ORM1-like protein

Overview
NameORM1-like protein
Smed IDSMED30035214
Length (bp)831
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ORM1-like protein (SMED30035214) t-SNE clustered cells

Violin plots show distribution of expression levels for ORM1-like protein (SMED30035214) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ORM1-like protein (SMED30035214) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ORM1-like protein (SMED30035214) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035214

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035214SMESG000057003.1 Contig2851newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035214SMESG000057003.1 Contig2851uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035214SMESG000014644.1 Contig2851newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30035214SMESG000014644.1 Contig2851uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ORM1-like protein vs. Ensembl Human
Match: ORMDL3 (ORMDL sphingolipid biosynthesis regulator 3 [Source:HGNC Symbol;Acc:HGNC:16038])

HSP 1 Score: 179.489 bits (454), Expect = 2.782e-56
Identity = 84/154 (54.55%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Human
Match: ORMDL3 (ORMDL sphingolipid biosynthesis regulator 3 [Source:HGNC Symbol;Acc:HGNC:16038])

HSP 1 Score: 179.489 bits (454), Expect = 2.782e-56
Identity = 84/154 (54.55%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Human
Match: ORMDL3 (ORMDL sphingolipid biosynthesis regulator 3 [Source:HGNC Symbol;Acc:HGNC:16038])

HSP 1 Score: 179.489 bits (454), Expect = 2.782e-56
Identity = 84/154 (54.55%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Human
Match: ORMDL2 (ORMDL sphingolipid biosynthesis regulator 2 [Source:HGNC Symbol;Acc:HGNC:16037])

HSP 1 Score: 175.637 bits (444), Expect = 9.902e-55
Identity = 82/154 (53.25%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL YI+L+ ++H V L IPF S+  +WTLT   HN+  Y  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFL++ PIVL+L+ASFYTKY+  HF+IN+ +L+ + L+PKLPQ H +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSV-LLPKLPQFHGVRVFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Human
Match: ORMDL2 (ORMDL sphingolipid biosynthesis regulator 2 [Source:HGNC Symbol;Acc:HGNC:16037])

HSP 1 Score: 175.637 bits (444), Expect = 9.902e-55
Identity = 82/154 (53.25%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL YI+L+ ++H V L IPF S+  +WTLT   HN+  Y  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFL++ PIVL+L+ASFYTKY+  HF+IN+ +L+ + L+PKLPQ H +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSV-LLPKLPQFHGVRVFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Fly
Match: ORMDL (gene:FBgn0037110 transcript:FBtr0078423)

HSP 1 Score: 137.502 bits (345), Expect = 2.802e-40
Identity = 69/153 (45.10%), Postives = 97/153 (63.40%), Query Frame = 1
Query:  106 QVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
             +       NP   + ++RG WL Y+L ++ VH +FL +PF+S+ W WT T   HN    + LH  KG+P+ + +   +R  T WEQ DDG Q++ T+KFLT VPIVLFL+   YT+    HFI N I+LV++ L PKLPQ H +RLFNIN++
Sbjct:    3 SIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFLHVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNFISLVVVTL-PKLPQFHGVRLFNINKY 154          
BLAST of ORM1-like protein vs. Ensembl Zebrafish
Match: ormdl3 (ORMDL sphingolipid biosynthesis regulator 3 [Source:NCBI gene;Acc:450067])

HSP 1 Score: 179.104 bits (453), Expect = 2.016e-56
Identity = 84/154 (54.55%), Postives = 112/154 (72.73%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H + L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PI+L+ + SFYTKY+  HF+IN+I+L+ + L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYDRVHFVINTISLLTV-LIPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Zebrafish
Match: ormdl3 (ORMDL sphingolipid biosynthesis regulator 3 [Source:NCBI gene;Acc:450067])

HSP 1 Score: 179.104 bits (453), Expect = 2.016e-56
Identity = 84/154 (54.55%), Postives = 112/154 (72.73%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H + L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PI+L+ + SFYTKY+  HF+IN+I+L+ + L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYDRVHFVINTISLLTV-LIPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Zebrafish
Match: ormdl1 (ORMDL sphingolipid biosynthesis regulator 1 [Source:NCBI gene;Acc:368632])

HSP 1 Score: 176.407 bits (446), Expect = 2.531e-55
Identity = 83/154 (53.90%), Postives = 108/154 (70.13%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY L + M+H V L IPF SV  +WTLT   HN  MY  +H  KG+P+ET DQGKAR+LT WEQ D G Q + ++KF T+ PI+L+ +ASFYTKY+  HF+IN+ +L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLTYALGVGMLHIVLLSIPFFSVPVVWTLTNVIHNFGMYVFMHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDTAHFVINTASLLSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Zebrafish
Match: ormdl2 (ORMDL sphingolipid biosynthesis regulator 2 [Source:ZFIN;Acc:ZDB-GENE-060331-113])

HSP 1 Score: 169.859 bits (429), Expect = 1.102e-52
Identity = 86/154 (55.84%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL Y+LL   +H V L IPFLSV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+++ASFYTKY+ THF++N+ +L +  L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYLLLTTALHVVLLSIPFLSVPVVWTLTNIIHNLAMYLFLHTVKGTPFETPDQGKARLLTHWEQMDYGIQFTASRKFLTISPIVLYILASFYTKYDTTHFLVNTGSL-LSVLLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Zebrafish
Match: ormdl2 (ORMDL sphingolipid biosynthesis regulator 2 [Source:ZFIN;Acc:ZDB-GENE-060331-113])

HSP 1 Score: 169.859 bits (429), Expect = 1.102e-52
Identity = 86/154 (55.84%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL Y+LL   +H V L IPFLSV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+++ASFYTKY+ THF++N+ +L +  L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYLLLTTALHVVLLSIPFLSVPVVWTLTNIIHNLAMYLFLHTVKGTPFETPDQGKARLLTHWEQMDYGIQFTASRKFLTISPIVLYILASFYTKYDTTHFLVNTGSL-LSVLLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Xenopus
Match: birc6 (baculoviral IAP repeat containing 6 [Source:Xenbase;Acc:XB-GENE-1001894])

HSP 1 Score: 176.407 bits (446), Expect = 3.726e-55
Identity = 82/154 (53.25%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL Y++L+  +H + L  PF SV  +WTLT   HN++MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+L+ASFYTKY+  HF+IN+++L +  L+PKLPQ H +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVLNSRGIWLAYVILVGFLHIILLSFPFFSVPVVWTLTNVIHNLVMYLFLHTVKGTPFETPDQGKARLLTHWEQMDYGIQFTSSRKFLTISPIVLYLLASFYTKYDPAHFLINTVSL-LSVLLPKLPQFHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Xenopus
Match: slc18b1 (solute carrier family 18, subfamily B, member 1 [Source:Xenbase;Acc:XB-GENE-953331])

HSP 1 Score: 175.637 bits (444), Expect = 6.696e-55
Identity = 85/154 (55.19%), Postives = 108/154 (70.13%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY L + M+H V L IPF SV   WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PI+L+ + SFYTKY+ THF IN+ +L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGMLHIVLLSIPFFSVPVAWTLTNVIHNLGMYVFLHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFLTISPIILYFLTSFYTKYDPTHFFINTASLLSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Mouse
Match: Ormdl3 (ORM1-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913862])

HSP 1 Score: 180.644 bits (457), Expect = 6.446e-57
Identity = 85/154 (55.19%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HFI+N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMTV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Mouse
Match: Ormdl1 (ORM1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2181669])

HSP 1 Score: 173.326 bits (438), Expect = 5.462e-54
Identity = 82/154 (53.25%), Postives = 109/154 (70.78%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY L + ++H V L IPF SV   WTLT   HN+ MY  LH  KG+P+ET DQG+AR+LT WEQ D G Q + ++KF T+ PI+L+ +ASFYTKY+ THFI+N+ +L+ + L+PK+PQLH +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASLLSV-LIPKMPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Mouse
Match: Ormdl2 (ORM1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914094])

HSP 1 Score: 167.548 bits (423), Expect = 7.513e-52
Identity = 84/154 (54.55%), Postives = 111/154 (72.08%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL YI+L+ ++H V L IPF S+  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFL++ PIVL+L+ASFYTKY+  HF+IN+ +L+ + L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSV-LLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Mouse
Match: Ormdl2 (ORM1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914094])

HSP 1 Score: 167.548 bits (423), Expect = 7.513e-52
Identity = 84/154 (54.55%), Postives = 111/154 (72.08%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL YI+L+ ++H V L IPF S+  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFL++ PIVL+L+ASFYTKY+  HF+IN+ +L+ + L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSV-LLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Mouse
Match: Ormdl2 (ORM1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914094])

HSP 1 Score: 167.548 bits (423), Expect = 7.513e-52
Identity = 84/154 (54.55%), Postives = 111/154 (72.08%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL YI+L+ ++H V L IPF S+  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFL++ PIVL+L+ASFYTKY+  HF+IN+ +L+ + L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSV-LLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. UniProt/SwissProt
Match: sp|Q9CPZ6|ORML3_MOUSE (ORM1-like protein 3 OS=Mus musculus OX=10090 GN=Ormdl3 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.509e-56
Identity = 85/154 (55.19%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HFI+N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMTV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. UniProt/SwissProt
Match: sp|Q6QI25|ORML3_RAT (ORM1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Ormdl3 PE=2 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 7.039e-56
Identity = 85/154 (55.19%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HFI+N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. UniProt/SwissProt
Match: sp|Q0VD15|ORML3_BOVIN (ORM1-like protein 3 OS=Bos taurus OX=9913 GN=ORMDL3 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.007e-55
Identity = 85/154 (55.19%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HFI+N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. UniProt/SwissProt
Match: sp|Q5R570|ORML3_PONAB (ORM1-like protein 3 OS=Pongo abelii OX=9601 GN=ORMDL3 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.293e-55
Identity = 84/154 (54.55%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. UniProt/SwissProt
Match: sp|Q8N138|ORML3_HUMAN (ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.336e-55
Identity = 84/154 (54.55%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y+L I ++H V L IPF+SV  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. TrEMBL
Match: A0A4E0RW75 (Oligosaccharyltransferase complex subunit delta OS=Fasciola hepatica OX=6192 GN=D915_007103 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 2.735e-79
Identity = 113/153 (73.86%), Postives = 134/153 (87.58%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINR 561
            MQVGTA S  NPT  YFNS+G+W+TYIL+I++VHFV LC+PFLS A +WTLTC+ HNV MY  LHWEKGSPYETLDQG+ARVLTQWEQFDDGEQ SPTKKFL VVPIVLFL+ASFYT+Y+ TH +IN+ +L+ILA++PKLPQ +R+RLF INR
Sbjct:    1 MQVGTATSVLNPTSEYFNSQGTWVTYILVIVIVHFVLLCVPFLSTAVVWTLTCSIHNVFMYLFLHWEKGSPYETLDQGEARVLTQWEQFDDGEQFSPTKKFLLVVPIVLFLLASFYTEYDPTHCLINASSLIILAVLPKLPQFYRVRLFGINR 153          
BLAST of ORM1-like protein vs. TrEMBL
Match: A0A0X3PJJ1 (ORM1-like protein 2 OS=Schistocephalus solidus OX=70667 GN=ORML2 PE=4 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.870e-78
Identity = 110/153 (71.90%), Postives = 133/153 (86.93%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINR 561
            MQVGTA ST NPTF Y NS G+W+TY++LI + HF FLCIPFLSVA +WTLTCTFHNV+ Y +LHWEKGSPYETLDQG+ARVLTQWEQFDDGEQ SPTKKFL VVPIV+F++ASFYT+Y+  HF IN+  L++L+++PKLPQ +R+R+F INR
Sbjct:    1 MQVGTATSTANPTFDYLNSTGTWITYLILIALCHFFFLCIPFLSVASVWTLTCTFHNVITYLLLHWEKGSPYETLDQGEARVLTQWEQFDDGEQYSPTKKFLLVVPIVIFILASFYTQYDPIHFAINASTLILLSILPKLPQFYRVRVFGINR 153          
BLAST of ORM1-like protein vs. TrEMBL
Match: A0A564Y020 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1097 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 8.270e-77
Identity = 108/154 (70.13%), Postives = 131/154 (85.06%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            MQVGTA ST NPT  Y NS G+W+TY+LLI   H + LCIPFLSVA +WTLTCT HNVL Y ILHWEKGSPYETLDQG+ARVLTQWEQFDDGEQ SPTKKFL VVPI++F++ASFYT+Y+  HF+IN+  L++L+++PKLPQ +R+R+F INR+
Sbjct:    1 MQVGTATSTANPTSEYLNSTGTWITYLLLIAGCHLILLCIPFLSVASVWTLTCTLHNVLTYLILHWEKGSPYETLDQGEARVLTQWEQFDDGEQYSPTKKFLLVVPIIIFILASFYTQYDPIHFVINASTLILLSILPKLPQFYRVRVFGINRW 154          
BLAST of ORM1-like protein vs. TrEMBL
Match: A0A0R3TVL9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11862 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.663e-76
Identity = 108/154 (70.13%), Postives = 131/154 (85.06%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            MQVGTA ST NPT  Y NS G+W+TY+LLI   H + LCIPFLSVA +WTLTCT HNVL Y ILHWEKGSPYETLDQG+ARVLTQWEQFDDGEQ SPTKKFL VVPI++F++ASFYT+Y+  HF+IN+  L++L+++PKLPQ +R+R+F INR+
Sbjct:    1 MQVGTATSTANPTSEYINSTGTWITYLLLIAGFHLILLCIPFLSVASVWTLTCTLHNVLTYLILHWEKGSPYETLDQGEARVLTQWEQFDDGEQYSPTKKFLLVVPIIIFILASFYTQYDPIHFVINASTLILLSILPKLPQFYRVRVFGINRW 154          
BLAST of ORM1-like protein vs. TrEMBL
Match: A0A4S2LE16 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009592 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 1.719e-76
Identity = 107/153 (69.93%), Postives = 132/153 (86.27%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINR 561
            MQVGTA S  NPT  YFNS G+W+TYIL+I++ HFV LC+PFL+ A +WTLTC+ HN +MY +LHWEKGSPYETLDQG+ARVLTQWEQFDDGEQ SPTKKFL VVPIVLFL+ASFYT+Y+  H +IN+ +L++LA++PKLPQ +R+R+F INR
Sbjct:    1 MQVGTATSVLNPTSEYFNSHGTWVTYILIIVLGHFVLLCVPFLTTAVVWTLTCSIHNAVMYLLLHWEKGSPYETLDQGEARVLTQWEQFDDGEQFSPTKKFLLVVPIVLFLLASFYTEYDPMHCLINASSLIVLAVLPKLPQFYRVRIFGINR 153          
BLAST of ORM1-like protein vs. Ensembl Cavefish
Match: ormdl2 (ORM1-like protein 2 [Source:NCBI gene;Acc:103029753])

HSP 1 Score: 184.882 bits (468), Expect = 9.911e-59
Identity = 89/154 (57.79%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY+LL I++H V L IPF SV+ +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+L+ASFYTKY+ THF+IN+ +L +  L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLTYLLLTIVLHVVLLSIPFFSVSLVWTLTNVIHNLAMYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGIQFTSSRKFLTISPIVLYLLASFYTKYDATHFLINTGSL-LSVLLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Cavefish
Match: ormdl2 (ORM1-like protein 2 [Source:NCBI gene;Acc:103029753])

HSP 1 Score: 184.882 bits (468), Expect = 9.911e-59
Identity = 89/154 (57.79%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY+LL I++H V L IPF SV+ +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D G Q + ++KFLT+ PIVL+L+ASFYTKY+ THF+IN+ +L +  L+PKLPQ H +RLF IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLTYLLLTIVLHVVLLSIPFFSVSLVWTLTNVIHNLAMYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGIQFTSSRKFLTISPIVLYLLASFYTKYDATHFLINTGSL-LSVLLPKLPQFHGVRLFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Cavefish
Match: ormdl1 (ORMDL sphingolipid biosynthesis regulator 1 [Source:NCBI gene;Acc:103027115])

HSP 1 Score: 174.481 bits (441), Expect = 1.465e-54
Identity = 82/154 (53.25%), Postives = 107/154 (69.48%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY L + M+H V L IPF SV  +WTLT   HN  MY  +H  KG+P+ET DQGKAR+LT WEQ D G Q + ++KF T+ PI+L+ +ASFYTKY+  HF+IN+ +L+ + L+PKLPQLH +R+  IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLTYALGVGMLHIVLLSIPFFSVPVVWTLTNVIHNFGMYVFMHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDTAHFVINTASLLSV-LIPKLPQLHGVRILGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Cavefish
Match: ormdl1 (ORMDL sphingolipid biosynthesis regulator 1 [Source:NCBI gene;Acc:103027115])

HSP 1 Score: 173.711 bits (439), Expect = 1.065e-53
Identity = 82/156 (52.56%), Postives = 108/156 (69.23%), Query Frame = 1
Query:   97 LNMQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            + M VG A S  NP     NSRG WLTY L + M+H V L IPF SV  +WTLT   HN  MY  +H  KG+P+ET DQGKAR+LT WEQ D G Q + ++KF T+ PI+L+ +ASFYTKY+  HF+IN+ +L+ + L+PKLPQLH +R+  IN++
Sbjct:   44 VKMNVGVAHSEVNPNTRVMNSRGIWLTYALGVGMLHIVLLSIPFFSVPVVWTLTNVIHNFGMYVFMHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDTAHFVINTASLLSV-LIPKLPQLHGVRILGINKY 198          
BLAST of ORM1-like protein vs. Ensembl Sea Lamprey
Match: ormdl3 (ORMDL sphingolipid biosynthesis regulator 3 [Source:NCBI gene;Acc:450067])

HSP 1 Score: 181.03 bits (458), Expect = 6.163e-58
Identity = 84/154 (54.55%), Postives = 113/154 (73.38%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M+VGTA S  NP     NSRG WLTY+L I ++H V L IPF SV+ +WTLT   HN+ MY  LH  KG+P+ET DQGK R+LT WEQ D G Q + ++KFLT+ PIVL+ + SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MEVGTAHSEVNPNTRVMNSRGIWLTYVLAIGLLHVVLLSIPFCSVSLVWTLTNVIHNLGMYIFLHTVKGTPFETPDQGKDRLLTHWEQMDYGVQFTSSRKFLTITPIVLYFLTSFYTKYDAVHFVVNTLSLMSV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Sea Lamprey
Match: ormdl2 (ORMDL sphingolipid biosynthesis regulator 2 [Source:ZFIN;Acc:ZDB-GENE-060331-113])

HSP 1 Score: 167.933 bits (424), Expect = 1.039e-52
Identity = 84/154 (54.55%), Postives = 112/154 (72.73%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WL+Y+L ++++H V L IPF+SV  +WTLT   HNV MY  LH  KG+P+ET DQG+AR+LT WEQ D G Q + ++KFLT+ PIVL+ +ASFYTKYEV HF++N+++L +  L+PKLPQLH +R   IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGMWLSYVLAVLLLHVVLLSIPFVSVPVVWTLTNVIHNVGMYLFLHTLKGTPFETPDQGRARLLTYWEQMDHGFQYTASRKFLTISPIVLYFLASFYTKYEVAHFVVNTVSL-LSVLIPKLPQLHGVRFLGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Yeast
Match: ORM2 (Protein that mediates sphingolipid homeostasis; evolutionarily conserved, required for resistance to agents that induce unfolded protein response; Orm1p and Orm2p together control membrane biogenesis by coordinating lipid homeostasis with protein quality control; protein abundance increases in response to DNA replication stress; ORM2 has a paralog, ORM1, that arose from the whole genome duplication [Source:SGD;Acc:S000004342])

HSP 1 Score: 94.3597 bits (233), Expect = 6.855e-24
Identity = 51/139 (36.69%), Postives = 85/139 (61.15%), Query Frame = 1
Query:  130 PNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRL 546
            PN    + + RG+WL +I++I+++  +F  +   +  W WTLT   + +  Y + H  KG+P++  + G    LT WEQ +D    +PT+KFL +VPIVLFLI++ Y + ++T F+ N    V++ +VPKL   HR+R+
Sbjct:   68 PNMNATWVDQRGAWLIHIVVIVLLR-LFYSLFGSTPKWTWTLTNMTYIIGFYIMFHLVKGTPFD-FNGGAYDNLTMWEQINDETLYTPTRKFLLIVPIVLFLISNQYYRNDMTLFLSNLAVTVLIGVVPKLGITHRLRI 204          
BLAST of ORM1-like protein vs. Ensembl Yeast
Match: ORM1 (Protein that mediates sphingolipid homeostasis; evolutionarily conserved, required for resistance to agents that induce unfolded protein response; Orm1p and Orm2p together control membrane biogenesis by coordinating lipid homeostasis with protein quality control; ORM1 has a paralog, ORM2, that arose from the whole genome duplication [Source:SGD;Acc:S000003270])

HSP 1 Score: 89.7373 bits (221), Expect = 5.249e-22
Identity = 49/139 (35.25%), Postives = 80/139 (57.55%), Query Frame = 1
Query:  130 PNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRL 546
            PN    + + RG+W+ ++++II++   +   P ++  W WTLT   + +  Y + H  KG+P++  + G    LT WEQ DD    +P++KFL  VPI LFL+++ Y  Y++  F  N       A+VPKLP  HR+R+
Sbjct:   73 PNMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMTYVIGSYVMFHLIKGTPFD-FNGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAHYDLKLFSWNCFLTTFGAVVPKLPVTHRLRI 210          
BLAST of ORM1-like protein vs. Ensembl Nematostella
Match: EDO43655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY87])

HSP 1 Score: 178.333 bits (451), Expect = 1.768e-56
Identity = 83/154 (53.90%), Postives = 119/154 (77.27%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            MQVGTA S  NP   + +S+G+WLTYI++II+ H V L +PF + +  WTLT T HN+ M+ +LH+ KG+P+ET DQGKAR LT WEQ + G Q + T+KF T++PI LF+I SFYTKY+  HFIIN+++L++L+LVPK PQ++++RLF +N++
Sbjct:    1 MQVGTAHSIDNPNESWLDSKGTWLTYIIMIILGHLVILSVPFFATSTAWTLTNTMHNLCMFLLLHYVKGTPFETSDQGKARRLTHWEQINQGVQFTQTRKFFTLIPIFLFMITSFYTKYDGIHFIINAVSLLLLSLVPKFPQMYKVRLFGLNKY 154          
BLAST of ORM1-like protein vs. Ensembl Nematostella
Match: EDO28402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6K3])

HSP 1 Score: 67.0106 bits (162), Expect = 8.034e-15
Identity = 28/50 (56.00%), Postives = 38/50 (76.00%), Query Frame = 1
Query:  280 MYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVL 429
            M+ +LH+ KG+P+ET DQGKAR LT WEQ + G Q + T+KF T++PI L
Sbjct:    5 MFLLLHYVKGTPFETSDQGKARRLTHWEQINQGVQFTQTRKFFTLIPIFL 54          
BLAST of ORM1-like protein vs. Ensembl Medaka
Match: ormdl3 (ORM1-like protein 3 [Source:NCBI gene;Acc:111946406])

HSP 1 Score: 182.185 bits (461), Expect = 1.252e-57
Identity = 84/154 (54.55%), Postives = 114/154 (74.03%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VGTA S  NP     NSRG WL+Y L I ++H + L IPF+SV  +WTLT   HN+ MY +LH  KG+P++T DQGKAR+LT WEQ D G Q + ++KFLTV PIVL+L+ SFYTKY+  HF++N+++L+ + L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGTAHSEVNPNTRVMNSRGMWLSYTLSIGLLHLILLSIPFVSVPVVWTLTNMIHNLCMYLLLHTVKGTPFQTPDQGKARLLTHWEQMDYGVQFTASRKFLTVTPIVLYLLTSFYTKYDRVHFVVNTVSLLTV-LIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Medaka
Match: ormdl1 (ORMDL sphingolipid biosynthesis regulator 1 [Source:NCBI gene;Acc:101160518])

HSP 1 Score: 176.022 bits (445), Expect = 3.291e-55
Identity = 83/154 (53.90%), Postives = 108/154 (70.13%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY L + ++H V L IPF SV  +WTLT   HN  MY  +H  KG+P+ET DQGKAR+LT WEQ D G Q + ++KF T+ PI+L+ +ASFYTKY+ THF+IN+ +L +  L+PKLPQLH +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLTYALGVGVLHIVLLSIPFFSVPVVWTLTNVIHNFGMYVFMHAVKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDTTHFVINTASL-LSVLIPKLPQLHGVRIFGINKY 153          
BLAST of ORM1-like protein vs. Ensembl Medaka
Match: ENSORLT00000019052.2 (ORM1-like protein 2 [Source:NCBI gene;Acc:101173704])

HSP 1 Score: 159.458 bits (402), Expect = 1.012e-48
Identity = 85/154 (55.19%), Postives = 112/154 (72.73%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            M VG A S  NP     NSRG WLTY+LL +++H V L IPFL+V  +WTLT   HN+ MY  LH  KG+P+ET DQGKAR+LT WEQ D+G Q + ++KFLT+ PIVL+++ SFYTKY+ THF IN+ +L +  L+PKLPQ H +R+F IN++
Sbjct:    1 MNVGVAHSEVNPNTRVMNSRGIWLTYLLLTVVLHVVLLSIPFLTVPLVWTLTNVIHNLAMYLFLHTVKGTPFETPDQGKARLLTHWEQMDNGIQFTSSRKFLTISPIVLYILTSFYTKYDPTHFFINTCSL-LSVLLPKLPQFHGVRVFGINKY 153          
BLAST of ORM1-like protein vs. Planmine SMEST
Match: SMESG000024189.1 (SMESG000024189.1)

HSP 1 Score: 317.005 bits (811), Expect = 6.666e-111
Identity = 154/154 (100.00%), Postives = 154/154 (100.00%), Query Frame = 1
Query:  103 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 564
            MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF
Sbjct:    1 MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWTLTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKKFLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFNINRF 154          
The following BLAST results are available for this feature:
BLAST of ORM1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ORMDL32.782e-5654.55ORMDL sphingolipid biosynthesis regulator 3 [Sourc... [more]
ORMDL32.782e-5654.55ORMDL sphingolipid biosynthesis regulator 3 [Sourc... [more]
ORMDL32.782e-5654.55ORMDL sphingolipid biosynthesis regulator 3 [Sourc... [more]
ORMDL29.902e-5553.25ORMDL sphingolipid biosynthesis regulator 2 [Sourc... [more]
ORMDL29.902e-5553.25ORMDL sphingolipid biosynthesis regulator 2 [Sourc... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ORM1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ORMDL2.802e-4045.10gene:FBgn0037110 transcript:FBtr0078423[more]
back to top
BLAST of ORM1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ormdl32.016e-5654.55ORMDL sphingolipid biosynthesis regulator 3 [Sourc... [more]
ormdl32.016e-5654.55ORMDL sphingolipid biosynthesis regulator 3 [Sourc... [more]
ormdl12.531e-5553.90ORMDL sphingolipid biosynthesis regulator 1 [Sourc... [more]
ormdl21.102e-5255.84ORMDL sphingolipid biosynthesis regulator 2 [Sourc... [more]
ormdl21.102e-5255.84ORMDL sphingolipid biosynthesis regulator 2 [Sourc... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
birc63.726e-5553.25baculoviral IAP repeat containing 6 [Source:Xenbas... [more]
slc18b16.696e-5555.19solute carrier family 18, subfamily B, member 1 [S... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ormdl36.446e-5755.19ORM1-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Ormdl15.462e-5453.25ORM1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Ormdl27.513e-5254.55ORM1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Ormdl27.513e-5254.55ORM1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Ormdl27.513e-5254.55ORM1-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of ORM1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CPZ6|ORML3_MOUSE4.509e-5655.19ORM1-like protein 3 OS=Mus musculus OX=10090 GN=Or... [more]
sp|Q6QI25|ORML3_RAT7.039e-5655.19ORM1-like protein 3 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q0VD15|ORML3_BOVIN1.007e-5555.19ORM1-like protein 3 OS=Bos taurus OX=9913 GN=ORMDL... [more]
sp|Q5R570|ORML3_PONAB1.293e-5554.55ORM1-like protein 3 OS=Pongo abelii OX=9601 GN=ORM... [more]
sp|Q8N138|ORML3_HUMAN1.336e-5554.55ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORM... [more]
back to top
BLAST of ORM1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RW752.735e-7973.86Oligosaccharyltransferase complex subunit delta OS... [more]
A0A0X3PJJ11.870e-7871.90ORM1-like protein 2 OS=Schistocephalus solidus OX=... [more]
A0A564Y0208.270e-7770.13Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3TVL91.663e-7670.13Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A4S2LE161.719e-7669.93Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ormdl29.911e-5957.79ORM1-like protein 2 [Source:NCBI gene;Acc:10302975... [more]
ormdl29.911e-5957.79ORM1-like protein 2 [Source:NCBI gene;Acc:10302975... [more]
ormdl11.465e-5453.25ORMDL sphingolipid biosynthesis regulator 1 [Sourc... [more]
ormdl11.065e-5352.56ORMDL sphingolipid biosynthesis regulator 1 [Sourc... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ormdl36.163e-5854.55ORMDL sphingolipid biosynthesis regulator 3 [Sourc... [more]
ormdl21.039e-5254.55ORMDL sphingolipid biosynthesis regulator 2 [Sourc... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ORM26.855e-2436.69Protein that mediates sphingolipid homeostasis; ev... [more]
ORM15.249e-2235.25Protein that mediates sphingolipid homeostasis; ev... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO436551.768e-5653.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284028.034e-1556.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ORM1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ormdl31.252e-5754.55ORM1-like protein 3 [Source:NCBI gene;Acc:11194640... [more]
ormdl13.291e-5553.90ORMDL sphingolipid biosynthesis regulator 1 [Sourc... [more]
ENSORLT00000019052.21.012e-4855.19ORM1-like protein 2 [Source:NCBI gene;Acc:10117370... [more]
back to top
BLAST of ORM1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000024189.16.666e-111100.00SMESG000024189.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035214 ID=SMED30035214|Name=ORM1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=831bp
GCCACTTTATGCGGTAAATTGAAAATATAAATAAAAAGTCGTAATTATTG
TTAATTTTGATTTCAAATTACACACTGTTTAAGAATTCAGTAAATATTGA
ATATGCAAGTTGGTACAGCTGATTCGACTCCAAATCCGACATTTCATTAT
TTTAATAGTCGTGGTTCATGGCTAACATACATCTTACTTATTATTATGGT
TCATTTTGTTTTTCTCTGTATACCTTTCCTATCTGTAGCATGGATATGGA
CACTAACTTGCACATTTCATAATGTTTTGATGTATTTTATACTTCATTGG
GAAAAGGGAAGTCCCTACGAAACTCTTGATCAAGGTAAAGCAAGAGTTTT
AACTCAATGGGAACAGTTCGATGATGGTGAGCAGTTATCTCCAACAAAAA
AATTTCTCACTGTGGTTCCAATAGTATTATTTTTGATTGCCAGTTTCTAT
ACAAAATATGAAGTCACTCATTTCATTATCAATTCAATCGCATTAGTTAT
TTTAGCATTGGTTCCAAAGCTTCCACAGTTGCATCGTATCCGGTTATTTA
ATATCAATCGATTTTAATCTGATTTGGATGATTGATTATTATTATTATTA
TTATGTCATCCATACAATATATAAAATATTCTCTGTGAATAAGATTTTAA
AAATGGAATAAACATTTAGTGAACTTTCTGATTTTCAATTACATAATATC
TTTGAAGATTATTCTATTGATTGTTTTTTGAAAGCAATACTTTTGTAAAA
TGATTGGATCAAGTATTGTTTTTATTTTCAATTTGATTTTAGATGATTAT
TATTATTATTATGTAACATATTAATTTTGGC
back to top

protein sequence of SMED30035214-orf-1

>SMED30035214-orf-1 ID=SMED30035214-orf-1|Name=SMED30035214-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MQVGTADSTPNPTFHYFNSRGSWLTYILLIIMVHFVFLCIPFLSVAWIWT
LTCTFHNVLMYFILHWEKGSPYETLDQGKARVLTQWEQFDDGEQLSPTKK
FLTVVPIVLFLIASFYTKYEVTHFIINSIALVILALVPKLPQLHRIRLFN
INRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006672ceramide metabolic process
GO:0090155negative regulation of sphingolipid biosynthetic process
GO:0090156cellular sphingolipid homeostasis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR029883ORML3
IPR007203ORMDL
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007203ORMDL familyPFAMPF04061ORMDLcoord: 11..147
e-value: 5.9E-51
score: 171.8
IPR007203ORMDL familyPIRSFPIRSF018147ORM1coord: 1..154
e-value: 2.0E-57
score: 191.6
IPR007203ORMDL familyPANTHERPTHR12665ORMDL PROTEINScoord: 1..154
IPR029883ORM1-like protein 3PANTHERPTHR12665:SF11ORM1-LIKE PROTEIN 3coord: 1..154
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 101..117
NoneNo IPR availableTMHMMTMhelixcoord: 121..143