Gelsolin

Overview
NameGelsolin
Smed IDSMED30035218
Length (bp)1573
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gelsolin (SMED30035218) t-SNE clustered cells

Violin plots show distribution of expression levels for Gelsolin (SMED30035218) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gelsolin (SMED30035218) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gelsolin (SMED30035218) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035218

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035218SMESG000015535.1 dd_Smed_v4_1132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035218SMESG000015535.1 dd_Smed_v4_1132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035218SMESG000015535.1 dd_Smed_v4_1132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035218SMESG000015535.1 dd_Smed_v4_1132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035218SMESG000015535.1 dd_Smed_v4_1132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035218SMESG000015535.1 Contig37042newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035218SMESG000015535.1 Contig37042uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30035218SMESG000015535.1 dd_Smed_v6_1132_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30035218SMESG000015535.1 dd_Smed_v6_1132_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gelsolin vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 202.601 bits (514), Expect = 6.640e-59
Identity = 116/319 (36.36%), Postives = 175/319 (54.86%), Query Frame = 2
Query:  233 VTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL--------------PDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +TTP L IWRIE  ++V  P   +G FF+GD YIIL I K  +S  L YDIH+WIG+ S+ DE G AA  T ++D FL  +A+QHREV G ES+ F+ YF   + I KGG  SG + V    Y+ + L  H   +++V   EV+ S  S + GDVF+LD G    QWNG  S + E+++     +++ + ER GR    V+D E+   + K+ +++              PDT V   +   L    +LY +SD  G +    ++     + +L   D +++D G   ++V+ G  A+  EKK AMS+A N++K   +P
Sbjct:   14 ITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASS--LSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRL-LHVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAAL----KLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP 325          
BLAST of Gelsolin vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 201.06 bits (510), Expect = 1.674e-55
Identity = 116/319 (36.36%), Postives = 175/319 (54.86%), Query Frame = 2
Query:  233 VTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL--------------PDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +TTP L IWRIE  ++V  P   +G FF+GD YIIL I K  +S  L YDIH+WIG+ S+ DE G AA  T ++D FL  +A+QHREV G ES+ F+ YF   + I KGG  SG + V    Y+ + L  H   +++V   EV+ S  S + GDVF+LD G    QWNG  S + E+++     +++ + ER GR    V+D E+   + K+ +++              PDT V   +   L    +LY +SD  G +    ++     + +L   D +++D G   ++V+ G  A+  EKK AMS+A N++K   +P
Sbjct:   14 ITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASS--LSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRL-LHVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAAL----KLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP 325          

HSP 2 Score: 95.9005 bits (237), Expect = 4.301e-20
Identity = 79/302 (26.16%), Postives = 140/302 (46.36%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILK---IKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP--VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLT--HKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIE  ++V    +  G F+ GD Y++L    I ++++     Y ++ W G +++QDE   +AY+ V LD   + + +Q R   G E     S F   ++    G   +   +  P     RL         + +  EV    N L+S DVF+L      + W GK  + +E+  A     ++ ++   R +  V+ E   P      +    P     +   ++L I+ RL+  S++TG+   + I +    +  L+++DVF++D    +F +IG  A+ +EKK A + A  YLK   HP
Sbjct:  402 VWRIENLELVPVDSKWLGHFYGGDCYLLLYTYLIGEKQH-----YLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMSIFKGRMVVYQGGTSRTNNLETGPST---RLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGKGCSGDEREMA-----KMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTGRFLATEIPDFN--QDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLK--THP 686          
BLAST of Gelsolin vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 198.749 bits (504), Expect = 3.677e-55
Identity = 121/321 (37.69%), Postives = 181/321 (56.39%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLP---------DTAVTKKVHKDLAISKRLYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S  S ++GD FILD G    QW G  SN+ E++KA Q  + + ++ER+GR +  V  EE T     +  L P         DTA     ++ LA   +LY++S+  G ++ SL++ E    +  LK  D F++D+G+   +FV+ G  A+ +E+K A+  A +++ + D+P
Sbjct:    7 EFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHV-SEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLA---KLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYP 321          

HSP 2 Score: 104.375 bits (259), Expect = 7.033e-23
Identity = 90/298 (30.20%), Postives = 132/298 (44.30%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHK-IYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      YG+F+ GDSYIIL   +      ++ Y+   W G +STQDE   +A  T +LD  L    +Q R V G E     S F   P+I I KGG      Q  P     RL             VEV     +L+S D F+L     A+ W G  +++ EK  A + L+ L ++     +    D     L  K  Y+  P      K  K  A   RL+  S++ G+     +  G+  +  L  +DV ++D    +FV++G  +  +EK  A++ A  Y+ ETD
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMI-IYKGGTSREGGQTAPAST--RLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRL----KDKKMDAHPPRLFACSNKIGRFVIEEVP-GELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYI-ETD 683          
BLAST of Gelsolin vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 198.749 bits (504), Expect = 5.309e-55
Identity = 120/318 (37.74%), Postives = 183/318 (57.55%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAV---TKKVHKDLAISK---RLYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S  S ++GD FILD G    QW G  SN+ E++KA Q  + + ++ER+GR +  V  EE T     +  L P  A+   T+   K+ A ++   +LY++S+  G ++ SL++ E    +  LK  D F++D+G+   +FV+ G  A+ +E+K A+  A +++ + D+P
Sbjct:   18 EFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHV-SEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYP 332          

HSP 2 Score: 103.99 bits (258), Expect = 8.238e-23
Identity = 90/298 (30.20%), Postives = 132/298 (44.30%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHK-IYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      YG+F+ GDSYIIL   +      ++ Y+   W G +STQDE   +A  T +LD  L    +Q R V G E     S F   P+I I KGG      Q  P     RL             VEV     +L+S D F+L     A+ W G  +++ EK  A + L+ L ++     +    D     L  K  Y+  P      K  K  A   RL+  S++ G+     +  G+  +  L  +DV ++D    +FV++G  +  +EK  A++ A  Y+ ETD
Sbjct:  409 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMI-IYKGGTSREGGQTAPAST--RLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRL----KDKKMDAHPPRLFACSNKIGRFVIEEVP-GELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYI-ETD 694          
BLAST of Gelsolin vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 198.364 bits (503), Expect = 5.447e-55
Identity = 120/318 (37.74%), Postives = 183/318 (57.55%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAV---TKKVHKDLAISK---RLYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S  S ++GD FILD G    QW G  SN+ E++KA Q  + + ++ER+GR +  V  EE T     +  L P  A+   T+   K+ A ++   +LY++S+  G ++ SL++ E    +  LK  D F++D+G+   +FV+ G  A+ +E+K A+  A +++ + D+P
Sbjct:   15 EFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHV-SEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYP 329          

HSP 2 Score: 103.99 bits (258), Expect = 8.279e-23
Identity = 90/298 (30.20%), Postives = 132/298 (44.30%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHK-IYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      YG+F+ GDSYIIL   +      ++ Y+   W G +STQDE   +A  T +LD  L    +Q R V G E     S F   P+I I KGG      Q  P     RL             VEV     +L+S D F+L     A+ W G  +++ EK  A + L+ L ++     +    D     L  K  Y+  P      K  K  A   RL+  S++ G+     +  G+  +  L  +DV ++D    +FV++G  +  +EK  A++ A  Y+ ETD
Sbjct:  406 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMI-IYKGGTSREGGQTAPAST--RLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRL----KDKKMDAHPPRLFACSNKIGRFVIEEVP-GELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYI-ETD 691          
BLAST of Gelsolin vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 171.4 bits (433), Expect = 2.871e-47
Identity = 113/315 (35.87%), Postives = 170/315 (53.97%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQVTPE--KYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHK----DLAISKR------LYRLSDETGKITFSLISEGKT-PKSMLKDNDVFMID--NGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
             L +WRI KF +   P+ D+G F+ GD+YI L  K +       +D+HFW+GK ++ DE G AA KTVE+D  L     QHRE+  +ES LF SYFP  I  + GG ESG+R V  +   ++P L  FHC  +++V   EV+   NSL+ GDVFILD G + + W    S + E++K     + + + ER G  K  +LD+ +       +      +  +KV K    D    KR      L+++SD +G    S++S+G+   K  L   D F++D  NG  +FV+IG   + +E+  A+ +  NYLK+   P
Sbjct:   18 GLLVWRINKFVLEPVPEVDHGVFYIGDAYIALYQKYDG-----CWDVHFWLGKNASTDEIGVAAIKTVEIDDSLGGIPTQHREIQNYESPLFLSYFPDGIRYVSGGYESGYRHVDDQFKNWKPHL--FHCKGKRNVRCTEVECEVNSLNLGDVFILDLGKDLYVWMPPESGRLERIKGMARAKNIADHERMGIPKVHILDDVEWDNDSTFWSYFGGVSSVRKVSKGKDDDDNYWKRLTEQITLWKVSDASGAAKVSMVSQGENIRKEQLDPKDAFILDAING-GIFVWIGHECTLEERSKALIWGQNYLKQHHLP 324          
BLAST of Gelsolin vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.873e-16
Identity = 75/289 (25.95%), Postives = 136/289 (47.06%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF--PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP------LTHKIYKLLPDTAVTKKVHKD-LAISKRLYRLSDETGKITFSLIS--EGKTPKSMLKDNDVFMIDNGRHMFVYIGAGAS 1075
             +++W IE F      +  +G+F++ D+Y++LK  +E  S +L + I +W+G+ ++ D+   +A   V L   L+      RE    E++ F + F   ++ I  G   SGF       +  R L+    +   VE+  V  S  SLD    F+LD G   + W+G  S      KA  F ++L + +R G+ + +   +   P      LT    K  P  A+ + V +  +A  K+LY+++   G +    +   +G   + ML    VF++D+   +F++IG  A+
Sbjct:  509 GMWVWEIENFYPSIMDEAFHGQFYDADAYLVLKTTREA-SGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEFLTLFGEEIVYIEGGRTISGFYTTEKPAHLTR-LYRAGVNGTAVEMEPVPLSVESLDPRFCFLLDAGETIWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARCPPEFWQALTGNPDK--PQGAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKAN 793          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078973)

HSP 1 Score: 194.897 bits (494), Expect = 1.076e-53
Identity = 110/315 (34.92%), Postives = 178/315 (56.51%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQV-TPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP---------LTHKIYKLLPDTAVTKK---VHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            TP L IWRIE F+ V +PK +YGKF+ GDS+I+L   + +   +L +D+HFW+G  ++ DE G AA  TV+LD  L+   +QHREV   ES LF SYF   I   +GG  +GF+ V T  + E RL  F    +++V + +V  S +S+++GD FILD G + + + G  + + EK+KA     Q+ + + NGR +  ++D+  T          L       +PD +   +     +  A +  LY++SD +GK+   +I +    ++ML   + F++D G  +FV++G GA+  EK +AM+ A  +L+   +P
Sbjct:   69 TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRL--FQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309256)

HSP 1 Score: 194.897 bits (494), Expect = 1.076e-53
Identity = 110/315 (34.92%), Postives = 178/315 (56.51%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQV-TPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP---------LTHKIYKLLPDTAVTKK---VHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            TP L IWRIE F+ V +PK +YGKF+ GDS+I+L   + +   +L +D+HFW+G  ++ DE G AA  TV+LD  L+   +QHREV   ES LF SYF   I   +GG  +GF+ V T  + E RL  F    +++V + +V  S +S+++GD FILD G + + + G  + + EK+KA     Q+ + + NGR +  ++D+  T          L       +PD +   +     +  A +  LY++SD +GK+   +I +    ++ML   + F++D G  +FV++G GA+  EK +AM+ A  +L+   +P
Sbjct:   69 TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRL--FQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078969)

HSP 1 Score: 194.897 bits (494), Expect = 1.076e-53
Identity = 110/315 (34.92%), Postives = 178/315 (56.51%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQV-TPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP---------LTHKIYKLLPDTAVTKK---VHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            TP L IWRIE F+ V +PK +YGKF+ GDS+I+L   + +   +L +D+HFW+G  ++ DE G AA  TV+LD  L+   +QHREV   ES LF SYF   I   +GG  +GF+ V T  + E RL  F    +++V + +V  S +S+++GD FILD G + + + G  + + EK+KA     Q+ + + NGR +  ++D+  T          L       +PD +   +     +  A +  LY++SD +GK+   +I +    ++ML   + F++D G  +FV++G GA+  EK +AM+ A  +L+   +P
Sbjct:   69 TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRL--FQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078968)

HSP 1 Score: 194.897 bits (494), Expect = 1.076e-53
Identity = 110/315 (34.92%), Postives = 178/315 (56.51%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQV-TPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP---------LTHKIYKLLPDTAVTKK---VHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            TP L IWRIE F+ V +PK +YGKF+ GDS+I+L   + +   +L +D+HFW+G  ++ DE G AA  TV+LD  L+   +QHREV   ES LF SYF   I   +GG  +GF+ V T  + E RL  F    +++V + +V  S +S+++GD FILD G + + + G  + + EK+KA     Q+ + + NGR +  ++D+  T          L       +PD +   +     +  A +  LY++SD +GK+   +I +    ++ML   + F++D G  +FV++G GA+  EK +AM+ A  +L+   +P
Sbjct:   69 TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRL--FQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0336707)

HSP 1 Score: 194.126 bits (492), Expect = 1.161e-53
Identity = 110/315 (34.92%), Postives = 178/315 (56.51%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQV-TPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP---------LTHKIYKLLPDTAVTKK---VHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            TP L IWRIE F+ V +PK +YGKF+ GDS+I+L   + +   +L +D+HFW+G  ++ DE G AA  TV+LD  L+   +QHREV   ES LF SYF   I   +GG  +GF+ V T  + E RL  F    +++V + +V  S +S+++GD FILD G + + + G  + + EK+KA     Q+ + + NGR +  ++D+  T          L       +PD +   +     +  A +  LY++SD +GK+   +I +    ++ML   + F++D G  +FV++G GA+  EK +AM+ A  +L+   +P
Sbjct:   11 TPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRL--FQVKGKRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 323          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 194.897 bits (494), Expect = 6.127e-54
Identity = 115/309 (37.22%), Postives = 179/309 (57.93%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHK----IYKLLPDTAVTKKVHKDLAISK--RLYRLSDETGKITFSLISEGKT-PKSMLKDNDVFMIDNGRH--MFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
             L IWRIEK ++V  P+  YG F+ GD+Y++L   K+++S   FYD+HFW+GK  +QDE   AA  + ++D +L  K +Q+RE+ GFES +F SYF   I    GG  SGF+ V       R L FH   ++ V   EV  S  S ++GD FI+D G   +QW G   NK E++KAAQ    + ++ER+GR K  V++E   P        +   +P+   ++    D++  K   LY +SD TGK+  SL+S+     +S L  ++ F++D+G++  +FV+ G  A+P E+K AM  A +++K+  +P
Sbjct:   16 GLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSS--FYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKGGIKYKSGGVASGFQHVITNDLTARRL-FHIKGRRTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYP 321          

HSP 2 Score: 86.2705 bits (212), Expect = 2.670e-17
Identity = 90/306 (29.41%), Postives = 138/306 (45.10%), Query Frame = 2
Query:  254 IWRIEKFKV-----VNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILD--NGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKV--HKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWR+E         V    E YG+F+ GD YIIL +  K E        I+ W G RST DE   +A+ TVELD  L   A+Q R   G E     S F   P+I    G    G +         RL   H        + EV    +SL+S D ++L    G + + W GK +++ E+ KAA+++ +        CKT ++ E   P    +         T  +   + +A   RL+  S++TGK     +  G+  +  L ++DV ++D    +FV+IG  A+  E+  ++  A  Y+ ETD
Sbjct:  398 IWRVECGATKGDTKVPVDPETYGQFYGGDCYIILYRYSKGEI-------IYTWQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPPHLLSLFKDKPLIVYKDGTSRKGGQAPAAPT---RLFQVHKNLGTITRISEVDAKASSLNSNDAYLLKLPQG-DGYIWKGKGASEEEE-KAAKYMTE-----KLNCKTKMVVEGKEPEAFWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVP-GEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYI-ETD 684          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 194.897 bits (494), Expect = 6.376e-54
Identity = 115/309 (37.22%), Postives = 179/309 (57.93%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHK----IYKLLPDTAVTKKVHKDLAISK--RLYRLSDETGKITFSLISEGKT-PKSMLKDNDVFMIDNGRH--MFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
             L IWRIEK ++V  P+  YG F+ GD+Y++L   K+++S   FYD+HFW+GK  +QDE   AA  + ++D +L  K +Q+RE+ GFES +F SYF   I    GG  SGF+ V       R L FH   ++ V   EV  S  S ++GD FI+D G   +QW G   NK E++KAAQ    + ++ER+GR K  V++E   P        +   +P+   ++    D++  K   LY +SD TGK+  SL+S+     +S L  ++ F++D+G++  +FV+ G  A+P E+K AM  A +++K+  +P
Sbjct:   16 GLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSS--FYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKGGIKYKSGGVASGFQHVITNDLTARRL-FHIKGRRTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYP 321          

HSP 2 Score: 84.7297 bits (208), Expect = 7.472e-17
Identity = 90/306 (29.41%), Postives = 138/306 (45.10%), Query Frame = 2
Query:  254 IWRIEKFKV-----VNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILD--NGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKV--HKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWR+E         V    E YG+F+ GD YIIL +  K E        I+ W G RST DE   +A+ TVELD  L   A+Q R   G E     S F   P+I    G    G +         RL            + EV    +SL+S DV++L    G + + W GK +++ E+ KAA+++ +        CKT ++ E   P    +         T  +   + +A   RL+  S++TGK     +  G+  +  L ++DV ++D    +FV+IG  A+  E+  ++  A  Y+ ETD
Sbjct:  398 IWRVECGATKGDTKVPVDPETYGQFYGGDCYIILYRYSKGEI-------IYTWQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPPHLLSLFKDKPLIVYKDGTSRKGGQAPAAPT---RLFQVRKNLGTITRISEVDAKASSLNSNDVYLLKLPQG-DGYIWKGKGASEEEE-KAAKYMSE-----KLNCKTKMVVEGKEPDVFWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVP-GEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYI-ETD 684          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 195.282 bits (495), Expect = 1.108e-53
Identity = 114/320 (35.62%), Postives = 169/320 (52.81%), Query Frame = 2
Query:  236 TTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL---------------PDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHPL 1141
            TTP L IWR+E  ++V  P + +G+FF GDSY+IL   K  N+    YDIH+W+GK ++QDE G AA  T ++D  L   A+QHRE  G ES  F+ YF   I   KGG  SG +QV    Y  R L  H    KHV   EV+ S NS + GDVF+LD G    QWNG  SN+ E+++     + + + ER GR +  V++ +D   + +  KL+               PD  V +K    L  + +LY +SD  G +    ++     + +LK  D +++D G   +F++ G  AS  E+  ++  A  Y+K   +P+
Sbjct:   16 TTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHKTSNN--FSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVASGMKQVETNTYNIRRL-LHVKGNKHVVAGEVEMSWNSFNKGDVFLLDLGSLIIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEIVDEK----LKTAIKLYHISDAQGSLVVQEVAVKPLTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYPV 328          

HSP 2 Score: 101.293 bits (251), Expect = 4.552e-22
Identity = 83/299 (27.76%), Postives = 143/299 (47.83%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP--VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKD--LAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIE  ++    ++  G F+ GD Y+IL   K E S +  Y ++ W G+ ++  E    AY+ V LD   + + +Q R   G E     + F   +I   +G    G  Q  P     RL H H  ++ +    EV    +SL+S DVF+L      + W GK  + +E+ + A+ L  + S+R    +  V+ E   P    +         + K  +D  ++I+ RL+  S++TG+   + I+     +  L ++DV ++D    ++++IG GA+  EK+ A+  A  YLK   HP
Sbjct:  404 VWRIEDNELAPVDRKWLGHFYGGDCYLILY--KYEVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQSRPSV---RLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKCCYLWYGKGCSGDER-EMAKSLADIISKR----EKQVIAEGQEPADFWVNLGGKSQYASNKRLQDENISITPRLFECSNQTGRFIATEITNFN--QDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLK--SHP 688          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 195.282 bits (495), Expect = 1.108e-53
Identity = 114/320 (35.62%), Postives = 169/320 (52.81%), Query Frame = 2
Query:  236 TTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL---------------PDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHPL 1141
            TTP L IWR+E  ++V  P + +G+FF GDSY+IL   K  N+    YDIH+W+GK ++QDE G AA  T ++D  L   A+QHRE  G ES  F+ YF   I   KGG  SG +QV    Y  R L  H    KHV   EV+ S NS + GDVF+LD G    QWNG  SN+ E+++     + + + ER GR +  V++ +D   + +  KL+               PD  V +K    L  + +LY +SD  G +    ++     + +LK  D +++D G   +F++ G  AS  E+  ++  A  Y+K   +P+
Sbjct:   16 TTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHKTSNN--FSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVASGMKQVETNTYNIRRL-LHVKGNKHVVAGEVEMSWNSFNKGDVFLLDLGSLIIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEIVDEK----LKTAIKLYHISDAQGSLVVQEVAVKPLTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYPV 328          

HSP 2 Score: 101.293 bits (251), Expect = 4.552e-22
Identity = 83/299 (27.76%), Postives = 143/299 (47.83%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP--VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKD--LAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIE  ++    ++  G F+ GD Y+IL   K E S +  Y ++ W G+ ++  E    AY+ V LD   + + +Q R   G E     + F   +I   +G    G  Q  P     RL H H  ++ +    EV    +SL+S DVF+L      + W GK  + +E+ + A+ L  + S+R    +  V+ E   P    +         + K  +D  ++I+ RL+  S++TG+   + I+     +  L ++DV ++D    ++++IG GA+  EK+ A+  A  YLK   HP
Sbjct:  404 VWRIEDNELAPVDRKWLGHFYGGDCYLILY--KYEVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQSRPSV---RLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKCCYLWYGKGCSGDER-EMAKSLADIISKR----EKQVIAEGQEPADFWVNLGGKSQYASNKRLQDENISITPRLFECSNQTGRFIATEITNFN--QDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLK--SHP 688          
BLAST of Gelsolin vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 195.282 bits (495), Expect = 1.108e-53
Identity = 114/320 (35.62%), Postives = 169/320 (52.81%), Query Frame = 2
Query:  236 TTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL---------------PDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHPL 1141
            TTP L IWR+E  ++V  P + +G+FF GDSY+IL   K  N+    YDIH+W+GK ++QDE G AA  T ++D  L   A+QHRE  G ES  F+ YF   I   KGG  SG +QV    Y  R L  H    KHV   EV+ S NS + GDVF+LD G    QWNG  SN+ E+++     + + + ER GR +  V++ +D   + +  KL+               PD  V +K    L  + +LY +SD  G +    ++     + +LK  D +++D G   +F++ G  AS  E+  ++  A  Y+K   +P+
Sbjct:   16 TTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHKTSNN--FSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVASGMKQVETNTYNIRRL-LHVKGNKHVVAGEVEMSWNSFNKGDVFLLDLGSLIIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEIVDEK----LKTAIKLYHISDAQGSLVVQEVAVKPLTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYPV 328          

HSP 2 Score: 101.293 bits (251), Expect = 4.552e-22
Identity = 83/299 (27.76%), Postives = 143/299 (47.83%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP--VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKD--LAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIE  ++    ++  G F+ GD Y+IL   K E S +  Y ++ W G+ ++  E    AY+ V LD   + + +Q R   G E     + F   +I   +G    G  Q  P     RL H H  ++ +    EV    +SL+S DVF+L      + W GK  + +E+ + A+ L  + S+R    +  V+ E   P    +         + K  +D  ++I+ RL+  S++TG+   + I+     +  L ++DV ++D    ++++IG GA+  EK+ A+  A  YLK   HP
Sbjct:  404 VWRIEDNELAPVDRKWLGHFYGGDCYLILY--KYEVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQSRPSV---RLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKCCYLWYGKGCSGDER-EMAKSLADIISKR----EKQVIAEGQEPADFWVNLGGKSQYASNKRLQDENISITPRLFECSNQTGRFIATEITNFN--QDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLK--SHP 688          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 198.749 bits (504), Expect = 1.451e-54
Identity = 118/311 (37.94%), Postives = 169/311 (54.34%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIM-KGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLD-EEDTPLTHKIYKL--------LPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L IW +EK K+V  P++ YG FF GD YI+L  K+  N   L  DIH+WIGK S+QDE G+AA+   ++D  L    IQHREV G ES  FKSYF    I  KGG  SGF+ V    Y  R L  H   +KHV   EV  S NS + GDVF+LD G    QWNG  SNK+E+++A    Q + + ER GR +  V+D E+D+P   +I           L D+   +K  +    + RLY + ++   +    ++     + +L+  D  ++D G   ++V+ G  +SP+EK  A S A  +++   +P
Sbjct:   12 PGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNG--LISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRL-LHVKGKKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 319          

HSP 2 Score: 103.219 bits (256), Expect = 1.561e-22
Identity = 75/296 (25.34%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD-EEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIEK ++       YG+F+ GD Y+IL    +   P   Y ++ W+G+ ++QDE    A++ V+LD    D+ +Q R   G E    ++ F    I+  G  S      PE    +L      ++ + +  EV    +SL+S DVF+L      + W GK  + +E+ + A+ +  + S+++   K  +L+ +E       +    P  +  +   + +  S RL+  S++TG+   + + +    +S L ++DV ++D    +F+++G  A+  EK  ++  +  YL+   HP
Sbjct:  396 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPN--YLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLGVHEPEA-PIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER-EMAKTVANIISKQD---KQTILEGQEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVVD--FCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HP 680          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 198.364 bits (503), Expect = 1.529e-54
Identity = 118/311 (37.94%), Postives = 169/311 (54.34%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIM-KGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLD-EEDTPLTHKIYKL--------LPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L IW +EK K+V  P++ YG FF GD YI+L  K+  N   L  DIH+WIGK S+QDE G+AA+   ++D  L    IQHREV G ES  FKSYF    I  KGG  SGF+ V    Y  R L  H   +KHV   EV  S NS + GDVF+LD G    QWNG  SNK+E+++A    Q + + ER GR +  V+D E+D+P   +I           L D+   +K  +    + RLY + ++   +    ++     + +L+  D  ++D G   ++V+ G  +SP+EK  A S A  +++   +P
Sbjct:   12 PGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNG--LISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRL-LHVKGKKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 319          

HSP 2 Score: 103.219 bits (256), Expect = 1.555e-22
Identity = 75/296 (25.34%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD-EEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIEK ++       YG+F+ GD Y+IL    +   P   Y ++ W+G+ ++QDE    A++ V+LD    D+ +Q R   G E    ++ F    I+  G  S      PE    +L      ++ + +  EV    +SL+S DVF+L      + W GK  + +E+ + A+ +  + S+++   K  +L+ +E       +    P  +  +   + +  S RL+  S++TG+   + + +    +S L ++DV ++D    +F+++G  A+  EK  ++  +  YL+   HP
Sbjct:  396 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPN--YLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLGVHEPEA-PIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER-EMAKTVANIISKQD---KQTILEGQEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVVD--FCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HP 680          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 193.741 bits (491), Expect = 7.575e-53
Identity = 116/311 (37.30%), Postives = 166/311 (53.38%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIM-KGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLD-EEDTPLTHKIYKL--------LPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L IW +EK K+V  P++ YG FF GD YI+L          L  DIH+WIGK S+QDE G+AA+   ++D  L    IQHREV G ES  FKSYF    I  KGG  SGF+ V    Y  R L  H   +KHV   EV  S NS + GDVF+LD G    QWNG  SNK+E+++A    Q + + ER GR +  V+D E+D+P   +I           L D+   +K  +    + RLY + ++   +    ++     + +L+  D  ++D G   ++V+ G  +SP+EK  A S A  +++   +P
Sbjct:   38 PGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYTPNG-----LISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRL-LHVKGKKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 342          

HSP 2 Score: 103.605 bits (257), Expect = 1.305e-22
Identity = 75/296 (25.34%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD-EEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIEK ++       YG+F+ GD Y+IL    +   P   Y ++ W+G+ ++QDE    A++ V+LD    D+ +Q R   G E    ++ F    I+  G  S      PE    +L      ++ + +  EV    +SL+S DVF+L      + W GK  + +E+ + A+ +  + S+++   K  +L+ +E       +    P  +  +   + +  S RL+  S++TG+   + + +    +S L ++DV ++D    +F+++G  A+  EK  ++  +  YL+   HP
Sbjct:  419 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPN--YLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLGVHEPEA-PIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER-EMAKTVANIISKQD---KQTILEGQEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVVD--FCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HP 703          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 186.422 bits (472), Expect = 2.352e-50
Identity = 114/313 (36.42%), Postives = 168/313 (53.67%), Query Frame = 2
Query:  233 VTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIM-KGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD-EEDTPLTHKIYKL--------LPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            ++T    I   +K K+V  P++ YG FF GD YI+L  K+  N   L  DIH+WIGK S+QDE G+AA+   ++D  L    IQHREV G ES  FKSYF    I  KGG  SGF+ V    Y  R L  H   +KHV   EV  S NS + GDVF+LD G    QWNG  SNK+E+++  Q ++  + ER GR +  V+D E+D+P   +I           L D+   +K  +    + RLY + ++   +    ++     + +L+  D  ++D G   ++V+ G  +SP+EK  A S A  +++   +P
Sbjct:    3 LSTNKPLICSFQKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNG--LISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRL-LHVKGKKHVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRVTQSIR--DDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQKANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 310          

HSP 2 Score: 97.0561 bits (240), Expect = 1.702e-20
Identity = 84/364 (23.08%), Postives = 167/364 (45.88%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDT---EKLVKKT---------SSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHG-------FESDLFKSYFPVITIMKGGCESGFRQVTPEKYEP-RLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD-EEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            M KQ   NW+D   +     T    K+V++T           E  A  ++V   +  ++ +WRIEK ++       YG+F+ GD Y+IL    +   P   Y ++ W+G+ ++QDE    A++ V+LD    D+ +Q R   G       F   +   ++ ++ I+               + P +L      ++ + +  EV    +SL+S DVF+L      + W GK  + +E+ + A+ +  + S+++   K  +L+ +E       +    P  +  +   + +  S RL+  S++TG+   + + +    +S L ++DV ++D    +F+++G  A+  EK  ++  +  YL+   HP
Sbjct:  326 MFKQLFQNWRDVGETQGLGKTFSVGKIVEQTKFDVNQLYARPELAAEQRMVDDASG-NVEVWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPN--YLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQFADTILNQFYLILLII---------------FAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDER-EMAKTVANIISKQD---KQTILEGQEPAEFWVALGGKAPYASDKRFQEQAVQYSPRLFECSNQTGRFVMTEVVD--FCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HP 663          
BLAST of Gelsolin vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 181.415 bits (459), Expect = 4.325e-49
Identity = 114/313 (36.42%), Postives = 174/313 (55.59%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQ-VTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP--LTHKIYKLLPDTAVTKKVHKDLAISKR----LYRLSDETGKITFSLISEGKTP--KSMLKDNDVFMIDNG--RHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +  L IWRIE   +V  PK  YG F+ GD+Y++L    + NS   +YD+H+W+GK  +QDE   AA  TV+LD FL  K +Q+RE+ G ES  F  YF   I    GG  SGF+  VT E    RLLH     ++ V   EV  S ++ +SGD FI+D G   +QW G   NK E++KAAQ    + ++E+NGR +  V++E   P  LT K+    P              + R    LY +SD +G +  S+++E ++P  K+ML   + F++D+   + +FV+ G  A+ +E+K AM  A  ++++ ++P
Sbjct:   14 STGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSK--YYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIK--GRRVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEGSEPNELT-KVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAE-QSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 79.7221 bits (195), Expect = 4.412e-15
Identity = 87/305 (28.52%), Postives = 133/305 (43.61%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILD-NGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTP------LTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHM--FVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            I+R+E    V      +G+F+ GD YIIL    +         I+ W G ++T+DE   +A+ TV+LD  L D+A+Q R   G E     S F   P+I I K G      Q  P     RL            ++EV    + L+S DVF+L       ++W GK ++  E+ KAA+++  +      RCK   + E   P      L  K  K    +A+ +   K +    RL+  S++TG+                    V MI    H+  F++IG  A+  EKK ++  A  Y+ ETD
Sbjct:  398 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG------LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLI-IYKDGTSRKGGQTPPSAV--RLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSGYKWIGKGASGEEE-KAAEYIANVL-----RCKVSKIAEGQEPDEFWSALNGK--KKYQTSALLES--KSIVNPPRLFGCSNKTGRFLV----------------QVLMIRFLFHLKVFLWIGKDANEQEKKESLKSAKQYI-ETD 666          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 202.986 bits (515), Expect = 7.914e-58
Identity = 120/318 (37.74%), Postives = 184/318 (57.86%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF-PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAV---TKKVHKDLAISKR---LYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S +S ++GD FILD G   +QW G  SNK E++KA Q  + + ++ER+GR +  V +E   P    +  L P  A+   T+   K+ A ++R   LY++S+  G ++ SL++ E    +  L+  D F++D+GR   +FV+ G  A+ +E+K A+  A +++ +  +P
Sbjct:   18 EFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEP-EAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYP 332          

HSP 2 Score: 81.2629 bits (199), Expect = 9.026e-16
Identity = 57/165 (34.55%), Postives = 73/165 (44.24%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNG 736
            IWRIE    V      YG+F+ GDSYIIL   +      ++ Y+   W G +STQDE   +A  T +LD  L    +Q R V G E     S F   P+I I KGG      Q  P     RL     +       VEV     +L+S D F+L     A+ W G
Sbjct:  409 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMI-IYKGGTSRDGGQTAPASI--RLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVG 567          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 202.216 bits (513), Expect = 1.675e-56
Identity = 120/318 (37.74%), Postives = 184/318 (57.86%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAV---TKKVHKDLAISKR---LYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S +S ++GD FILD G   +QW G  SNK E++KA Q  + + ++ER+GR +  V +E   P    +  L P  A+   T+   K+ A ++R   LY++S+  G ++ SL++ E    +  L+  D F++D+GR   +FV+ G  A+ +E+K A+  A +++ +  +P
Sbjct:    7 EFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEP-EAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYP 321          

HSP 2 Score: 108.997 bits (271), Expect = 1.708e-24
Identity = 90/297 (30.30%), Postives = 132/297 (44.44%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      YG+F+ GDSYIIL   +      ++ Y+   W G +STQDE   +A  T +LD  L    +Q R V G E     S F   P+I I KGG      Q  P     RL     +       VEV     +L+S D F+L     A+ W G  +++ EK  A + L+ L S+     + +   E D        K    T+   K  K  A   RL+  S+  G+     +  G+  +  L  +DV ++D    +FV++G  +  +EK  A++ A  Y+ ETD
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMI-IYKGGTSRDGGQTAPASI--RLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVLRSQ---HVQVEEGSEPDAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVP-GELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYI-ETD 683          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 202.601 bits (514), Expect = 1.944e-56
Identity = 120/318 (37.74%), Postives = 184/318 (57.86%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAV---TKKVHKDLAISKR---LYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S +S ++GD FILD G   +QW G  SNK E++KA Q  + + ++ER+GR +  V +E   P    +  L P  A+   T+   K+ A ++R   LY++S+  G ++ SL++ E    +  L+  D F++D+GR   +FV+ G  A+ +E+K A+  A +++ +  +P
Sbjct:   56 EFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEP-EAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYP 370          

HSP 2 Score: 109.383 bits (272), Expect = 1.356e-24
Identity = 90/297 (30.30%), Postives = 132/297 (44.44%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIIL-KIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      YG+F+ GDSYIIL   +      ++ Y+   W G +STQDE   +A  T +LD  L    +Q R V G E     S F   P+I I KGG      Q  P     RL     +       VEV     +L+S D F+L     A+ W G  +++ EK  A + L+ L S+     + +   E D        K    T+   K  K  A   RL+  S+  G+     +  G+  +  L  +DV ++D    +FV++G  +  +EK  A++ A  Y+ ETD
Sbjct:  447 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMI-IYKGGTSRDGGQTAPASI--RLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVLRSQ---HVQVEEGSEPDAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVP-GELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYI-ETD 732          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 198.749 bits (504), Expect = 8.562e-55
Identity = 117/315 (37.14%), Postives = 177/315 (56.19%), Query Frame = 2
Query:  233 VTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLD---EEDTPLTHKI--YKLLP----DTAVTKKVHKDLA-ISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +TTP + IWRIE  ++V  P   +G FF+GD Y++L I K   S  L YDIH+WIG+ S+QDE G AA  T ++D +L  +A+QHREV G ES+ F+SYF   + I KGG  SG + V     + + L  H   +++V   EV+ S  S + GDVF+LD G    QWNG  SN+ E+++     +++ + ER GR    V+D   E D+P    I  + L P      A++  V +  A  + +LY +SD  GK+    ++     + +LK  D +++D G   +FV+ G  A+  E+  AMS A N++K   +P
Sbjct:   14 ITTPGIQIWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHK--TSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRL-LHVKGKRNVLAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQLMAIMNHVLGPRKELKAAISDSVVEPAAKAALKLYHVSDSEGKLVVREVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYP 325          

HSP 2 Score: 97.4413 bits (241), Expect = 8.536e-21
Identity = 80/300 (26.67%), Postives = 139/300 (46.33%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILK---IKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLT--HKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            +WRIE  ++V    +  G F+ GD Y++L    I ++++     Y ++ W G +++QDE   +AY+ V LD   +D+ +Q R   G E     S F    ++  G  S    + P     RL      +  + +  EV     SL+S DVFIL      + W GK  + +E+  A     ++ ++   R +  V+ E   P      +    P     +   ++  I+ RL+  S++TG+   + I +    +  L++ DVF++D    +F +IG  A+ +EKK A +    YLK   HP
Sbjct:  402 VWRIEDLELVPVESKWLGHFYGGDCYLLLYTYLIGEKQH-----YLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQGGTSRKNNLEPVP-STRLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDEREMA-----KMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENQVITPRLFECSNQTGRFLATEIFDFN--QDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLK--THP 686          
BLAST of Gelsolin vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 170.244 bits (430), Expect = 5.955e-49
Identity = 100/246 (40.65%), Postives = 142/246 (57.72%), Query Frame = 2
Query:  218 KLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAV---TKKVHKDLAISKRLYRL 940
            + +K    P L IWR+EKF +V  P   YG FF GD+Y+ILK  +  N   L YD+H+W+G   +QDE G AA  TV+LD +L+ +A+QHREV GFES  F  YF   +   KGG  SGF+ V P +   + L F    ++ V   EV  S +S ++GD FILD G   +QW G  SNK E++KA Q  + + ++ER+GR +  V +E   P    +  L P  A+   T+   K+ A ++RL +L
Sbjct:    7 EFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNG-NLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRL-FQVKGRRVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEP-EAMLQVLGPKPALPEGTEDTAKEDAANRRLAKL 249          
BLAST of Gelsolin vs. UniProt/SwissProt
Match: sp|Q24800|SEVE_ECHGR (Severin OS=Echinococcus granulosus OX=6210 GN=AG8 PE=2 SV=3)

HSP 1 Score: 352.058 bits (902), Expect = 1.299e-116
Identity = 178/358 (49.72%), Postives = 237/358 (66.20%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVI----TIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTP----LTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCL 1159
            ++K K Y+WKDSN+ LFGS  ++ VKK S+ TE  W+ V   T+P L +WR+ +F +   P ++ G F+NGDSY+I K  +     +L Y++HFWIGK ST DEYGTAAYKTVELDTFLDD A+QHREV G+ES LFKSYF  +     I+KGG  SGFR V P++Y PRLL F C + K   + +V FSK S+ SGDVFILD G  A+Q+NG   +  EK  AA FLQ LES+RNGRC T VLDE DTP    + H+ +  LPD  V K++     + K LY+LSD +GK+  +++SEG   K  +K +DV++I     +FVYIG   S  EK+NA+S AH +L+   +P + IT +
Sbjct:    4 LVKAKDYDWKDSNMELFGSSKDRQVKKESAMTEKCWEPVGRATSPFLMVWRVNQFTLEPVPSDEIGNFYNGDSYVICKATRSPGGDKLLYNVHFWIGKHSTADEYGTAAYKTVELDTFLDDAAVQHREVEGYESQLFKSYFDKLVILKVILKGGYASGFRHVKPDEYRPRLLRF-CKEGKTTYMRQVAFSKQSVHSGDVFILDLGSRAYQFNGSKCSAFEKSSAAAFLQDLESKRNGRCNTSVLDEADTPQDVGVLHEFWTALPDVPV-KELEPPKEVIKSLYKLSDSSGKLELTIVSEGSASKHDIKPDDVYIILTKEGLFVYIGKDCSVLEKRNALSNAHKFLQTCPNPFLPITVV 359          
BLAST of Gelsolin vs. UniProt/SwissProt
Match: sp|Q8MPM1|GELS2_LUMTE (Gelsolin-like protein 2 OS=Lumbricus terrestris OX=6398 GN=gelsolin PE=1 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 1.222e-110
Identity = 183/365 (50.14%), Postives = 231/365 (63.29%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIY-KLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQL 1198
            ++K K+Y+WKDSNL++FGS  +K VKK S+  EAAWK V       L IWRI  FKV  WP++DYG FF+GDSYIIL   K +   EL YD+HFWIG +STQDEY  AAYKTVELD +LDD AIQHR+  G ESDLF SYF   +TIM+GG E GF  V PE+Y+ RLLHF    +KH+ + EV      L S DVFILD G   +QWNG  SNK+E+ KA Q+LQ L++ER G   +  L+EE    +H+ Y  L  +     +   D A  K L R+SD  G    +++  G    S L   DVF++DNG   FV++G GAS  EK+N + YAH++L +T HPLI I   Q GQ SK F   L
Sbjct:    4 LVKAKRYDWKDSNLAMFGSALDKSVKKESALKEAAWKGVGEKV--GLKIWRIVNFKVTEWPEKDYGSFFSGDSYIILNTYKLKGREELAYDVHFWIGSKSTQDEYCVAAYKTVELDAYLDDAAIQHRDAEGNESDLFLSYFENGLTIMEGGAEMGFNNVKPEEYKARLLHF-SGLKKHIVVKEVPLCPQRLKSDDVFILDLGRTLYQWNGTGSNKDERFKAMQYLQNLKAER-GAATSKTLEEEHIDKSHEFYTSLTGEDEDLPEDQTDSAAVKTLLRVSDAAGHFKSTVVKTGHIAASDLDSKDVFILDNGSTCFVWVGNGASAQEKRNGLGYAHSHLMKTPHPLIPILRHQRGQASKCFNAAL 364          
BLAST of Gelsolin vs. UniProt/SwissProt
Match: sp|Q7JQD3|GELS1_LUMTE (Gelsolin-like protein 1 OS=Lumbricus terrestris OX=6398 GN=AM PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.390e-105
Identity = 173/369 (46.88%), Postives = 230/369 (62.33%), Query Frame = 2
Query:   98 LTIDMIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKI-KKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQL 1198
            +   +IK K+Y+WKDSNL+LFGSDTEK VKK S+ TE AWK         L IWRI  FKV  WP+  +GKF+NGDSYIIL   K +  S EL YD+HFWIG +S+QDEYGTAAYKTVELDTFLDDK +QHREV G+ES+LF++YF   +TI++GG E+GF  V P +Y+PRLLHF    ++ + + EV   K  LD  DVFILD GL  +QWNGK S+K E  KA Q+L  + SER  + + + L++E TP +HK Y  L  T     V   +    +L ++SD  G +  + +  G         NDVF++D G   FV++G G     +      +H +L +T HPL  I  ++ GQ  K F + +
Sbjct:    1 MATGLIKAKEYDWKDSNLALFGSDTEKQVKKDSAATEPAWK--GAGQKEGLKIWRIVNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFWIGSQSSQDEYGTAAYKTVELDTFLDDKPVQHREVQGYESELFRNYFKQGLTILEGGAETGFHHVKPTEYKPRLLHF-SGQKQQIYVHEVPLVKERLDHKDVFILDLGLTLYQWNGKESSKEEGFKAMQYLGLMRSERP-KAEAETLEDESTPESHKFYTSLTGTDEPNLVKPLVKEENQLLKVSDAGGHLKTTEVKRGAVNSKDFSSNDVFILDTGDQCFVWVGKGRFAVGEAEWTRISHAHLMKTCHPLAPIHVIKEGQLCKAFNVAI 365          
BLAST of Gelsolin vs. UniProt/SwissProt
Match: sp|P10733|SEVE_DICDI (Severin OS=Dictyostelium discoideum OX=44689 GN=sevA PE=1 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 4.738e-90
Identity = 155/339 (45.72%), Postives = 212/339 (62.54%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAI--SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYL 1120
            MIK +K +   +N++  G+D +K  +  ++ TEA WK V     P L IWRIE FKVV  P+  YGKF++GDSYIIL   KE NS  L +DIHF++G  +TQDE GTAAYKTVELD FL    IQ+R+   +ES  F S FP   I+ GG ESGF  V P +Y+PRLLH   +  K+ ++ EV  + +SL+SGD F+LD GL  +Q+NG  S+  EK KAA+  + +++ER G  K +V  E D+ +  + +KLL         H+       K LY+LSD +G + FS +S GK  KS LK  DVF+ID G  ++ +IG+ +SP+EKK A S+A  YL
Sbjct:    1 MIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQA--PGLKIWRIENFKVVPVPESSYGKFYDGDSYIILHTFKEGNS--LKHDIHFFLGTFTTQDEAGTAAYKTVELDDFLGGAPIQYRQCQSYESPSFLSLFPKYFILSGGVESGFNHVKPTEYKPRLLHI--SGDKNAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLGGKGAIAAKHETAPTKSEKVLYKLSDASGSLKFSEVSRGKINKSSLKSEDVFIIDLGNEIYTWIGSKSSPNEKKTAFSHATQYL 333          
BLAST of Gelsolin vs. UniProt/SwissProt
Match: sp|Q10L71|VLN2_ORYSJ (Villin-2 OS=Oryza sativa subsp. japonica OX=39947 GN=VLN2 PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.958e-57
Identity = 116/310 (37.42%), Postives = 180/310 (58.06%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF-PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLD------EEDTPLTHKIYKLLPDTAVTKKVHKDLAI---SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P   IWRI+ FK V  PK DYGKF+NGDSYI+L+    +      +DIHFWIGK S+QDE GTAA KTVELDT L  +A+QHRE+ G+ESD F SYF P I  ++GG  SGF+    +K+E RL  + C  ++ + + EV F+++SL+  DVFILD   + +Q+NG  SN  E+ KA + +Q L E+  NG C   ++D      E D+     ++              D+ +   + +LY +++   K+  ++++     KS+L++N  F++D G  +F+++G     +E+K A +    ++   + P
Sbjct:   19 PGTEIWRIQDFKPVPLPKADYGKFYNGDSYIVLQTTCSKGGGAYLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHRELQGYESDKFLSYFKPCIIPLEGGFASGFKTPEEDKFETRL--YICKGKRAIRVKEVPFARSSLNHDDVFILDTEKKIYQFNGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKAICDDDVVLETTAPKLYSINNGQLKLEDTVLT-----KSILENNKCFLVDCGSDLFIWVGRLTQVEERKAASAAVEEFIATQNRP 321          

HSP 2 Score: 73.9442 bits (180), Expect = 1.796e-12
Identity = 74/289 (25.61%), Postives = 122/289 (42.21%), Query Frame = 2
Query:  290 PKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEK------YEP---RLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEK---VKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVT-KKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNY 1117
            PKE+ GKF++GD YI+L      +  E FY + +WIGK S  ++   A      +   L  + I  R   G E   F + F  + I+KGG  SG+++   EK      Y      L         + ++++V    ++L   D F+L +G   F W G  S+  ++    K A+FL+   + ++  CK      E T  +   + L      T +    D+     LY  S   GK+  + I      +  L   D+ ++D    +FV++G      EK+ A      Y
Sbjct:  411 PKEELGKFYSGDCYIVLYTYHSGDKREEFY-LTYWIGKDSIPEDQEMAFQTANSIWNSLKGRPILGRIYQGKEPPQFIALFQPMVILKGGISSGYQKFVEEKGLKDETYSGDGIALFRISGTSIHNNKVLQVDAVSSNLSPTDCFVLQSGNSMFTWIGNASSYEQQQWAAKVAEFLKPGVAVKH--CK------EGTESSAFWFALGGKQNYTSRNATHDVVREPHLYTFSLRNGKLEVTEIF--NFSQDDLLTEDMMVLDTHGEVFVWMGQCVDAKEKQKAFEIGQKY 688          
BLAST of Gelsolin vs. TrEMBL
Match: A0A1I8GFK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019412g3 PE=4 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 7.658e-153
Identity = 217/368 (58.97%), Postives = 276/368 (75.00%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKK---VHKDLAISKR-LYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            M K +KY+WKDSNL+LFGS TEK VKK +SE E AW+ VK  T+  LF+WRIEKFKV  WPKEDYGKFF+GDSYI+L + K+ +  EL YD+HFWIGK STQDEYGTAAYKTVELDTFLDDKA+QHREV   ES +FKSYF  IT +KGGC +GFRQV PE+Y+PRLLHF C  ++++E+ EVK ++ +L+S DVFILD G  A+QWNGK  NK+E++KAA FLQQLE+ER+G+ +T  LDE      HK Y+ LPD    KK   V  D+   K+ ++RLSDE+GK+ +SL+SEG  P+SM+ ++DV++ID G  +FVY+GA AS  EK NA+ YAH+YLK T HPLI +T  +    + + E  LD
Sbjct:    1 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHF-CGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLENERHGKTQTFTLDENSIGSEHKFYQSLPDVPYAKKSSEVKSDVRSGKKAMFRLSDESGKLQYSLVSEGNCPRSMINEDDVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQMEKVLD 367          
BLAST of Gelsolin vs. TrEMBL
Match: A0A1I8JDB7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 9.498e-143
Identity = 211/368 (57.34%), Postives = 265/368 (72.01%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKK---VHKDLAISKR-LYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            M K +KY+WKDSNL+LFGS TEK VKK +SE E AW+ VK  T+  LF+WRIEKFKV  WPKEDYGKFF+GDSYI+L + K+ +  EL YD+HFWIGK STQDEYGTAAYKTVELDTFLDDKA+QHREV   ES +FKSYF  IT +KGGC +GFRQV PE+Y+PRLLHF C  ++++E+ EVK ++ +L+S DVFILD G  A+QWNGK  NK+E++KAA FLQQLE+ER+G+ +T  LDE      HK Y+ LPD    KK   V  D+   K+ ++RLSDE+GK+ +SL              DV++ID G  +FVY+GA AS  EK NA+ YAH+YLK T HPLI +T  +    + + E  LD
Sbjct:    1 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHF-CGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLENERHGKTQTFTLDENSIGSEHKFYQSLPDVPYAKKSSEVKSDVRSGKKAMFRLSDESGKLQYSL--------------DVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQMEKVLD 353          
BLAST of Gelsolin vs. TrEMBL
Match: A0A094ZM00 (Severin OS=Schistosoma haematobium OX=6185 GN=MS3_03937 PE=4 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 2.990e-139
Identity = 201/364 (55.22%), Postives = 264/364 (72.53%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            ++ +K Y+WKD+NL+LFGSD E+ VKK S+E E AW  V+ + + +L +WRI+ F++     ED GKFF GDSYI+L  +K  +  EL YD+HFWIG+ ST DEYGTAAYKTVELDTFLDDKA+QHREV GFESDLFK+YF     + GG  SGF  V P +Y PRLL FH  D+K++EL+EV FS+ SLDS DVFILD G EA+QWNG+   K EK +A+QFLQQLES+RNGRCKT+V DE+ +    K   LLPD A+ KKV + +   K +YR+SDE+GK+  SL+ E   PK+ L +NDV++ID+G+ +FVYIG   S  EK +A+S+AH+YL++TDHP   IT +   + SKE +  L+
Sbjct:    4 LVSEKVYSWKDTNLALFGSDVERAVKKESAEKEPAWGPVRKIASSTLMVWRIKNFQLEVVRGEDIGKFFRGDSYIVLNTEKVGD--ELLYDVHFWIGRESTADEYGTAAYKTVELDTFLDDKAVQHREVDGFESDLFKTYFNRFETLAGGYASGFNHVKPNEYRPRLLLFHSVDRKNMELIEVPFSRRSLDSTDVFILDMGTEAYQWNGRGCTKEEKFRASQFLQQLESDRNGRCKTEVTDEDGSEEHKKFISLLPDVAIEKKVEQKIG-KKVIYRVSDESGKMEISLVCENALPKASLTENDVYLIDSGQSLFVYIGVKCSRREKLDALSHAHDYLQKTDHPFAPITVVSNNRKSKELDKLLE 364          
BLAST of Gelsolin vs. TrEMBL
Match: G4VIJ1 (Putative gelsolin OS=Schistosoma mansoni OX=6183 GN=Smp_008660.1 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 4.391e-138
Identity = 201/364 (55.22%), Postives = 263/364 (72.25%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            ++  K Y+WKD+NL+LFGSD E+ VKK S+E E AW  V+ +T+P+L +WRI+ F++     ED GKFF GDSYI+L I+K  +  EL YD+HFWIG+ ST DEYGTAAYKTVELDTFLDDKA+QHREV GFESDLFK+YF     + GG  SGF  V P +Y PRLL FH  D+K +EL+EV FS+ SLDS DVFILD G +A+QWNG+  +K EK KA+QFLQQLE +RNGRCKT+V DE+ +    K   LLPD  + +KV + +   K +YR+SDE+GK+  SL+ E   PKS L ++DV++ID+G+ +FVYIG   S  EK +A+S+AH YL++TDHP   IT +   + SKE +  L+
Sbjct:    4 VLAAKMYSWKDTNLALFGSDIERAVKKESAEKEPAWGPVRKITSPTLMVWRIKNFQLEVVRGEDIGKFFRGDSYIVLNIEKVGD--ELLYDVHFWIGRESTADEYGTAAYKTVELDTFLDDKAVQHREVDGFESDLFKTYFNRFETLAGGYASGFNHVKPNEYRPRLLMFHSVDRKTMELIEVPFSRRSLDSTDVFILDMGNQAYQWNGRGCSKEEKFKASQFLQQLECDRNGRCKTEVTDEDGSEEHKKFISLLPDVEIGEKVQQKIG-KKVIYRVSDESGKMEISLVCENALPKSSLTEDDVYLIDSGQSLFVYIGVKCSRREKLDALSHAHEYLQKTDHPFAPITVVSNNRKSKELDKVLE 364          
BLAST of Gelsolin vs. TrEMBL
Match: A0A1I8GS75 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 1.605e-137
Identity = 203/364 (55.77%), Postives = 259/364 (71.15%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            M K +KY+WKDSNL+LFGS TEK VKK +SE E AW+ VK  T+  LF+WRIEKFKV  WPKEDYGKFF+GDSYI+L +  + +  EL YD+HFWIGK STQDEYGTAAYKTVELDTFLDDKA+QHREV   ES +FKSYF  IT +KGGC +GFRQV PE+Y+PRLLHF C  ++++E+ EVK ++ +L+S DVFILD G  A+QWNGK  NK+E++KAA FLQQLE     R +        +P         P T+ T+   +     +   RLSDE+GK+ +SL+SEG  P+SM+ ++DV++ID G  +FVY+GA AS  EK NA+ YAH+YLK T HPLI +T  +    + + E  LD
Sbjct:   48 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVTPDGD--ELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHF-CGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLEKSATARRRL-------SPWMRTASA--PSTSSTRAC-RTCPTPRNPRRLSDESGKLQYSLVSEGNCPRSMINEDDVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQMEKVLD 398          
BLAST of Gelsolin vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 197.593 bits (501), Expect = 5.003e-55
Identity = 124/312 (39.74%), Postives = 183/312 (58.65%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF-PVITIMKGGCESGFRQ-VTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL---PDT--AVTKKVHKDLAISK--RLYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGRH--MFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L +WRIEKF +V  P+  YG F+ GD+Y+IL   K+  S  L YD+HFW+G   TQDE G+AA  TV++D +L  K IQ+REV GFES  F  YF   +  MKGG  SGF+  VT E    R+L      ++ V   EV  S +S ++GD FILD G E +QW G  SN+ EK+K+ Q  + + ++ER+GR +  V DE       KI ++L   PD        +  D +  K  +LY++SD +G +T +L++ E    +S L+  D F++D+G +  +FV+ G  A+ +E+K AM  A  ++K+  +P
Sbjct:   14 PGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQ-RSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVK--GRRVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDE--GVEREKILEVLGEKPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYP 320          

HSP 2 Score: 93.2041 bits (230), Expect = 1.369e-19
Identity = 86/298 (28.86%), Postives = 129/298 (43.29%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD--EEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      +G+F+ GDSYIIL   +  +     + I+ W G  STQDE G +A    +LD  L    +Q R V G E     S F   P++    G    G +    E    RL             VEV    ++L+S D FIL     +F W G  ++ +EK  A      L     G   +++ +  E D        K    T+   K   D+    RL+  S++TG+     +  G+  +  L  +DV ++D    +FV++G  A  +EK  A++ A  Y+ ETD
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYR--HGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEKQGAQGLCDIL-----GVSASEITEGGESDDFWAALGGKAAYRTSTRLKDKMDVH-PPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYI-ETD 681          
BLAST of Gelsolin vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 197.593 bits (501), Expect = 6.513e-55
Identity = 124/312 (39.74%), Postives = 183/312 (58.65%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF-PVITIMKGGCESGFRQ-VTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL---PDT--AVTKKVHKDLAISK--RLYRLSDETGKITFSLIS-EGKTPKSMLKDNDVFMIDNGRH--MFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L +WRIEKF +V  P+  YG F+ GD+Y+IL   K+  S  L YD+HFW+G   TQDE G+AA  TV++D +L  K IQ+REV GFES  F  YF   +  MKGG  SGF+  VT E    R+L      ++ V   EV  S +S ++GD FILD G E +QW G  SN+ EK+K+ Q  + + ++ER+GR +  V DE       KI ++L   PD        +  D +  K  +LY++SD +G +T +L++ E    +S L+  D F++D+G +  +FV+ G  A+ +E+K AM  A  ++K+  +P
Sbjct:   14 PGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQ-RSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVK--GRRVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDE--GVEREKILEVLGEKPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYP 320          

HSP 2 Score: 85.5001 bits (210), Expect = 4.137e-17
Identity = 86/307 (28.01%), Postives = 128/307 (41.69%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAI---------QHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLD--EEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWRIE    V      +G+F+ GDSYIIL      +     + I+ W G  STQDE G +A    +LD  L    +         Q R V G E     S F   P++    G    G +    E    RL             VEV    ++L+S D FIL     +F W G  ++ +EK  A      L     G   +++ +  E D        K    T+   K   D+    RL+  S++TG+     +  G+  +  L  +DV ++D    +FV++G  A  +EK  A++ A  Y+ ETD
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIIL--YNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVAGVPITTQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEKQGAQGLCDIL-----GVSASEITEGGESDDFWAALGGKAAYRTSTRLKDKMDVH-PPRLFACSNKTGRFIIEEVP-GEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYI-ETD 690          
BLAST of Gelsolin vs. Ensembl Cavefish
Match: gsnb (gelsolin [Source:NCBI gene;Acc:103027267])

HSP 1 Score: 189.119 bits (479), Expect = 7.058e-52
Identity = 116/317 (36.59%), Postives = 179/317 (56.47%), Query Frame = 2
Query:  227 KTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLL---PDTAVTKKVHKDLAISKR----LYRLSDETGKITFSLISEGKTP--KSMLKDNDVFMIDNGRH--MFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            K    P L +WRIEK  +V+ P+  YG F+ GD+YI+L   K+     L YD+HFW G+  T DE   AA  TV++D FL    +Q+REV G+ES  F  YF   +  M+GG  SGFR VT ++ E R    H   ++ V   EV  S +S + GD FILD G E +QW G  SN  E++KA    + + ++ER GR K  V +E   P   K+ ++L   P+   T     ++  S R    LY++SD +G ++ +LI+ G+ P  ++ L+ +D F++D+G +  +F + G GA+P+E+   M  A  ++++  +P
Sbjct:    9 KAGQQPGLQVWRIEKMDLVSVPENLYGSFYTGDTYIVLNTIKQHLG-NLQYDLHFWQGEICTTDESAAAAIFTVQMDDFLGGSPVQYREVQGYESKTFVGYFKSGMKYMQGGVASGFRHVTGDE-EGRQRVLHVTGRRIVRATEVPLSWDSFNKGDCFILDLGEELYQWCGSKSNHFERLKATNISKTIRDNERRGRAKLHVCEEGAEP--DKMLEILGPKPELPDTDCDDTEIDASNRKMAKLYKVSDASGDMSVTLIA-GENPFFQNALESSDCFILDHGSNGKIFFWKGKGANPEERSAGMKAAEEFIQKMGYP 320          

HSP 2 Score: 103.219 bits (256), Expect = 9.751e-23
Identity = 92/301 (30.56%), Postives = 142/301 (47.18%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKI-YKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLI 1144
            IWRIE  + V+    +YG+F+ GDSYII    +          I+ W G+ S+QDE G ++    +LD  L   A+Q R V G E     S F   P++ + KGG      Q   E  E RL     +   H   VEV    ++L+S D FIL N   +  W GK ++  EK  A Q  + L+ E +   + +  D     L  K  Y+    T+   K   D +   RL+  S++TG+     +  G+  +  L  +DV ++D    +FV+IG  A+ +EK  A++ A  Y++   HP +
Sbjct:  397 IWRIEGSEKVDVDPSNYGQFYGGDSYIIQYSYQHGGRHGQI--IYIWQGELSSQDEKGASSILAAQLDEELGGGAVQVRVVQGKEPPHLMSVFGEKPIV-VYKGGTSRQGGQ--SEAAEIRLFQVRSSTAGHTRAVEVDAVASNLNSNDAFILVNPSGSVLWVGKGTSDAEKHGAKQLSEILQVEVSEVVEGEEGDTFWEALGGKTEYR----TSERLKSKMD-SHPPRLFACSNKTGQFRIEEVP-GEMTQEDLAPDDVMLLDTWDQVFVWIGKEANEEEKTEAVTSAARYIE--THPAV 684          
BLAST of Gelsolin vs. Ensembl Cavefish
Match: scin (scinderin [Source:NCBI gene;Acc:103042167])

HSP 1 Score: 188.734 bits (478), Expect = 7.181e-52
Identity = 110/310 (35.48%), Postives = 178/310 (57.42%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF-PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP--LTHKI--YKLLPDTAVTKKVHKDLAISK--RLYRLSDETGKITFSLISEGKTP--KSMLKDNDVFMIDNGRHMFVYI--GAGASPDEKKNAMSYAHNYLKETDHP 1138
             L IWRIE  ++   P+  +G F+ GD+Y+IL+  K+++    FYD+HFW+GK  TQDE   AA  TV++D +L  K +Q+RE+ G ES  F SYF   IT   GG  SGF+ V       + L FH   ++ V   +V    NS ++GD FI+D G   +QW G   N+ E++KA Q    + ++ERNGR +  ++++   P  LT  +     LPD      +  D++  +  +LY +SD +GK+  SL+SE + P  ++ L  ++ F++D+G+   +Y+  G  A+P+E+K AM  A  ++++  +P
Sbjct:   16 GLQIWRIENMELAPVPESLHGNFYVGDAYLILRTVKQKDVS--FYDLHFWLGKECTQDESTAAAIFTVQMDDYLGGKPVQYRELQGCESTAFTSYFKGGITYKTGGVSSGFQHVVTNDLSAQRL-FHIKGRRTVRATQVPLDWNSFNTGDCFIVDLGAIIYQWCGSKCNRFERLKATQVANSIRDNERNGRAQVVIVEDGHEPGQLTSVLGDKPTLPDEDDNDDIAADMSNRRMAKLYMVSDASGKMQVSLVSE-ENPFSQTHLLSDECFILDHGKSKMIYVWKGRNANPNERKEAMKTAEGFIQQMGYP 321          

HSP 2 Score: 79.337 bits (194), Expect = 3.916e-15
Identity = 85/304 (27.96%), Postives = 137/304 (45.07%), Query Frame = 2
Query:  254 IWRIE-----KFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGC-ESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILD--NGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLL---PDTAVTKKVH-KDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYL 1120
            IWR+E     + K+   PK  YG+F+ GD YIIL   K          I+ W G  ST DE   +A+ TVELD  L   A+Q R   G E     S F   P++    G   E G     P     RL            + EV    +SL+S D ++L    G E + W GK +++ E+    +++ +L      +CK   + E   P     +K L    +   ++++  K +  + RL+  S++TG+     +  G+  +  L ++DV ++D    +FV+IG  A+  EK  ++  A  Y+
Sbjct:  398 IWRVETCNKGESKIPVDPKT-YGQFYGGDCYIILYTYKRGQI------IYTWQGSCSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPAHLLSLFKAKPLVVYKNGTSREGGQAPAAP----TRLFQVRRNLGTITRISEVDAVASSLNSNDAYLLKVPEG-EGYMWVGKGASEEEE-HGVKYMSELL-----QCKMKRITEGQEP--GDFWKALGGKTEYQTSERLESKTITHAPRLFGCSNKTGRFIIEEVP-GEFNQDDLAEDDVMLLDVWDQVFVWIGKDANEVEKMESVKSAKMYI 680          
BLAST of Gelsolin vs. Ensembl Cavefish
Match: scinlb (scinderin like b [Source:ZFIN;Acc:ZDB-GENE-040426-2068])

HSP 1 Score: 181.8 bits (460), Expect = 1.878e-49
Identity = 113/312 (36.22%), Postives = 171/312 (54.81%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQ-VTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP------LTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTP--KSMLKDNDVFMIDNG--RHMFVYIGAGASPDEKKNAMSYAHNYLKETDH 1135
             P L +WRIE   +   PK  YG F+ GD+Y++L      +     Y IH W+G   +QDE G AA  + +LD FL    +Q+REV   ES  F  YF   I   KGG  SGF+  VT +    RLLH     ++ +   EV FS  S + GD FI+D G + +QW+G   N+ EK+KA++    + ++ERNGR K  ++DE   P      L  K   + P TA  ++V K       LY +SD TG +  S++++  +P  ++ML D + +++DNG   ++FV+ G  A+PDE+K AM  A +++K  ++
Sbjct:   13 APGLQVWRIENMDLKPVPKNLYGNFYTGDAYLLLHTTTAPS-----YSIHMWLGDECSQDESGAAAIFSTQLDDFLGGSPVQYREVQNNESVSFLGYFKSGIKYKKGGVASGFQHVVTNDANVKRLLHVK--GRRAIRATEVDFSWGSFNQGDCFIVDLGKDVYQWSGSGCNRFEKLKASEVAIDIRDNERNGRAKLHMVDEGAEPQAIIDALGAKP-AIAPATADDEQVDKSNKTKGALYMISDATGSMKTSVVAQ-SSPFKQAMLSDEECYILDNGADNNVFVWKGPKANPDERKAAMKVAQDFIKSKNY 315          

HSP 2 Score: 63.5438 bits (153), Expect = 3.344e-10
Identity = 68/277 (24.55%), Postives = 117/277 (42.24%), Query Frame = 2
Query:  383 IHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHR--EVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTA--VTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKE--TDHPLIGITCLQAGQHSKEF 1186
            I+ W G +STQDE   +A+ TV+LD  +    +Q R        +    S F   P++    G   +G +    +    RL H   +         V  S +SL++ DVF+L      F W G  ++ +E   A   +  L     G   TDV + ++       +  L   A   + K  + +  + RL+  S++TG++    +  G   +S L  +DV ++D    +F+++G  A+  EK  A   A  Y+    +    I IT ++ G     F
Sbjct:  419 IYTWQGLKSTQDELAASAFLTVQLDDSMGGAPVQVRITSRRMLPAPTLMSLFKGKPMVIHSGGTSRAGGQS---QAGGTRLFHIRTSSPPG---PPVNPSASSLNTNDVFVLKTPDSLFVWRGVGASADESDAAKHVVSFL-----GGKPTDVAEGKE---PAGFWSALGGKAEYQSSKTLQKVVKTPRLFGCSNKTGRLVVEEV-PGDFTQSDLATDDVMLLDTWDQIFLWVGNDANEVEKTGAPKIAKEYVDSDPSGRRGIPITTIKQGAEPPTF 680          
BLAST of Gelsolin vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 192.2 bits (487), Expect = 3.158e-53
Identity = 109/317 (34.38%), Postives = 167/317 (52.68%), Query Frame = 2
Query:  239 TPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISK-------------RLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGR-HMFVYIGAGASPDEKKNAMSYAHNYLKETDHPL 1141
            +  L IWR+EK ++   P++ YG FF GD YIIL  KK  +SP   YD+H+W+G+ S+QDE   AA  T +LD  L    +QHRE  G ES++F+ YF   +   KGG  SGF       Y  + L  H   +K V   EV  S +S   GDVF+LD G    QWNG  SN+ EK+K  Q    + + ER GR +  V++  D   + ++  +L  TA   + H DL+                +LY +S++ G +    ++     + +L  +D +++D G   ++V+ G G+S +E++ AM  A  Y+K   +P+
Sbjct:   11 SAGLHIWRVEKMELAAVPQKAYGSFFEGDCYIILSAKKAGSSPTPTYDVHYWVGQESSQDEQAAAAMYTTQLDDALGGFPVQHREYQGHESEVFRGYFKSGVVYKKGGVASGFHHTETNSYNVQRL-LHIKGRKAVTATEVNLSWDSFSRGDVFLLDLGKVIIQWNGPDSNRVEKIKGMQLASDIRDRERGGRAQIGVVEGNDEDSSPELMAVL--TAALGERHGDLSPGSPDEPTDHSRKANVKLYHVSEKGGNLMVEEVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGYPV 324          

HSP 2 Score: 114.39 bits (285), Expect = 5.354e-27
Identity = 88/311 (28.30%), Postives = 148/311 (47.59%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIM-----KGGCESGFRQVTPEKYEP--RLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLA-ISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYL------KETDHPLI 1144
            ++RIE  ++    K  +G+F+ GD Y++L      N  +L Y ++ W G+ +TQDE   +AY+ V LD     + +Q R V G E   F + F    I+     +GG              P  RL      D+ + + VEV    ++L+S DVF+L+  +  F W GK  + +E+  A      L      R K  VL+ ++ P            A  K++  + A +  RL+  S +TG+   + IS+    +  L ++DV ++D    +F+++G GAS  EKK +M+ A +YL      ++ D P+I
Sbjct:  400 MFRIEDLELKPVEKRLHGQFYGGDCYLVLYTYTSNN--KLAYLLYMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGTDEFNTKAVEVPARASALNSNDVFVLNAEVACFLWCGKGCSGDEREMARSLADGLTR----RDKQTVLEGQEPPEFWAALGGKAPYASEKRMQVEEAEVQPRLFECSTQTGRFVVTEISD--FSQDDLDEDDVMLLDTWDQVFLWVGQGASDAEKKESMTTAADYLRTHPGARDPDTPII 702          
BLAST of Gelsolin vs. Ensembl Sea Lamprey
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 164.081 bits (414), Expect = 2.273e-47
Identity = 85/204 (41.67%), Postives = 118/204 (57.84%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEEDTP 847
            P L +WR+EK  +V  PKE YG F+ GD+Y++L       +  + YD+HFW+G   +QDE G AA  TV++D  L  + +QHREV GFES  F  YF   I    GG  SGFR V P   + + L  H   ++ V   EV  S  S + GD FI+D G   +QW G  SN+ E++KA Q  + + ++ER+GR + DVL+E   P
Sbjct:   14 PGLQVWRVEKLDLVAVPKELYGSFYTGDAYVLL-FSVRNRAGNMQYDLHFWLGNECSQDESGAAAIFTVQMDDHLGGQPVQHREVQGFESTAFSGYFKNGIKYKPGGVASGFRHVVPNLVDVKRL-LHVKGRRTVRATEVPLSWASFNQGDCFIVDLGANIYQWCGSKSNRFERLKATQVAKGIRDNERSGRARVDVLEEGMQP 215          
BLAST of Gelsolin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.651e-15
Identity = 53/149 (35.57%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDY-GKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFP-VITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLD 682
            P + +W IE F V    +E Y GKF++ D YI+L+   +EN   + ++I++WIG ++T D+   AA   V L  FL  +    RE    ES+ F + F   I+ ++GG  SGF  V    +  RL   H     H+E V +K S  SLD
Sbjct:  498 PGVSVWHIENF-VPQLTEEYYHGKFYDADCYIVLRTFIDENG-AIAWEIYYWIGAKATLDKKACAAIHAVNLRNFLGAEGRSQREEMDDESEEFLAVFDGSISYIEGGTSSGFFTVEENAHIIRLYRCHGTQSIHLEAVALKGS--SLD 642          
BLAST of Gelsolin vs. Ensembl Nematostella
Match: EDO40348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K4])

HSP 1 Score: 369.392 bits (947), Expect = 7.079e-125
Identity = 191/365 (52.33%), Postives = 255/365 (69.86%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDE---EDTPLTHKIYKLLPDTAVT-KKVHKDLAISKRLYRLSDETGKITFSLISEGK-TPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFE 1189
            + KQK+Y+WKDSNL+LFGSDTEK VKK S++TE AW  +     P + IWRI KFKV  WP+E+YG F+NGDSYIIL+ KKE  + EL +D+HFWIGK+ST DEYGTAAYKTVELDTFLDDK +QHREV G ESDLFKSYF  +T++ GG ESGF+ V P++Y PRL      ++K+V L  ++  K +L + D FI+D GLE FQWNG  +NK EK KA +  +   S+R G+ +  VLD+   E      ++  +LPD   + KK        K L+ LSD TG++  + I+ GK   +S+LK++DV++ D+GRH +VY+G  AS DE++NAM+YAHNYL  T+HPL+ +T +  GQ S +FE
Sbjct:    4 LRKQKEYDWKDSNLALFGSDTEKNVKKESAQTETAW--IGAGEKPGMKIWRIVKFKVTKWPEENYGSFYNGDSYIILRTKKE--NEELVHDVHFWIGKKSTADEYGTAAYKTVELDTFLDDKPVQHREVEGHESDLFKSYFSEMTLLDGGAESGFKHVGPKEYTPRLFLVR-GNKKNVTLTNIELVKGNLTNDDCFIIDLGLELFQWNGIDANKEEKWKAGEICRDWRSKRGGKPRHIVLDDCTVEKIEELEELEGILPDGENSFKKQAGSEPSEKVLFSLSDRTGQLQCNEIARGKEVKRSLLKEDDVYIFDSGRHCYVYVGKAASIDERRNAMTYAHNYLMRTEHPLLPVTVINGGQKSVDFE 363          
BLAST of Gelsolin vs. Ensembl Nematostella
Match: EDO49235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV0])

HSP 1 Score: 346.28 bits (887), Expect = 1.060e-115
Identity = 183/367 (49.86%), Postives = 237/367 (64.58%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISK--------RLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEF 1186
            + KQK+  WKD+NL+LFGSD EK VK+ ++ TE AWK     T   L IWRIEKFKV  W +EDYG F++GDSYIIL   KE    EL YD+HFWIGK STQDEYGTAAYKTVELD  L+DK IQHREV GFES LFKSYF  +TI+KGG +SGFR V P++Y+PRLL        +  + EV  +++SL S DVFILD GL  + W G   +K+EK +  Q + +++SERNG+ K++V DE         YKLLP+ +   K  +D +  K         LYR+SD +GKI  + I +G+  +    + DVF+ D GRH+FVY G  AS DE++ A+   HN+L  TDHP   I+ +  G+   EF
Sbjct:    4 LRKQKQPEWKDTNLALFGSDIEKNVKREAAATEIAWK--NAGTREGLQIWRIEKFKVKVWSREDYGSFYDGDSYIILNTYKESGEDELKYDVHFWIGKDSTQDEYGTAAYKTVELDIHLNDKPIQHREVQGFESKLFKSYFKSLTILKGGVDSGFRHVKPQEYKPRLLRVRGTTVSNCVVEEVLLARSSLCSEDVFILDKGLNLYLWVGVKCDKDEKFRGMQEILKIKSERNGKPKSEVNDESSMKPDDDFYKLLPNVS---KDCEDSSFPKGDYDSFEPELYRISDASGKIQKTQIKKGRISRKDFDEQDVFLFDTGRHLFVYTGNKASIDERRLALQIGHNHLMRTDHPFAAISTVYHGREPGEF 365          
BLAST of Gelsolin vs. Ensembl Nematostella
Match: EDO43190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ87])

HSP 1 Score: 332.798 bits (852), Expect = 2.048e-110
Identity = 175/374 (46.79%), Postives = 241/374 (64.44%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPE----LFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPD------TAVTKKVHKDLAISKR----LYRLSDETGKITFSLISEGKTPK-SMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEF 1186
            ++K KKY+WKDSNL+LFGSD EK VKK S+E E AW+         + +WRI KFKV +WPK+DYG F+NGDSYI+L   K++ S E    L YD+HFWIG+ S+QDEYGTAAYKTVELD FLDDK ++HREV G ES LFKSYF  +  +KGG E+GFR+V PE Y+PRLLHF C   K +E+ E    + ++++GDVFI+D GL  +QWNG   + +EK  AA F+  ++ E +        ++    +   I KLL +      T  ++ V + L + +        LSD +G + FS +S G   K S L  NDVF++D+G H +V+ G G+S DE++ AM +AHNYL ++D P + ITC+  G  + +F
Sbjct:    4 LVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWE--GAGKEVGVQVWRIVKFKVTHWPKQDYGHFYNGDSYIVLNTYKKDPSSEACGELSYDVHFWIGRFSSQDEYGTAAYKTVELDHFLDDKPVEHREVEGHESTLFKSYFDALITLKGGAETGFRRVNPEAYKPRLLHF-CKKNKKIEVTEKSLKRANMNNGDVFIVDLGLTLYQWNGSRCSPDEKFSAAHFMDIIQKEIS-------TNKGRKSVKSGILKLLLERVEFNSTLSSEPVAECLVLCQSNIICFMVLSDASGHLVFSEVSRGSAVKRSQLNTNDVFIMDSGDHCYVWSGKGSSVDERRRAMEFAHNYLMKSDSPFLPITCVVEGNETDDF 367          
BLAST of Gelsolin vs. Ensembl Nematostella
Match: EDO43191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ88])

HSP 1 Score: 313.538 bits (802), Expect = 3.056e-103
Identity = 170/362 (46.96%), Postives = 223/362 (61.60%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRL--SDETGKITFSLISEGKT-PKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEF 1186
            ++K KKY+WKDSNL+LFGSD EK VKK S+E E AW+         + +WRI KFKV +WPKEDYGKFFNGDSYI+L   KE ++  L YD+HFWIGK S+QDEYGTAAYKTVELD FL+D  +QHREV G ES LFK YF  +TIMKGG +SGF+ V PE Y PRL H    + K V + + +  + ++ + DVFI+D GL  +QW   L N       A F  + ++  N   K      E  P   K+  LL            L I   + ++  SD +G +    +S G    +S L  NDVF+ D G H +V++GAGAS DE+  AM+YAHNYL +TDHP + +T +  G+ + +F
Sbjct:    4 LVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAGKEV--GVQVWRIVKFKVEHWPKEDYGKFFNGDSYIVLNTYKEPSTENLLYDVHFWIGKFSSQDEYGTAAYKTVELDHFLNDVPVQHREVEGHESKLFKGYFSTLTIMKGGADSGFKHVLPEAYTPRLFHVF-KEGKCVIVRQKQMKRTNMCNSDVFIVDLGLVIYQWYSVLLN-------AVFYTENQTVENFNPKLAKTIPEGKPKKDKVQALL-----------SLLIKAEMEQMEVSDASGSLNCEEVSRGSAISRSQLDSNDVFLFDTGCHCYVWVGAGASIDERGKAMTYAHNYLGQTDHPFLPVTVVAEGKETNDF 344          
BLAST of Gelsolin vs. Ensembl Nematostella
Match: EDO49234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU9])

HSP 1 Score: 312.383 bits (799), Expect = 2.957e-102
Identity = 167/362 (46.13%), Postives = 231/362 (63.81%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDE-EDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGK--TPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEF 1186
            + KQ++  W+D+NL+LFGSD EK VK+ ++  E AW          L IWR+E+FKV +  ++DYGKF++GDSYIIL   K+    E  YD+HFWIG+ STQDEYGTAAYKTVELD +L+DK +QHREV G ES LF SYF  +TI+KGG +SGF+ V PE Y+PRLL  +    K V++ EV F + SL+S DVFILD G   +QWNGK  +K+EK +AAQ   +L+SER GR   +V+DE ED   +   Y+ LPD    ++          L R+SD +G++  + + +GK    ++   + DVF+ D G  +FVY G  AS DE++ A+    NYL  T+HP   I+ +   +  +EF
Sbjct:    4 LRKQEQPKWQDTNLALFGSDIEKNVKREAAGQERAWS--GAGKREGLQIWRVEQFKVKSVLRDDYGKFYDGDSYIILNTYKDPEEDEFKYDVHFWIGQDSTQDEYGTAAYKTVELDIYLNDKPVQHREVQGHESKLFMSYFDSLTILKGGVKSGFKHVRPEVYQPRLLRVYGTTPKSVKVEEVPFVRKSLNSDDVFILDKGKTIYQWNGKDCDKDEKFRAAQEANRLKSERGGRPVIEVIDEGEDR--SAPFYRFLPDLPCKEEKGDYDDFEPVLLRVSDASGQMKLTEMKKGKGRITRNDFDEKDVFLFDTGNVLFVYSGNKASIDERRLALQIGTNYLNGTNHPFASISAIYDERLPEEF 361          
BLAST of Gelsolin vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 194.897 bits (494), Expect = 1.200e-53
Identity = 119/310 (38.39%), Postives = 179/310 (57.74%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQ-VTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEE-DTPLTHKIYKLLPD--TAVTKKVHKDLA--ISKRLYRLSDETGKITFSLI-SEGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L +WR+EKF +V  P+  YG F+ GD+Y++L   K+  S +L YD+HFW+G   +QDE G+AA  TV++D FL  K IQ+REV G ES  F  YF   I  M+GG  SGF+  VT E    RLL      ++ V   EV    +S +  D FILD G E +QW G  SN+ EK+KA Q  + + ++ER+GR +  V DE  +     K+    PD     +  +H D++   S +LY++S+ +G +T +L+ +E    +S L+  D F++D G    +FV+ G  A+ DE+K A+  A  ++K+  +P
Sbjct:  111 PGLQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQR-SGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIK--GRRVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEGMEREQMLKVLGPKPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYP 417          

HSP 2 Score: 96.2857 bits (238), Expect = 1.644e-20
Identity = 84/297 (28.28%), Postives = 130/297 (43.77%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDL-AISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWR+E           YG+F+ GDSYIIL   +  +     + I+ W G  S+QDE G  A    +LD  L    +Q R + G E     S F   P++ + KGG      Q  P   E RL         H   VE+  + ++L+S D F+L        W G  +++ EK  A Q    L     G   +++ +  +T           D   + ++   + A   RL+  S++TG      +  G+  +  L  +DV ++D    +FV+IG  A  +EK  AM+ A  Y+ ETD
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYR--HGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQVRVIQGKEPAHLMSLFGGKPMV-VYKGGTSREGGQSAPA--ETRLFQVRSNSTGHTRAVELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDIL-----GVSASELSEGGETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEVP-GELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYV-ETD 778          
BLAST of Gelsolin vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 194.897 bits (494), Expect = 1.663e-53
Identity = 119/310 (38.39%), Postives = 179/310 (57.74%), Query Frame = 2
Query:  242 PSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYF-PVITIMKGGCESGFRQ-VTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVLDEE-DTPLTHKIYKLLPD--TAVTKKVHKDLA--ISKRLYRLSDETGKITFSLI-SEGKTPKSMLKDNDVFMIDNGR--HMFVYIGAGASPDEKKNAMSYAHNYLKETDHP 1138
            P L +WR+EKF +V  P+  YG F+ GD+Y++L   K+  S +L YD+HFW+G   +QDE G+AA  TV++D FL  K IQ+REV G ES  F  YF   I  M+GG  SGF+  VT E    RLL      ++ V   EV    +S +  D FILD G E +QW G  SN+ EK+KA Q  + + ++ER+GR +  V DE  +     K+    PD     +  +H D++   S +LY++S+ +G +T +L+ +E    +S L+  D F++D G    +FV+ G  A+ DE+K A+  A  ++K+  +P
Sbjct:  111 PGLQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQR-SGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIK--GRRVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEGMEREQMLKVLGPKPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYP 417          

HSP 2 Score: 87.8113 bits (216), Expect = 8.681e-18
Identity = 84/309 (27.18%), Postives = 129/309 (41.75%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQH------------REVHGFESDLFKSYF---PVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDL-AISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETD 1132
            IWR+E           YG+F+ GDSYIIL      +     + I+ W G  S+QDE G  A    +LD  L    +Q             R + G E     S F   P++ + KGG      Q  P   E RL         H   VE+  + ++L+S D F+L        W G  +++ EK  A Q    L     G   +++ +  +T           D   + ++   + A   RL+  S++TG      +  G+  +  L  +DV ++D    +FV+IG  A  +EK  AM+ A  Y+ ETD
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILY--NYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQFSQVVGAPITTQVRVIQGKEPAHLMSLFGGKPMV-VYKGGTSREGGQSAPA--ETRLFQVRSNSTGHTRAVELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDIL-----GVSASELSEGGETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEVP-GELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYV-ETD 790          
BLAST of Gelsolin vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 185.652 bits (470), Expect = 3.215e-50
Identity = 115/330 (34.85%), Postives = 176/330 (53.33%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMK-GGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVL---DEEDTPLTHKIYKLL----PDT---AVTKKVHKDLAI-SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDN-GRHMFVYIGAGASPDEKKNAMSYAHNYLKETDH-PLIGITCLQAGQHSKEFE 1189
             L IW I   K+V+ P + +G FF GD YI+L I++ + + +   D+H+WIG  S+QDE G AA    +LD +L    +Q+REV G+ES  F+SYF    I K GG  SGF  V    Y    L  H   +KHV   EV+ S NS ++GD+F+LD G    QWNG  SN+ EK+KA    Q + + ER GR +  V+   +E ++P   KI   +    P+    A+  + H  +   S RLY + +  G +    ++     + +L  +D F++D+ G  + V+ G  AS  E++ AM+ A  Y+K  ++ P  G+  +  G  S  F+
Sbjct:   18 GLQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSI-DVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRL-MHVKGKKHVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKHDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYPPSTGVEVMSEGGESAMFK 345          

HSP 2 Score: 107.842 bits (268), Expect = 3.410e-24
Identity = 84/307 (27.36%), Postives = 144/307 (46.91%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDT-AVTKKVHKDLAI-SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYL------KETDHPLIGI 1150
            +WRIE  ++V    + +G+F+ GD Y++L      N  +  Y ++ W G+ +TQDE    AY+ V +D+  +   +Q R V G E   F + F    I+  G         PE    RL      ++ + +  EV    +SL+S DVF+L      + W GK  + +E+V A     +  S+   R    V+ E   P    +      + A  K++ K+  I S RL+  S++TG+   + + +    +S L ++DV ++D    +F++IG  A+  E  +A   A  YL      ++ D P+I I
Sbjct:  404 VWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQ--YILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGGTGRAGAANPES-STRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMA-----KTTSDVLFRQDKQVVMEGQEPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVYD--FAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISI 700          
BLAST of Gelsolin vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 185.267 bits (469), Expect = 4.072e-50
Identity = 115/330 (34.85%), Postives = 176/330 (53.33%), Query Frame = 2
Query:  245 SLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMK-GGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCKTDVL---DEEDTPLTHKIYKLL----PDT---AVTKKVHKDLAI-SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDN-GRHMFVYIGAGASPDEKKNAMSYAHNYLKETDH-PLIGITCLQAGQHSKEFE 1189
             L IW I   K+V+ P + +G FF GD YI+L I++ + + +   D+H+WIG  S+QDE G AA    +LD +L    +Q+REV G+ES  F+SYF    I K GG  SGF  V    Y    L  H   +KHV   EV+ S NS ++GD+F+LD G    QWNG  SN+ EK+KA    Q + + ER GR +  V+   +E ++P   KI   +    P+    A+  + H  +   S RLY + +  G +    ++     + +L  +D F++D+ G  + V+ G  AS  E++ AM+ A  Y+K  ++ P  G+  +  G  S  F+
Sbjct:   36 GLQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSI-DVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRL-MHVKGKKHVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKHDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYPPSTGVEVMSEGGESAMFK 363          

HSP 2 Score: 107.457 bits (267), Expect = 3.821e-24
Identity = 84/307 (27.36%), Postives = 144/307 (46.91%), Query Frame = 2
Query:  254 IWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDT-AVTKKVHKDLAI-SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYL------KETDHPLIGI 1150
            +WRIE  ++V    + +G+F+ GD Y++L      N  +  Y ++ W G+ +TQDE    AY+ V +D+  +   +Q R V G E   F + F    I+  G         PE    RL      ++ + +  EV    +SL+S DVF+L      + W GK  + +E+V A     +  S+   R    V+ E   P    +      + A  K++ K+  I S RL+  S++TG+   + + +    +S L ++DV ++D    +F++IG  A+  E  +A   A  YL      ++ D P+I I
Sbjct:  422 VWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQ--YILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGGTGRAGAANPES-STRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMA-----KTTSDVLFRQDKQVVMEGQEPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVYD--FAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISI 718          
BLAST of Gelsolin vs. Ensembl Medaka
Match: capgb (capping actin protein, gelsolin like [Source:NCBI gene;Acc:101163360])

HSP 1 Score: 175.252 bits (443), Expect = 9.744e-50
Identity = 107/314 (34.08%), Postives = 176/314 (56.05%), Query Frame = 2
Query:  233 VTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPV-ITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQL-ESERNGRCK-TDVLDEEDTPLTHKIYKLLPDTAVT---KKVHKDLAISKRLYRLSDETGKITFSLISEGKTP--KSMLKDNDVFMIDNGRH--MFVYIGAGASPDEKKNAMSYAHNYLKETDHPLI 1144
            V  P L++WR+EK K V     + G F+NGDSY++LK     N  E   D+H WIG++S++DE    A    +LD FL    +QHR+V GFE+  F + FP  I+   GG ESGFR+        RL  +    ++++   EV+ S +S + GD FILD G     W G  +N  EK K  +    + +++R+G+ +  D+ + E+     K+    P+ A +   +    D + S  LY++SD TG +T + ISE K+P  + +L  +D F++DNG +  +FV+ G GA+ +EK+ A+  A +++++  +P++
Sbjct:   15 VRDPGLWVWRVEKMKAVLLDPSEVGSFYNGDSYLVLK-----NDGEQGADLHMWIGEKSSRDEQVACAMLATQLDNFLGGDPVQHRQVQGFETPEFMALFPRGISYKDGGVESGFRRTQGSGPVHRL--YQIKGKRNIRAKEVELSWSSFNKGDCFILDLGEIIVSWIGSQANIFEKQKVREIASLIRDTDRHGKARIVDITEGEEPEEMLKVLGQKPELAESTPEEDSKADASNSAALYKVSDATGSMTMTKISE-KSPFAQELLVRDDCFILDNGANGKIFVWKGNGANAEEKRVALQMADSFIQQMKYPIM 320          
BLAST of Gelsolin vs. Planmine SMEST
Match: SMESG000015535.1 (SMESG000015535.1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 363/364 (99.73%), Postives = 364/364 (100.00%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            MIKQKKY+WKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD
Sbjct:    1 MIKQKKYDWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 364          
BLAST of Gelsolin vs. Planmine SMEST
Match: SMESG000035418.1 (SMESG000035418.1)

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 283/364 (77.75%), Postives = 321/364 (88.19%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQAGQHSKEFELQLD 1201
            MIKQK Y+WKDSNL+LFGSDTEKLVKKTS+ETE AW++ K  T P LF+WRIEKFKV++ PKE++GKF+NGDSYIILKI KEE+SPEL YD+HFWIGK+S+QDEYGTAAYKTVELDT LDDKAIQHREV G E+DLFKSYFP++TIMKGGCESGF  VTP+KYEPRLLHF C D KHVELVEVK SK +LDS DV ILDNGLE FQWNGKLSNKNEK KAAQFLQQL+SER+GR KTDVLDEE T   H+I+KLLPD   TKK   DL +SK LYRLSDE+GK+TFS ISEG  P+SMLKD+DV+MIDNGRH+FVYIGA AS +EKKNAMSYAHNYLK T+HPLIGITCLQ+GQH+KE++LQL+
Sbjct:   29 MIKQKNYDWKDSNLALFGSDTEKLVKKTSAETEPAWRVAKATTVPGLFVWRIEKFKVISLPKEEFGKFYNGDSYIILKINKEEDSPELLYDVHFWIGKQSSQDEYGTAAYKTVELDTLLDDKAIQHREVQGNETDLFKSYFPIMTIMKGGCESGFHHVTPDKYEPRLLHFRCTDHKHVELVEVKLSKQALDSEDVLILDNGLEVFQWNGKLSNKNEKFKAAQFLQQLKSERSGRVKTDVLDEEFTAANHRIFKLLPDVPFTKKTQNDLNMSKMLYRLSDESGKMTFSCISEGSIPRSMLKDDDVYMIDNGRHLFVYIGARASQEEKKNAMSYAHNYLKTTEHPLIGITCLQSGQHNKEYDLQLE 392          
BLAST of Gelsolin vs. Planmine SMEST
Match: SMESG000015924.1 (SMESG000015924.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.158e-134
Identity = 201/370 (54.32%), Postives = 262/370 (70.81%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTA--VTKKVHKDL-AISKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQ---AGQHSKEFELQLD 1201
            M K +KY+WKDSN+ L GS  ++ VKK+S++TE AW   KT  T +LFIWRIEKFKVV WPK+ +G+FF GDSYI+L I ++E   EL YDIHFWIGK STQDEYGTAAYKTVELDT LDDK IQHREV  +ESD+FKSYFP I  +KGGCESGFR V   +Y PRLLH    ++ ++ + EV  +K +L+S DVFI D+G   +QW GK +NK+E+ KA QF QQL S+RNG+ K +VLDE      H+ Y  L +       K HK L A  K+L+R+SDETG + F  ++ G   KS + +NDVF+IDNG+ ++VY+G  AS +E+KNA+ YAHNYLK TD+P   IT ++    G++++EF   L+
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKE--KELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVR-GEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLN 367          
BLAST of Gelsolin vs. Planmine SMEST
Match: SMESG000015927.1 (SMESG000015927.1)

HSP 1 Score: 382.104 bits (980), Expect = 1.808e-129
Identity = 189/353 (53.54%), Postives = 255/353 (72.24%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTKKVH--KDLAISK-RLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCL 1159
            M +  KY+WKDSN+ L GS  ++ VKK+S+ETE AW   K     +LF+WRIEKFKVV WPK  YG+F+ GDSYI+LKI ++E   +L YD+HFWIGK STQDEYGTAAYKTVELDT LDDK +QHREV  +ES+LFKSYF  I  +KGG ESGFR V   +Y PRLLHF   D++++ + E+  +K +L S DVFI D G   FQW GK +NK+EK KA QF QQL ++RNG+   +VLDEE+TP  H+++K L D+   ++    K L + + +L+++SD TG + F  ++ GK  KS + + DVF++DNG+ ++VY+G G+SP+E+KNA+ YAHNYLKETD+P   +T +
Sbjct:    1 MKRSAKYDWKDSNVELIGSSEDRSVKKSSAETEKAWAAAKACNHAALFVWRIEKFKVVEWPKVQYGEFYEGDSYIVLKIFEKE--KQLNYDVHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPVQHREVQHYESNLFKSYFQNIVYLKGGHESGFRHVNTREYIPRLLHFK-GDKRNIIITEISATKKNLKSDDVFIYDTGSSIFQWIGKGANKDEKYKAQQFAQQLNADRNGKLNIEVLDEEETPSNHELFKHLSDSDPEEEDQHLKVLNLQETQLFKISDATGSLKFEKVAAGKLNKSQINEEDVFIVDNGQIVYVYVGEGSSPNERKNALIYAHNYLKETDYPQAPVTVI 350          
BLAST of Gelsolin vs. Planmine SMEST
Match: SMESG000015928.1 (SMESG000015928.1)

HSP 1 Score: 374.015 bits (959), Expect = 2.213e-126
Identity = 182/354 (51.41%), Postives = 251/354 (70.90%), Query Frame = 2
Query:  110 MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIWRIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRSTQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGGCESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDNGLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHKIYKLLPDTAVTK--KVHKDLAI-SKRLYRLSDETGKITFSLISEGKTPKSMLKDNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCLQ 1162
            M K KKY+WKDSN+ L GS  ++ VKK+S+E E AWK  K  +   LFIWRIEKFKVV WP++ +G+F+ GDSYI+L I + EN  EL YD+HFWIGK STQDEYGTAAYKTVELD  LDDK +QHREV  +ES+LFKSYF  +  +KGGCESGFR V   +Y PRLLH    +++++ + EV  +K++L+S DVFI D G   F+W GK +NK+EK K  +F Q L S+RNG+ K +V+DE +    H+ YK L D    +  K    L++  K+L+R+SD +G + F  I+ GK  K  + ++D+F++DNG  ++VYIG  ASP+E++NA+ YAHNYLK+T++P + +T ++
Sbjct:    1 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACSHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQREN--ELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVR-GEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMK 351          
The following BLAST results are available for this feature:
BLAST of Gelsolin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIL16.640e-5936.36villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
VIL11.674e-5536.36villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
GSN3.677e-5537.69gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN5.309e-5537.74gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN5.447e-5537.74gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
back to top
BLAST of Gelsolin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gsnl-12.871e-4735.87Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
fli-11.873e-1625.95pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
back to top
BLAST of Gelsolin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gel1.076e-5334.92gene:FBgn0010225 transcript:FBtr0078973[more]
Gel1.076e-5334.92gene:FBgn0010225 transcript:FBtr0309256[more]
Gel1.076e-5334.92gene:FBgn0010225 transcript:FBtr0078969[more]
Gel1.076e-5334.92gene:FBgn0010225 transcript:FBtr0078968[more]
Gel1.161e-5334.92gene:FBgn0010225 transcript:FBtr0336707[more]
back to top
BLAST of Gelsolin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scin6.127e-5437.22scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
scin6.376e-5437.22scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
vil11.108e-5335.63villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
vil11.108e-5335.63villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
vil11.108e-5335.63villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
back to top
BLAST of Gelsolin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jazf11.451e-5437.94JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf11.529e-5437.94JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf17.575e-5337.30JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf12.352e-5036.42JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
ndc804.325e-4936.42NDC80 kinetochore complex component [Source:Xenbas... [more]
back to top
BLAST of Gelsolin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gsn7.914e-5837.74gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn1.675e-5637.74gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn1.944e-5637.74gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Vil18.562e-5537.14villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Gsn5.955e-4940.65gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
back to top
BLAST of Gelsolin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24800|SEVE_ECHGR1.299e-11649.72Severin OS=Echinococcus granulosus OX=6210 GN=AG8 ... [more]
sp|Q8MPM1|GELS2_LUMTE1.222e-11050.14Gelsolin-like protein 2 OS=Lumbricus terrestris OX... [more]
sp|Q7JQD3|GELS1_LUMTE2.390e-10546.88Gelsolin-like protein 1 OS=Lumbricus terrestris OX... [more]
sp|P10733|SEVE_DICDI4.738e-9045.72Severin OS=Dictyostelium discoideum OX=44689 GN=se... [more]
sp|Q10L71|VLN2_ORYSJ1.958e-5737.42Villin-2 OS=Oryza sativa subsp. japonica OX=39947 ... [more]
back to top
BLAST of Gelsolin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GFK57.658e-15358.97Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JDB79.498e-14357.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A094ZM002.990e-13955.22Severin OS=Schistosoma haematobium OX=6185 GN=MS3_... [more]
G4VIJ14.391e-13855.22Putative gelsolin OS=Schistosoma mansoni OX=6183 G... [more]
A0A1I8GS751.605e-13755.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Gelsolin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna5.003e-5539.74gelsolin-like [Source:NCBI gene;Acc:103033745][more]
gsna6.513e-5539.74gelsolin-like [Source:NCBI gene;Acc:103033745][more]
gsnb7.058e-5236.59gelsolin [Source:NCBI gene;Acc:103027267][more]
scin7.181e-5235.48scinderin [Source:NCBI gene;Acc:103042167][more]
scinlb1.878e-4936.22scinderin like b [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Gelsolin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
avil3.158e-5334.38advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna2.273e-4741.67gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
ENSPMAT00000008894.12.651e-1535.57pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
back to top
BLAST of Gelsolin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gelsolin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403487.079e-12552.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492351.060e-11549.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431902.048e-11046.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431913.056e-10346.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492342.957e-10246.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gelsolin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna1.200e-5338.39gelsolin [Source:NCBI gene;Acc:101167720][more]
gsna1.663e-5338.39gelsolin [Source:NCBI gene;Acc:101167720][more]
vill3.215e-5034.85villin like [Source:NCBI gene;Acc:101155645][more]
vill4.072e-5034.85villin like [Source:NCBI gene;Acc:101155645][more]
capgb9.744e-5034.08capping actin protein, gelsolin like [Source:NCBI ... [more]
back to top
BLAST of Gelsolin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015535.10.000e+099.73SMESG000015535.1[more]
SMESG000035418.10.000e+077.75SMESG000035418.1[more]
SMESG000015924.11.158e-13454.32SMESG000015924.1[more]
SMESG000015927.11.808e-12953.54SMESG000015927.1[more]
SMESG000015928.12.213e-12651.41SMESG000015928.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035218 ID=SMED30035218|Name=Gelsolin|organism=Schmidtea mediterranea sexual|type=transcript|length=1573bp
TTATAACAGTCGCTTAATAAAATGATTAAAATCCTTAATTTTTAGTGAAT
TCAAATAACAAATTTTAAAATCTAATTAATAATTAAAATCTGTGACTTTG
ACAATCGATATGATAAAACAAAAAAAATACAACTGGAAAGACTCCAACTT
ATCTTTATTTGGATCTGATACGGAAAAATTAGTCAAAAAAACTTCGTCGG
AAACAGAAGCAGCATGGAAATTGGTAAAAACTGTAACTACACCGAGTCTT
TTTATTTGGAGAATTGAAAAATTTAAAGTTGTCAATTGGCCTAAAGAAGA
CTATGGGAAATTTTTCAATGGAGATTCGTATATCATTTTAAAAATAAAAA
AGGAAGAAAATAGTCCTGAATTATTTTATGATATTCATTTTTGGATTGGA
AAAAGAAGTACACAAGACGAGTATGGCACAGCTGCGTACAAAACAGTAGA
ACTAGATACATTTCTTGATGATAAAGCAATACAGCATCGTGAAGTTCACG
GTTTTGAATCTGATTTATTTAAGTCCTATTTTCCGGTTATTACAATAATG
AAAGGCGGATGTGAAAGTGGTTTCAGACAAGTAACTCCAGAAAAATATGA
ACCAAGACTTTTACATTTTCACTGTGCTGATCAAAAACATGTTGAACTTG
TAGAAGTGAAATTTTCAAAAAACTCTTTGGATTCAGGCGATGTATTTATT
TTAGACAACGGACTAGAGGCTTTTCAGTGGAATGGAAAACTATCAAATAA
AAATGAGAAAGTTAAAGCAGCACAATTTTTACAGCAATTAGAATCAGAAC
GAAACGGTCGGTGCAAAACAGATGTATTAGACGAAGAAGATACTCCTTTG
ACGCATAAAATTTACAAATTACTACCTGATACAGCTGTTACTAAGAAGGT
TCACAAAGACTTGGCAATTTCCAAACGTCTGTATAGATTATCTGATGAGA
CAGGCAAAATAACGTTTTCTCTAATCTCAGAGGGCAAAACTCCAAAATCT
ATGCTGAAAGACAATGATGTGTTTATGATAGATAATGGGCGACACATGTT
TGTATATATTGGCGCCGGTGCGTCTCCGGATGAAAAGAAAAATGCAATGT
CATATGCACATAATTACTTGAAAGAAACTGACCATCCATTAATTGGAATT
ACTTGTCTCCAAGCTGGCCAGCATAGCAAAGAATTTGAGCTTCAATTGGA
CTAGAAAATGATTATGAAATTTTAAATTGCATGGCATTTCAATATTTTTA
AATATTTGTGTTTTTACTTAATTTTTACAAAATGCATGAGTTTATGGTAA
TTCATTTTCTTAGAAGAGTGAAGAAATATTTTTTTGTTTATGTATTTCAT
AAATTGCTTAAATATAATTAAACCTAATGTATATATTGCTGTATTATTTG
CTGTTACGAATATTATTGGGCTTGATAGAGCTATCAGAACTAACTCGCCA
TGCTCTTGATCATAACAAGAAATCTACGCAATCAATATATTTGTACCAAA
AATCATAACCATTACAATTTTCACCAACACAAATCAATCTAGTTTTTATT
TGTTGCCAGAATCAAATTTTGGG
back to top

protein sequence of SMED30035218-orf-1

>SMED30035218-orf-1 ID=SMED30035218-orf-1|Name=SMED30035218-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MIKQKKYNWKDSNLSLFGSDTEKLVKKTSSETEAAWKLVKTVTTPSLFIW
RIEKFKVVNWPKEDYGKFFNGDSYIILKIKKEENSPELFYDIHFWIGKRS
TQDEYGTAAYKTVELDTFLDDKAIQHREVHGFESDLFKSYFPVITIMKGG
CESGFRQVTPEKYEPRLLHFHCADQKHVELVEVKFSKNSLDSGDVFILDN
GLEAFQWNGKLSNKNEKVKAAQFLQQLESERNGRCKTDVLDEEDTPLTHK
IYKLLPDTAVTKKVHKDLAISKRLYRLSDETGKITFSLISEGKTPKSMLK
DNDVFMIDNGRHMFVYIGAGASPDEKKNAMSYAHNYLKETDHPLIGITCL
QAGQHSKEFELQLD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0051015actin filament binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0045010actin nucleation
GO:0051014actin filament severing
GO:0051016barbed-end actin filament capping
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR007122Villin/Gelsolin
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR007123Gelsolin-like_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinPRINTSPR00597GELSOLINcoord: 325..344
score: 26.36
coord: 178..198
score: 39.83
coord: 64..80
score: 41.18
coord: 296..318
score: 30.24
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 45..144
e-value: 2.1E-20
score: 83.8
coord: 273..353
e-value: 0.0018
score: 27.5
coord: 165..258
e-value: 1.2E-12
score: 58.0
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 46..359
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 57..137
e-value: 2.3E-14
score: 53.0
coord: 178..243
e-value: 1.4E-15
score: 57.0
coord: 297..339
e-value: 4.2E-7
score: 29.8
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 31..157
e-value: 1.1E-39
score: 137.2
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 267..362
e-value: 9.2E-19
score: 69.3
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 158..266
e-value: 4.8E-28
score: 99.5
NoneNo IPR availablePANTHERPTHR11977:SF85VILLIN-2coord: 46..359
NoneNo IPR availableCDDcd11290gelsolin_S1_likecoord: 45..150
e-value: 8.67601E-53
score: 168.556
NoneNo IPR availableCDDcd11289gelsolin_S2_likecoord: 164..256
e-value: 4.31922E-31
score: 111.56
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 159..247
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 44..171
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 263..341