G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30035215
Length (bp)669
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30035215) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30035215) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30035215) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30035215) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035215

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035215SMESG000023842.1 PL05015B2G09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035215SMESG000023842.1 Contig3429GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035215SMESG000023842.1 Contig3376GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30035215SMESG000023842.1 dd_Smed_v4_32_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035215SMESG000023842.1 dd_Smed_v4_32_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30035215SMESG000023842.1 dd_Smed_v4_32_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035215SMESG000023842.1 dd_Smed_v4_32_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035215SMESG000023842.1 dd_Smed_v4_32_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035215SMESG000023842.1 dd_Smed_v4_32_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035215SMESG000023842.1 Contig50833uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035215SMESG000023842.1 Contig50833newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30035215SMESG000023842.1 dd_Smed_v6_32_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30035215SMESG000023842.1 dd_Smed_v6_32_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035215SMESG000023842.1 dd_Smed_v6_32_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30035215SMESG000023842.1 dd_Smed_v6_32_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267F6N5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018526g1 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.352e-21
Identity = 46/86 (53.49%), Postives = 54/86 (62.79%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            YFVPCY  GK+AEAVGDSC LCG   LF  PC+ A VR K+R+++ I GSFIGD     CC  C + Q  QEV  M      +ERE
Sbjct:   22 YFVPCYTFGKNAEAVGDSCVLCGLAFLFVSPCVGAIVRGKIREKQGINGSFIGDFFVHLCCPLCALVQDAQEVKEMSPGGQVVERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8JBM9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001673g1 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.018e-21
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            Y VPCY  GK+AEAV +SC LCG G LF  PC+ A VR K+R+++ I G F+ DLL   CC  C + Q  QEV AM  +  A+ERE
Sbjct:   23 YLVPCYTFGKNAEAVQESCLLCGIGYLFVSPCLGAIVRGKIREKQGIPGRFVSDLLAHLCCPLCALMQDAQEVKAMAPAGSAVERE 108          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8H2V8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 8.319e-21
Identity = 45/86 (52.33%), Postives = 56/86 (65.12%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            Y VPCY  GK+AEAV +SC LCG G LF  PC+ A VR K+R+++ I G F+ DLL   CC  C + Q  QEV AM  +  A+ERE
Sbjct:   85 YLVPCYTFGKNAEAVQESCLLCGIGYLFVSPCLGAIVRGKIREKQGIPGRFVSDLLAHLCCPLCALMQDAQEVKAMAPAGSAVERE 170          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8GZL5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033858g1 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.331e-19
Identity = 45/87 (51.72%), Postives = 55/87 (63.22%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAM-GGSSMAIERE 404
            YF+PCY  GK AEAVGDSC LC  G LF  PC+ A +R KVRD++ I G F+GD     CC  C + Q  QEV  M   S+ ++ERE
Sbjct:   22 YFLPCYTHGKTAEAVGDSCVLCAIGYLFVAPCVGAVIRGKVRDKQGIAGGFVGDFFTYLCCPLCALVQDAQEVKDMVPPSAQSLERE 108          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A267H2K2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005849g1 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.386e-17
Identity = 46/91 (50.55%), Postives = 56/91 (61.54%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCG-----SLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            YFVPCY  GK+AEAVG++C LCG G     S   GP     VR K+R+++NI GSFI D    F C  C + Q  QEV + GG  MA+ERE
Sbjct:   23 YFVPCYTFGKNAEAVGENCILCGFGICCGLSFILGP----IVRGKIREKQNIPGSFITDYCIWFFCAFCALVQEAQEVKSFGGYGMAVERE 109          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 67.3958 bits (163), Expect = 8.265e-15
Identity = 38/84 (45.24%), Postives = 48/84 (57.14%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPC----IIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSS 386
            Y  PCY  GK+AEAVGDSC LCG    F  P     +++ VR K+R++  I+GSFIGD     CC  C + Q  Q+V    GS 
Sbjct:   23 YIAPCYTFGKNAEAVGDSCLLCGLA--FFVPVVDLIVMSSVRGKIREQHGISGSFIGDCAATICCPFCSLVQSAQQVKGAPGSQ 104          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK5])

HSP 1 Score: 65.0846 bits (157), Expect = 5.873e-14
Identity = 36/81 (44.44%), Postives = 48/81 (59.26%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAY----VRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMG 377
            Y VPCY  GK AEAVG+ C +CG   +   PC   +    +R KVR+++ I GSF+ DLL  +CCG C +    QE + MG
Sbjct:   22 YCVPCYTFGKTAEAVGEDCLMCGI--VLMVPCANIWFATQIRGKVREQKGIEGSFVNDLLMTWCCGFCSII---QEALEMG 97          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 56.9954 bits (136), Expect = 6.553e-11
Identity = 35/91 (38.46%), Postives = 50/91 (54.95%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFL------CGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIER 401
            YF PC + GK+AEAVG++CFL       GC  +F G    A +R K+R++  I GSF  D +  + C  C  +Q  +E+ A   S  A+ R
Sbjct:   21 YFCPCVVAGKNAEAVGENCFLHGFLSTLGCVGIFCG----AKIREKIREKHGIEGSFGNDCIMHWFCPLCAYSQEARELKARCPSGQAMAR 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023842.1 (SMESG000023842.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.125e-59
Identity = 107/107 (100.00%), Postives = 107/107 (100.00%), Query Frame = 3
Query:   84 MGEWEHXXXXXXXXXXXXXXXYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            MGEWEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE
Sbjct:    1 MGEWEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023846.1 (SMESG000023846.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.393e-31
Identity = 69/107 (64.49%), Postives = 84/107 (78.50%), Query Frame = 3
Query:   84 MGEWEHXXXXXXXXXXXXXXXYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            M EW+HGLCGC  DCGTCLL+YFVPCYL+GKDAEAVGDSCFLCG G L    C+ A VR KVR++R I+G+F  DL+ +  C CC VAQ HQEV+AM  ++M+IER+
Sbjct:    1 MAEWQHGLCGCFSDCGTCLLSYFVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023836.1 (SMESG000023836.1)

HSP 1 Score: 107.457 bits (267), Expect = 7.543e-30
Identity = 65/107 (60.75%), Postives = 80/107 (74.77%), Query Frame = 3
Query:   84 MGEWEHXXXXXXXXXXXXXXXYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            M EW+ G+CGC  D GTCLL+YFVPCYLIG DAEAV +SC LCG  S+F  PCII YVR K+R+++NI G    D LC+F  GCC VAQMH EV  M G+++++ERE
Sbjct:    1 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVISIFFPPCIICYVRGKIREKQNIDGGCCTDCLCSFFLGCCAVAQMHHEVKHMQGNAISLERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000023831.1 (SMESG000023831.1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.316e-23
Identity = 55/107 (51.40%), Postives = 69/107 (64.49%), Query Frame = 3
Query:   84 MGEWEHXXXXXXXXXXXXXXXYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            M +W+ G+CGC  D GTC+L YF PCYL+G DAE V  +C LC    LF  PCI  ++R KVR +RNI G    D + +    CC VAQMH EV  M G++MA+ERE
Sbjct:    1 MSDWQQGICGCFGDLGTCVLAYFAPCYLVGLDAETVDKNCVLCCIAFLFFPPCITCHIRGKVRSKRNIPGGSCNDCVVSLFLPCCTVAQMHHEVKHMSGTAMALERE 107          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000060415.1 (SMESG000060415.1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.164e-19
Identity = 40/87 (45.98%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  147 YFVPCYLIGKDAEAVGDSCFLCGCGSLF-AGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 404
            +F PCY +G DA+AVG+SC LCG  ++  A    +  +RS +RDR+ I GS++ D      C CC  AQMHQE       S AIERE
Sbjct:   29 FFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 115          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F6N51.352e-2153.49Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JBM94.018e-2152.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2V88.319e-2152.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GZL53.331e-1951.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H2K23.386e-1750.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO500688.265e-1545.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361165.873e-1444.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447946.553e-1138.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023842.11.125e-59100.00SMESG000023842.1[more]
SMESG000023846.11.393e-3164.49SMESG000023846.1[more]
SMESG000023836.17.543e-3060.75SMESG000023836.1[more]
SMESG000023831.11.316e-2351.40SMESG000023831.1[more]
SMESG000060415.13.164e-1945.98SMESG000060415.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035215 ID=SMED30035215|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=669bp
TGAATGCGATTCATGTCGAAATCACATATAAATGTTTAATTTATACATTT
AAAACAAATCGGTTTTGAATAAAAATAAAAATCATGGGTGAATGGGAACA
TGGTCTTTGCGGCTGTTGCGATGATTGCGGCACATGTTTGTTAACGTATT
TTGTACCGTGCTACTTGATCGGGAAAGACGCAGAAGCCGTGGGAGACAGT
TGTTTTCTGTGTGGTTGCGGATCATTGTTCGCGGGCCCGTGCATCATTGC
CTACGTCCGATCGAAAGTCCGTGACCGACGAAATATCACCGGAAGTTTCA
TCGGAGATCTATTATGTGCTTTTTGTTGTGGTTGCTGTGTCGTCGCTCAA
ATGCATCAGGAAGTCATTGCGATGGGTGGATCAAGCATGGCTATTGAGCG
AGAATAAAGTCAAAACGTTTCTAATCCGTTTGACTAAATTGTTAATTAAA
ATAATTATTTCTAATTATTATTTCTATTACAAATTTTTATAATCCTACAG
TGATTTTAGCATTCAAATTGTCTAACATGTGCGACCTACATATATTTCAT
GTGAAATTATATTATTTGCATATGTTTCAGAAAATCATACGATAATAATA
TCAATATTGAAAATAAAAATAAAATCGATATATTGTGCTCTGAATTTTTA
ATATATTTCTAAATTATGC
back to top

protein sequence of SMED30035215-orf-1

>SMED30035215-orf-1 ID=SMED30035215-orf-1|Name=SMED30035215-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
MGEWEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLFA
GPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGS
SMAIERE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 4..93
e-value: 7.6E-20
score: 71.8
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 3..94
e-value: 4.4E-18
score: 63.9
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 1..96
NoneNo IPR availablePANTHERPTHR15907:SF90coord: 1..96
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 35..57