPKPNSKQPVFSLDEDSGEIRLVKELDFDQIELTIIASDSATKPKMVMLKLIINNHSRVASSPSVSVIIILISVTGFISIVLVVSIICVRKRPIGTGIKYSCPNALDLGKTNMAEWTFQDNSIYKQKPGIHY--QLNDYQL------PTQNVASS------RTSYEPIDAEESGDSGKGPSEDIRNAPYLDQNQIFAR--NYANMQWKIPSPIPSTACNGRQLYMLPDRSM 917          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X9.664e-5629.21protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.021e-5529.21protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.024e-5529.21protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.073e-5529.21protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X1.230e-5529.21protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.106e-3525.26FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-15.765e-3525.26FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-14.243e-3425.94CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-11.672e-2923.18Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-11.672e-2923.18Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan1.267e-5127.88gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.267e-5127.88gene:FBgn0024836 transcript:FBtr0300578[more]
stan1.312e-5127.88gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.324e-5127.88gene:FBgn0024836 transcript:FBtr0303223[more]
stan1.324e-5127.88gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.193e-5727.59protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.230e-5727.97protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh119.810e-5728.15protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.774e-5628.15protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
dchs1b9.319e-5629.15dachsous cadherin-related 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh174.107e-5527.46protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.161e-5527.46protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh177.737e-5527.46protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh178.428e-5527.46protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh179.208e-5527.46protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.450e-5426.87protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.450e-5426.87protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11x3.078e-5428.39protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x5.057e-5428.39protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x7.226e-5428.39protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG7.904e-5627.94Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q9BZA7|PC11X_HUMAN6.753e-5529.21Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6X862|PC11X_GORGO2.712e-5429.21Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q9BZA8|PC11Y_HUMAN3.777e-5429.21Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WXV7|PC11X_PONPY4.235e-5429.21Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VXD33.692e-10731.44Protocadherin 9 OS=Echinococcus multilocularis OX=... [more]
A0A5K3FHZ75.230e-10731.43Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WWV16.639e-10731.34Protocadherin 9 OS=Echinococcus granulosus OX=6210... [more]
W6UEM32.418e-10631.47Protocadherin OS=Echinococcus granulosus OX=6210 G... [more]
A0A068WDC61.669e-10130.60Protocadherin 11 OS=Echinococcus granulosus OX=621... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh116.493e-5928.19protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh118.747e-5928.19protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1a8.936e-5727.96protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.363e-5627.96protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh112.028e-5628.01protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.425e-5329.32protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000010725.15.639e-5025.03pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
si:ch211-199f5.11.538e-4126.32protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.13.885e-4027.27pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000004043.12.991e-3924.22pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461894.950e-5027.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.720e-4929.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303649.126e-4729.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417679.744e-4726.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333601.169e-4529.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh115.794e-5627.67protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh119.937e-5627.81protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh1b4.301e-5428.00protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b4.781e-5428.00protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a3.617e-5326.85protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
back to top
BLAST of Protocadherin-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020691.10.000e+099.19SMESG000020691.1[more]
SMESG000020691.10.000e+099.46SMESG000020691.1[more]
SMESG000079318.11.828e-14734.32SMESG000079318.1[more]
SMESG000002712.11.196e-14033.73SMESG000002712.1[more]
SMESG000002712.11.310e-14033.73SMESG000002712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035224 ID=SMED30035224|Name=Protocadherin-9|organism=Schmidtea mediterranea sexual|type=transcript|length=3332bp
AAACAACGAAATACTTTTAATTCATAACGCAAAATTTAAATCCGATTTTG
TCATAGAAATTCAGCTGAAAGAAAATTATCCCAATTTCATTTTATGAAAA
ACAATGACAATGTTTAAAGTGCCGCAACATCATTGAAGATTAATCATTCC
GACAGTTTCGGAAAGACCGCATTTTGATAAAGAAACCCATTTTTAGACAT
TCCGAATTTAAAAGGATTTAGAAGTCTCTTTTCCTATCTCTCTCTCTCTC
GTGCCCTATTCTATAAGGGCAATGAAACAAATTTAAACCGTATTTTATTT
GAATCAAATGGTTCTTTACCAACAATGGGTTTCATATTGTTGACAGTTTT
ATTAGCAATAATTTCCAAATTGGATTTAGTCTATCAAACTGACATATCAA
TTAATGTGAAAGTGATGGAAGAAACGAGTCCGGATGTTGTTTTTATCAGT
TTGAGATCTGTGCTGAAAGAGAATTCGTTTATGCCTGAAGATTTTCTGTT
TCTAAATCGTCATGCTCTCATTGATGTGAAATACGATGGAAATATGTCGT
TCCATGAACGGTTAGATTTAGAAACGATTTGCTCAACGAAACAAATTTGT
TGTGGAGCGATTAATTGCATTGTAAAGATCTACATTCCATTGAAAAACAA
AATTACTGACATTCATTCTGACAGTATTAATGTTGACTTAGAAATTATAG
ATAGGAATGATAATAAACCACAGTTCAGTAAAACAAATCTCAAATTATTT
ATCCCAGAATCCGCGAAAATAGGATTCTATTTGCCGCTAGAGGCAGCAGT
TGACCATGATTTCAGCTCAGTTAATAGGGTACACGAATACCGGTTAATTG
AATCAACAAATACATTCCATTTAAAAACGGATAAACTAAAATTGAAATCC
TTTTATTTACAGTTGAATAAATTCATAGATTACGAAATTCAAACCGATTA
CGCAATGACTCTTTTGGCATGCGATCCTGATTTCTGTACAAATCAGTCTA
TTACTGTCCATGTAAGGGATGAAAATGATAATCTTCCAAAGTTTGAGTCG
GGAGTTTATAACGTCTCTGTAAAAGAAACTATTCCATTGGGTTATACCAT
TTTGACAGTTAAAGCAATAGATTTAGATAGAAGTAAAAACTTTAGCACCA
TTTATTATTCGATCGACCCAAAAATCATAGATTTAAATGTACAATCAACC
TTTCGGTTGAACAGAGATACCGGCGATTTAGTATTAAATGAATTTTTAAA
CTCAAAAATTCGTATCCAATATAACTTCCAAGTAGTGGCTCAAGACTCAG
AGAACGGTGGAAACATAGATTTAGCTACGGTGAATGTCTACGTAAAAGAC
GAAAACAACAATAGGCCTCTCATCGACATACTCTATCCTACCAATAGACA
TATTACATTACTCGAAAATCAACCCCTTCAAGAAATAGCCATTCTTACGG
TTTCCGATAGCGATTTAGGAGTCAACTCTCTGATCGCATGCGAATTGAAA
CCAACGAAAGATAGCGCAAAGTTTTCACTGCTAAACAAATCTCGTGATTT
GTACAGTATTCATTCCTCTAAACAATTCGACTATGAAAAAGAACAAGTCT
GCATGTTACAGATTCAGTGCCACGACTTTGGCTCTCCGTCTTTGTCAACA
ACAAAAACATTGAATATCTCTATTCTAGATGAAAATGAATACAGTCCAGC
ATTCAATCAGTCTCATTATCATGCATATGTTAGAGAAAATACGCCCGCCC
GCTCTCCTATATTGCAAATCGCCGCATTTGACGAAGACAAGAATGCTACT
CTGCGTTTTGAGTTCGACAATCTTACTGAGAATTTCTATTTGAAAATTGA
TACAGTAAATGGATGGATCAGTACAACTGAGAACATAATCGATCGGGAGA
AAATTAGCGAAATATCAAAAGTGGTCTATGTAACCGACACCCTAAATAAA
GACTCAAAAACGGCAACTGTAACAGTGAAATTTCAAATTAGTGATGAAAA
TGACAATAAACCAGTATTTGCAGAAACATTTTCCTTTGAAATTCAAGAAA
ATATTATTGTAAATTCTCTAGTCGGACAAGTTTTGGCTACAGATCCAGAC
GAAGGTGGAGCAGCAGTTCTTCAGTATTCTTTACTTAAAACCTGGTCTTC
GCGACAAAAGGAAGTCGACAACCTCTTTTTAATGAAAACAAACGGGGCTA
TTGAAACCAAAGGAGAAATAGATAGAGAACTTGATGATAACTTTACATTG
TTAATTGCTGTTACCGATGAGCCGCATTTAGCAGACAATTATGTGACGAC
AAATGTGACAATTCGAATCAGGGATGAAAACGATAACAAACCAATTTGGT
TCATTCCAAAAAACAGCAATGCAATAATAAATGTCACTAGTTATCCAAAG
GTGGGAGACATTATCATACAACTCATTGCAAAAGATGTCGATGCAGGAAA
TAATGGGAAAGTTCAGTACTACTTATCTTTAAATGATCCAGAAAATGAGG
TGGCCACAAAATATTTCTTCGTGAATTCAACAACTGGTTATGTTTATATT
CAAAATCAACTGATGGACGCAAGATACAGATTGACGTTGGAGGCAACAGA
TTTAGGAAGCCCCCCAATGAGAACACCAATAGTTCTCTATGTTAGAGTTA
CTGGTCAGATTTCCCAAACGTTAAAAATTGCCGTTGTTGCCAGTATTATC
GCTGTTACTGGAATTATATCTATATTTTTAATTATTGCAATTATTTGCGT
TAGAAAACACCCAAACAGAAGATCAGAAACTTCCTGTGGATCAAATATTA
CTGATAAAGAAGATTGTTATCTCAAATTGAAGTCCTCTATGAATTATGTT
CAACAAACTCCCGACTTTTTGACTCTCATTGGATCAGACAACCCTAATAA
TACATTGCAGACTTCAATGTTATCTCCATGTCAGAGACACATCAACGAGT
ATCTTGATGCCGACAGTGGAGATTCTGGTAACGGTCCAAGCGAAGAAGGA
ATATCATCCCATTATCTAAATGATGGAAAGGTCTTTCTTCGATCAATGAA
CCAACCAACCATAAATTATTCTGCATCTCCCTTTATACAGACCGGTATGT
ATCCTCATTCCTGTTTTAGTTTACCAGAAAACTCAGTGATCTCTCAAATA
TCTGACGATATGCTAATTGGTAACTCTTATTATGATCTCTCAACTTTAAA
CAATCGAAATTTGACCGGTATCTTTCAAAAGATTCCTTCAATGATGAATA
GCAATGGTGAATATTCTATGCAGAATTTGTACTCCCAATTATCACAAATT
TAATCATTCCTTTTATGATTTTGGTTAACTCA
back to top

protein sequence of SMED30035224-orf-1

>SMED30035224-orf-1 ID=SMED30035224-orf-1|Name=SMED30035224-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=993bp
MGFILLTVLLAIISKLDLVYQTDISINVKVMEETSPDVVFISLRSVLKEN
SFMPEDFLFLNRHALIDVKYDGNMSFHERLDLETICSTKQICCGAINCIV
KIYIPLKNKITDIHSDSINVDLEIIDRNDNKPQFSKTNLKLFIPESAKIG
FYLPLEAAVDHDFSSVNRVHEYRLIESTNTFHLKTDKLKLKSFYLQLNKF
IDYEIQTDYAMTLLACDPDFCTNQSITVHVRDENDNLPKFESGVYNVSVK
ETIPLGYTILTVKAIDLDRSKNFSTIYYSIDPKIIDLNVQSTFRLNRDTG
DLVLNEFLNSKIRIQYNFQVVAQDSENGGNIDLATVNVYVKDENNNRPLI
DILYPTNRHITLLENQPLQEIAILTVSDSDLGVNSLIACELKPTKDSAKF
SLLNKSRDLYSIHSSKQFDYEKEQVCMLQIQCHDFGSPSLSTTKTLNISI
LDENEYSPAFNQSHYHAYVRENTPARSPILQIAAFDEDKNATLRFEFDNL
TENFYLKIDTVNGWISTTENIIDREKISEISKVVYVTDTLNKDSKTATVT
VKFQISDENDNKPVFAETFSFEIQENIIVNSLVGQVLATDPDEGGAAVLQ
YSLLKTWSSRQKEVDNLFLMKTNGAIETKGEIDRELDDNFTLLIAVTDEP
HLADNYVTTNVTIRIRDENDNKPIWFIPKNSNAIINVTSYPKVGDIIIQL
IAKDVDAGNNGKVQYYLSLNDPENEVATKYFFVNSTTGYVYIQNQLMDAR
YRLTLEATDLGSPPMRTPIVLYVRVTGQISQTLKIAVVASIIAVTGIISI
FLIIAIICVRKHPNRRSETSCGSNITDKEDCYLKLKSSMNYVQQTPDFLT
LIGSDNPNNTLQTSMLSPCQRHINEYLDADSGDSGNGPSEEGISSHYLND
GKVFLRSMNQPTINYSASPFIQTGMYPHSCFSLPENSVISQISDDMLIGN
SYYDLSTLNNRNLTGIFQKIPSMMNSNGEYSMQNLYSQLSQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 657..674
score: 35.72
coord: 458..471
score: 44.63
coord: 622..648
score: 22.29
coord: 315..327
score: 30.02
coord: 240..269
score: 36.5
coord: 439..458
score: 34.66
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 586..673
e-value: 2.1E-11
score: 53.9
coord: 374..458
e-value: 9.6E-14
score: 61.7
coord: 482..563
e-value: 3.2E-10
score: 50.0
coord: 262..348
e-value: 1.7E-10
score: 50.8
coord: 700..783
e-value: 1.1E-4
score: 31.5
coord: 156..238
e-value: 9.0E-4
score: 28.5
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 692..776
e-value: 7.8E-9
score: 35.9
coord: 465..555
e-value: 7.8E-11
score: 42.3
coord: 245..340
e-value: 7.6E-11
score: 42.3
coord: 569..664
e-value: 1.2E-10
score: 41.7
coord: 359..451
e-value: 4.0E-11
score: 43.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 347..455
e-value: 1.3E-16
score: 63.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 673..784
e-value: 3.1E-14
score: 55.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 128..235
e-value: 5.2E-14
score: 54.6
coord: 456..562
e-value: 5.0E-19
score: 70.8
coord: 236..346
e-value: 1.8E-21
score: 78.7
coord: 563..672
e-value: 2.5E-21
score: 78.3
NoneNo IPR availablePANTHERPTHR24025FAMILY NOT NAMEDcoord: 108..538
NoneNo IPR availablePANTHERPTHR24025FAMILY NOT NAMEDcoord: 226..674
coord: 479..780
NoneNo IPR availablePANTHERPTHR24025:SF17coord: 226..674
NoneNo IPR availablePANTHERPTHR24025:SF17coord: 479..780
coord: 108..538
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 565..675
score: 21.248
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 679..775
score: 13.487
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 135..240
score: 15.439
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 354..460
score: 15.219
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 241..350
score: 19.034
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 461..565
score: 18.749
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 244..346
e-value: 9.9389E-20
score: 83.1317
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 141..236
e-value: 1.15487E-8
score: 51.5454
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 464..561
e-value: 5.78032E-19
score: 80.8205
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 692..776
e-value: 1.29037E-14
score: 68.4941
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 568..671
e-value: 2.12853E-18
score: 79.2797
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 359..455
e-value: 3.71174E-15
score: 70.0349
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.76
NoneNo IPR availableTMHMMTMhelixcoord: 785..807
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 122..132
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 228..238
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 128..232
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 663..777
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 359..452
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 228..354
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 448..566
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 555..677