slc17a-6

Overview
Nameslc17a-6 (AKN21529.1)
Smed IDSMED30035201
Length (bp)1811
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc17a-6 (SMED30035201) t-SNE clustered cells

Violin plots show distribution of expression levels for slc17a-6 (SMED30035201) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc17a-6 (SMED30035201) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc17a-6 (SMED30035201) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035201

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30035201SMESG000049463.1 PL05004B2F09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30035201SMESG000049463.1 dd_Smed_v4_8907_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035201SMESG000049463.1 dd_Smed_v4_8907_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30035201SMESG000049463.1 dd_Smed_v4_8907_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc17a-6 vs. Ensembl Human
Match: SLC17A5 (solute carrier family 17 member 5 [Source:HGNC Symbol;Acc:HGNC:10933])

HSP 1 Score: 246.514 bits (628), Expect = 6.508e-74
Identity = 157/455 (34.51%), Postives = 250/455 (54.95%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPV-SKPNNSIKRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAI 1482
             R+  A + F G  IVY LRVN+SVA+V M +S T  +    +  CP  S P      +TG+ + W    Q  IL SF++GY + QIP G +      K + G   L T++LT F P+AA+ GV  +++LR L G+ EG T+P+++A+   W    E S +++    G  +GT++   LSG+I  Y+ W ++FY     G  WF+ +  LV + P +H  IS +EK  +++SL +   + K     +PW  + KS P +  ++   +YN+T+YTL+  LP Y+  +L FN+ ENG +SSLPY+  +   + SG   D +++K   S   +R+IF+  GM G ++ +    F+GC+  L +  + +S  + G   S   +N +DIAP+YAG LL I N F ++ G++ P +    T    T   W  VF   +++  FGA+ F LF    +Q WA+
Sbjct:   38 ARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKS----VPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLT-PDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWAL 487          
BLAST of slc17a-6 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 219.164 bits (557), Expect = 4.467e-63
Identity = 141/479 (29.44%), Postives = 235/479 (49.06%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTD 1563
            R+I A M  LG  I + +R N+ VAIV+M N++             +     +  +  +F W      +I  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P+ HP ISE E+  + +++  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF++S++I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      E+   F   D L+  ++ E  D
Sbjct:   62 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST------------THRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGF-GMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKH-KTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMED 526          
BLAST of slc17a-6 vs. Ensembl Human
Match: SLC17A6 (solute carrier family 17 member 6 [Source:HGNC Symbol;Acc:HGNC:16703])

HSP 1 Score: 217.238 bits (552), Expect = 3.262e-62
Identity = 146/487 (29.98%), Postives = 237/487 (48.67%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMAN-STVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNI 1584
            R+I A M  LG  I + +R N+ VAIV M N ST+ +                + +E  +F W      MI  SF+WGY + QIP G +        ++G + L TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG VW++ + L+ +  P++HP I++ E+  +  S+  +       ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S++P++ +       G   DF++SK+I+S T +RKI  C G  G    +  ++       + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + ++R  W  VF+  + V + G + + +F S   QPWA      E+   F   D L     DE T   +Q  I
Sbjct:   70 RYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHR-------------GGKVIKEKAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGF-GMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKN-KSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEETSEEKCGFIHEDEL-----DEETGDITQNYI 536          
BLAST of slc17a-6 vs. Ensembl Human
Match: SLC17A7 (solute carrier family 17 member 7 [Source:HGNC Symbol;Acc:HGNC:16704])

HSP 1 Score: 214.157 bits (544), Expect = 6.820e-62
Identity = 138/473 (29.18%), Postives = 231/473 (48.84%), Query Frame = 1
Query:  148 MGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTD 1563
            M  LG  I + +R N+ VAIV+M N++             +     +  +  +F W      +I  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P+ HP ISE E+  + +++  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF++S++I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      E+   F   D L+  ++ E  D
Sbjct:    1 MSGLGFCISFGIRCNLGVAIVSMVNNST------------THRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPLTKFSTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRRIMSTTNVRKLMNCGGF-GMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKH-KTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMED 459          
BLAST of slc17a-6 vs. Ensembl Human
Match: SLC17A8 (solute carrier family 17 member 8 [Source:HGNC Symbol;Acc:HGNC:20151])

HSP 1 Score: 213.386 bits (542), Expect = 1.097e-60
Identity = 148/480 (30.83%), Postives = 235/480 (48.96%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMAN-STVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDS 1566
            R+I A M  LG  I + +R N+ VAIV M N STV+   +  PE            +T +F W      +I  SF+WGY + QIP G +   F    ++G +   TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y+GW  +FYI  MFG +W++ + L  +  P+ HP IS  EK  +  S+          +   PWK  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S++P++ +       G   D+++S++I++ T +RKI  C G  G    +  ++       + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W NVF+  + V + G + + +F S   Q WA    D E L      +    I++DE  + 
Sbjct:   75 RYIIAIMSGLGFCISFGIRCNLGVAIVEMVNNSTVYV--DGKPEI-----------QTAQFNWDPETVGLIHGSFFWGYIMTQIPGGFISNKFAANRVFGAAIFLTSTLNMFIPSAARVHYGCVMCVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYIGWSSVFYIYGMFGIIWYMFWLLQAYECPAAHPTISNEEKTYIETSIGEGANVVSLSKFSTPWKRFFTSLPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSAVPHMVMTIVVPIGGQLADYLRSRQILTTTAVRKIMNCGGF-GMEATLLLVVGFSHTKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTRH-KTREEWQNVFLIAALVHYSGVIFYGVFASGEKQEWA----DPENL----SEEKCGIIDQDELAEE 531          
BLAST of slc17a-6 vs. Ensembl Celegans
Match: slc-17.2 (Uncharacterized transporter slc-17.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03567])

HSP 1 Score: 199.904 bits (507), Expect = 5.122e-57
Identity = 141/487 (28.95%), Postives = 244/487 (50.10%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMAN-----STVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIP-LTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTD 1563
            RF  + + F G ++ YM+R N+S A+V M N     + V K      E    + N+S+    GEF W +    M+LSSF++GY   QI  G L   +  K +  ++ L +++LT   P+AA +  YA+ ILR  +G  +G T+P+++ +   W    E S++      G  IG ++   LSG + EY    GW  +FYI+ +FG +W   +  +  ++P+ HP I+  EK  ++ ++  +      K    PW  +  S   +         ++  YT++  LP ++  VLG N+S  G ++S+PYIA F    + G+  D ++SK I+S    R+      + G  I +    + GC    L I+ +   +A+ G+  +   VN ++IAP ++G ++   N  ++L GII+P V  Y T +G T+  W  V    + ++  GA++F +F S  +QPWA L  +        E   ++ + E E+ +
Sbjct:   15 RFALSLVMFFGCLVTYMMRTNMSFAVVCMVNENKTDTGVEKVSRCGKEMTPVESNSSV---IGEFDWDKQTTGMVLSSFFYGYIGSQIIGGHLASRYGGKRVVFVTILGSALLTLLNPVAARTSEYALAILRAAIGFLQGATFPAMHTMWSVWGPPLELSVLTGVTYAGAQIGNVIVLPLSGFLCEYGFDGGWPSIFYIIGVFGVLWTAVWWYVSSDKPATHPRITPEEKQYIVTAVEASMGKDTGKVPSTPWIKILTSPAVWACWAGHFAGDWGAYTMLVSLPSFLKDVLGLNLSSLGAVASIPYIAYFLAINAGGVLADTLRSKGILSTLNTRRAAMLVALIGQGIFLVASGYCGCGQDVLVIIFITCGMAISGLQYAGFVVNYLEIAPPFSGTVMGTGNTISALAGIISPAVSSYLTPNG-TQEEWQMVLWLTAGILTIGALLFSIFASGEVQPWAKLTAE--------EGHEMAPLREGEKIE 489          
BLAST of slc17a-6 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 184.496 bits (467), Expect = 2.117e-51
Identity = 131/451 (29.05%), Postives = 217/451 (48.12%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFL-WGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            R + A +  LG   +Y +R N+S+AIV M + T              K N +     G+F  W    Q ++LSSF++GY + Q+P G L      K I+   T  T++ T   P  A  G   +V  RF+ G+ EG TYP+++ +   W    E + + T   +G   GT++   LS  + E+ GW  +F+     G +W + +   V +RP + P IS  E + L+     +Q +Y      +PW  + +S+P +  ++  +  N  +Y ++  LP  +  + G+N+ + G  SSLPY  + F  ++ G   D+++  K      +RK+    G  G S+ +F ++    N  L ++   +S+ + GI      VN +D+AP YAG L+A  N F ++ GI  P + G    +G T   W  +     S    GA +F  F  +TLQPWA
Sbjct:   33 RHVVAILALLGFANIYAMRANLSIAIVEMTSGTE------------RKVNGTTLHVLGDFENWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSE-LALLQRDAVSQNHYI-----VPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLF-LVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNG-TIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWA 463          
BLAST of slc17a-6 vs. Ensembl Celegans
Match: slc-17.1 (SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:Q23514])

HSP 1 Score: 184.111 bits (466), Expect = 2.758e-51
Identity = 131/451 (29.05%), Postives = 217/451 (48.12%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFL-WGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            R + A +  LG   +Y +R N+S+AIV M + T              K N +     G+F  W    Q ++LSSF++GY + Q+P G L      K I+   T  T++ T   P  A  G   +V  RF+ G+ EG TYP+++ +   W    E + + T   +G   GT++   LS  + E+ GW  +F+     G +W + +   V +RP + P IS  E + L+     +Q +Y      +PW  + +S+P +  ++  +  N  +Y ++  LP  +  + G+N+ + G  SSLPY  + F  ++ G   D+++  K      +RK+    G  G S+ +F ++    N  L ++   +S+ + GI      VN +D+AP YAG L+A  N F ++ GI  P + G    +G T   W  +     S    GA +F  F  +TLQPWA
Sbjct:   38 RHVVAILALLGFANIYAMRANLSIAIVEMTSGTE------------RKVNGTTLHVLGDFENWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFARMGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSAYLGEHFGWPMIFWFFGALGVIWCMVWYKTVHDRPEDDPKISTSE-LALLQRDAVSQNHYI-----VPWAQILRSKPVWAVIVAHSAQNLGFYIMLTNLPKMLKDIAGYNVEKAGIASSLPYFLMGFQIITGGQLCDYLRRDKHYDTLFVRKMACALGFIGQSVFLF-LVMTTSNSLLLVLFFSISIGLGGICWCGFSVNHLDLAPQYAGHLMATSNTFATIPGIFGPLLVGAIVQNG-TIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWA 468          
BLAST of slc17a-6 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 177.563 bits (449), Expect = 2.280e-48
Identity = 123/452 (27.21%), Postives = 221/452 (48.89%), Query Frame = 1
Query:  118 KIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAAN-SGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQ 1470
            K   R++ A +  +G +I + +R N   A   M        KN+T       P   +     EF W   + +++ SS+++GY + QIP+G L   F P  ++G      + L   +P        Y +  ++   G+ +G  YP+++ +   W    E S + T   TG   G +LG  LS  ++ Y+ W   FY+  + G +W I +  + F +P+ HP IS+ EK+ + +++ H   N  P    +PWK +  S+P +  ++     ++T+Y L+     Y+   LG  I+++G ++++P++ +    +  G   D+++S KI+S T +RKIF C G  G +  M  + +   +    IM +  +V M G  +S   VN +DIAP YA  L+   N   +L G+  P+V   +T    +++ W +VF+  S + F G   + ++ S  LQ
Sbjct:   44 KCRKRWLLAILANMGFMISFGIRCNFGAAKTHMY-------KNYT------DPYGKVHMH--EFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVS-NTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDT-TAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFT--AHSKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 476          
BLAST of slc17a-6 vs. Ensembl Celegans
Match: eat-4 (Probable vesicular glutamate transporter eat-4 [Source:UniProtKB/Swiss-Prot;Acc:P34644])

HSP 1 Score: 177.948 bits (450), Expect = 2.987e-48
Identity = 123/452 (27.21%), Postives = 221/452 (48.89%), Query Frame = 1
Query:  118 KIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAAN-SGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQ 1470
            K   R++ A +  +G +I + +R N   A   M        KN+T       P   +     EF W   + +++ SS+++GY + QIP+G L   F P  ++G      + L   +P        Y +  ++   G+ +G  YP+++ +   W    E S + T   TG   G +LG  LS  ++ Y+ W   FY+  + G +W I +  + F +P+ HP IS+ EK+ + +++ H   N  P    +PWK +  S+P +  ++     ++T+Y L+     Y+   LG  I+++G ++++P++ +    +  G   D+++S KI+S T +RKIF C G  G +  M  + +   +    IM +  +V M G  +S   VN +DIAP YA  L+   N   +L G+  P+V   +T    +++ W +VF+  S + F G   + ++ S  LQ
Sbjct:   65 KCRKRWLLAILANMGFMISFGIRCNFGAAKTHMY-------KNYT------DPYGKVHMH--EFNWTIDELSVMESSYFYGYLVTQIPAGFLAAKFPPNKLFGFGIGVGAFLNILLPYGFKVKSDYLVAFIQITQGLVQGVCYPAMHGVWRYWAPPMERSKLATTAFTGSYAGAVLGLPLSAFLVSYVSWAAPFYLYGVCGVIWAILWFCVTFEKPAFHPTISQEEKIFIEDAIGHVS-NTHPTIRSIPWKAIVTSKPVWAIIVANFARSWTFYLLLQNQLTYMKEALGMKIADSGLLAAIPHLVMGCVVLMGGQLADYLRSNKILSTTAVRKIFNCGGFGGEAAFMLIVAYTTSDT-TAIMALIAAVGMSGFAISGFNVNHLDIAPRYAAILMGFSNGIGTLAGLTCPFVTEAFT--AHSKHGWTSVFLLASLIHFTGVTFYAVYASGELQ 497          
BLAST of slc17a-6 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0339677)

HSP 1 Score: 230.72 bits (587), Expect = 9.230e-68
Identity = 152/480 (31.67%), Postives = 255/480 (53.12%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKN----FTPECPVSKPNNSIK----RETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLI--IEYL-GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLP-----------------HNQPNYK-PKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCN-IPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            R IF +MGFLG  +VY +RVN+SVAIVAM N T     N     T  CP+  P+++      ++ GEF+W EA Q ++L SF++GY L Q+P G +   +  K IYG   L T++ T   PLAA+  +  +V++R L G+ EG TYP+++A+   W+   E +     +  G  IGT++   L+G +  +++L GW   FYI  + G +WFI +  LV+++PS+HP ISE E+  +  SL                   ++ + + P   P+PW  +  S P +  L+      + +YT +  LP Y+  +L F+I  N  ++++PY+  +F  ++     D++ +++ IS     K++        S+ +  II++GC+ + +T ML  +  +  G   +   +N I ++P YAG +  I N   ++CG +APYV G   +  ET   W  VF   + +   G  ++L+F S+  Q W+
Sbjct:   68 RHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVG-SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-6 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0073724)

HSP 1 Score: 230.72 bits (587), Expect = 9.230e-68
Identity = 152/480 (31.67%), Postives = 255/480 (53.12%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKN----FTPECPVSKPNNSIK----RETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLI--IEYL-GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLP-----------------HNQPNYK-PKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCN-IPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            R IF +MGFLG  +VY +RVN+SVAIVAM N T     N     T  CP+  P+++      ++ GEF+W EA Q ++L SF++GY L Q+P G +   +  K IYG   L T++ T   PLAA+  +  +V++R L G+ EG TYP+++A+   W+   E +     +  G  IGT++   L+G +  +++L GW   FYI  + G +WFI +  LV+++PS+HP ISE E+  +  SL                   ++ + + P   P+PW  +  S P +  L+      + +YT +  LP Y+  +L F+I  N  ++++PY+  +F  ++     D++ +++ IS     K++        S+ +  II++GC+ + +T ML  +  +  G   +   +N I ++P YAG +  I N   ++CG +APYV G   +  ET   W  VF   + +   G  ++L+F S+  Q W+
Sbjct:   68 RHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVG-SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-6 vs. Ensembl Fly
Match: MFS10 (gene:FBgn0030452 transcript:FBtr0339678)

HSP 1 Score: 230.72 bits (587), Expect = 9.230e-68
Identity = 152/480 (31.67%), Postives = 255/480 (53.12%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKN----FTPECPVSKPNNSIK----RETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLI--IEYL-GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLP-----------------HNQPNYK-PKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCN-IPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            R IF +MGFLG  +VY +RVN+SVAIVAM N T     N     T  CP+  P+++      ++ GEF+W EA Q ++L SF++GY L Q+P G +   +  K IYG   L T++ T   PLAA+  +  +V++R L G+ EG TYP+++A+   W+   E +     +  G  IGT++   L+G +  +++L GW   FYI  + G +WFI +  LV+++PS+HP ISE E+  +  SL                   ++ + + P   P+PW  +  S P +  L+      + +YT +  LP Y+  +L F+I  N  ++++PY+  +F  ++     D++ +++ IS     K++        S+ +  II++GC+ + +T ML  +  +  G   +   +N I ++P YAG +  I N   ++CG +APYV G   +  ET   W  VF   + +   G  ++L+F S+  Q W+
Sbjct:   68 RHIFGFMGFLGFAVVYAMRVNLSVAIVAMVNQTAIPHSNSSVIDTDTCPLPAPHHNGSDPNPQKEGEFVWDEATQGLVLGSFFYGYVLTQVPGGRMAELYGGKKIYGYGVLITAVFTLITPLAAHWDLPLLVLVRILEGMGEGVTYPAMHAMLAHWIPPLERNKFAAIVYAGSNIGTVISMPLAGWLCSLDFLGGWPSAFYIFGLLGILWFIAWMYLVYDKPSDHPRISESEREYIERSLQVQRLINQDLAEAEEEEGQDEVSLRAPPEEPIPWSSLLTSVPLWAILLTQCGQGWAFYTQLTELPTYMSNILHFDIQSNALLNAVPYLTSWFVGIACSALADWMLARRYISLLNSYKLWNTVASVVPSLGLIGIIYVGCDWVWVTFMLAGVG-SFGGAVYAGNQMNHIALSPRYAGTMYGITNSAANICGFLAPYVIGLIINHRETLTQWHLVFWLAAGLNIAGNFIYLIFASAEEQSWS 546          
BLAST of slc17a-6 vs. Ensembl Fly
Match: Picot (gene:FBgn0024315 transcript:FBtr0340067)

HSP 1 Score: 228.409 bits (581), Expect = 3.321e-67
Identity = 156/467 (33.40%), Postives = 237/467 (50.75%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFK---PKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSG-VYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTH--SGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQ 1503
            R+   +M FLG+   Y++R N+SVAIVAM N T  K    + +  EC   +       + GEF W  A Q  ILSSF++GY + QIP GIL   +      G   L  S+  F +P+AA  G V+ +  +RF+ G+ EGP  P  +A+   W+   E S +   +  G   GTI+   LSGL+ EY    GW  +FY+  + G VW I + + V   PS HP I E EK  + +SL        P   P+P+K + KS PF+  L     +N+ + TL+  LP Y+  VL F++  NG +SSLPY+A++ FS+   +  D++ S K  S+T  RK+    G  G  + +    + GC+  LT+ ++ + V + G   S   +N +D+ P +AG L++I N   +L G++AP   G+     S      W  VF   + V       + +FGS   Q W     D ++
Sbjct:   27 RYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECG-DRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSP---PIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYWDNPEDDEQK 489          
BLAST of slc17a-6 vs. Ensembl Fly
Match: Picot (gene:FBgn0024315 transcript:FBtr0087114)

HSP 1 Score: 228.409 bits (581), Expect = 3.321e-67
Identity = 156/467 (33.40%), Postives = 237/467 (50.75%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFK---PKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSG-VYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTH--SGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQ 1503
            R+   +M FLG+   Y++R N+SVAIVAM N T  K    + +  EC   +       + GEF W  A Q  ILSSF++GY + QIP GIL   +      G   L  S+  F +P+AA  G V+ +  +RF+ G+ EGP  P  +A+   W+   E S +   +  G   GTI+   LSGL+ EY    GW  +FY+  + G VW I + + V   PS HP I E EK  + +SL        P   P+P+K + KS PF+  L     +N+ + TL+  LP Y+  VL F++  NG +SSLPY+A++ FS+   +  D++ S K  S+T  RK+    G  G  + +    + GC+  LT+ ++ + V + G   S   +N +D+ P +AG L++I N   +L G++AP   G+     S      W  VF   + V       + +FGS   Q W     D ++
Sbjct:   27 RYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECG-DRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSP---PIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYWDNPEDDEQK 489          
BLAST of slc17a-6 vs. Ensembl Zebrafish
Match: slc17a5 (solute carrier family 17 member 5 [Source:ZFIN;Acc:ZDB-GENE-060929-1158])

HSP 1 Score: 253.062 bits (645), Expect = 9.449e-77
Identity = 163/465 (35.05%), Postives = 254/465 (54.62%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAM--------ANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLE 1500
            R+  A++   G  + Y LRVN+SVA+V M         +S++  P N     PV K N++       + W    Q  IL SF++GY + QIP G L   +  KW+ GL  L T I T   PLAA+ G   ++ +R L G+ EG TYP+++A+   W    E S ++T   TG  +GT++   LSG I  YL W ++FYI    G +WF  +   V N PS H  I+E EK  +++SL +      P +  +PW  +FKS P +  ++   +YN+T+YTL+  LP Y+  VLGF+I +NG +S+LPY+  +  ++  G   D ++ + +     +RK F   GM G ++ +    + GCN  L +  + +S ++ GI+ S   +N +DIAP+YAG LL I N F ++ G++ P +    T S  T   W  VF  ++++  FGAV F +FG  T+QPWA+    ++
Sbjct:   37 RYGLAFLSCYGFFVAYALRVNLSVAMVDMLKNSSKANTSSSICPPHNI----PVPKHNHTAM----VYDWNSETQGWILGSFFYGYIITQIPGGYLARKYGAKWLLGLGILCTVIFTLLTPLAADLGAGYLIAVRVLEGIGEGVTYPAMHAMWASWAPPLERSRLLTISYTGAQLGTVVALPLSGQICFYLDWTYVFYIFGAVGLLWFFLWICFVSNSPSSHKRITEAEKTYIMSSLKNE---LSPTQDYIPWTSIFKSMPLWAIVVAHFSYNWTFYTLLTLLPTYMNDVLGFSIQQNGMLSALPYLGCWLLALLGGQLADLLRERFLFRTVIVRKAFTVVGMAGPAVFLVAAGYTGCNYILAVAFLTISSSLGGISASGFNINHLDIAPSYAGILLGITNSFATIPGMVGPVIARSLTKS-NTIPEWQIVFYISAAINIFGAVFFTIFGKGTVQPWAVQTIHIQ 489          
BLAST of slc17a-6 vs. Ensembl Zebrafish
Match: si:ch1073-513e17.1 (si:ch1073-513e17.1 [Source:ZFIN;Acc:ZDB-GENE-030131-7188])

HSP 1 Score: 225.328 bits (573), Expect = 2.551e-66
Identity = 165/463 (35.64%), Postives = 246/463 (53.13%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKN---FTPECPVSKP---NNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLE 1500
            R   A M F G  +VY LRVN+SVA+VAM N T  +P +    + ECP   P   NNS K            Q M+L +F++GY   QIP G L   F      G   L T++LT   PL+A  G   +  LR L G  EG T+P++ A+   W    E + ++T    G + G  +   L+G I   LGW  +FY     GC+W + + +LV + P  HP I+  EK  +INSL   Q       VP+ W  +F S P +  +I     N+++YTL+  LP+Y+ TVL F++ +N  +S+LPY+A + FSV SG+  D +  K+I+S T +RKIF   G+   +  +  + F GC+  L +  + LS A  G + +   +N IDIAP YAG LL I N F ++ G++AP V         + + W NVF  ++ V  FGA+ +++FG+  +Q WA  + + +
Sbjct:   41 RCNLAVMMFFGFAVVYGLRVNLSVAMVAMVNGTNDQPSSNSSISNECPAPSPAHNNNSQKT-----------QGMLLGAFFFGYLFTQIPGGYLSGRFGGSLFLGGGVLGTALLTLLTPLSAQLGAKWLFALRALEGFGEGVTFPAMMAMWARWAPPLERARLMTFSGAGSSFGAFVALPLTGFICHSLGWPAVFYSCGGAGCLWAVFWFILVSDEPRTHPRITVQEKDYIINSL-GQQGTAHGWSVPV-WSMLF-SMPLWAIIIPQMCSNWSYYTLLTSLPIYMDTVLHFDLRQNSFLSALPYLAGWLFSVGSGVLADNLLEKEILSVTAVRKIFTFIGLFLPAAFLLAVGFSGCSGVLAVTFLTLSSAFGGFSAAGVFINQIDIAPRYAGMLLGITNTFGTIPGVLAPIV--------HSVSGWRNVFWLSAGVSAFGAIFYVIFGTGKIQSWARTDEESD 481          
BLAST of slc17a-6 vs. Ensembl Zebrafish
Match: slc17a6a (solute carrier family 17 member 6a [Source:NCBI gene;Acc:494492])

HSP 1 Score: 221.476 bits (563), Expect = 6.989e-64
Identity = 145/475 (30.53%), Postives = 236/475 (49.68%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+I A M  LG  I + +R N+ VAIV M N++            + K    I +E  +F W      MI  SF+WGY + QIP G +        ++G + L TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FYI   FG VW++ + L+ +  P++HP I++ E+  +  S+  +       ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D+++SK I++ T +RKI  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W NVF+  S V + G + + +F S   QPWA      ++   F + D L+    D
Sbjct:   70 RYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNST-----------IHKGGKIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGILVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERTYIEESIGESAKLLGAMEKYKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMVSALPHLVMTIIVPIGGQLADYLRSKNILTTTTVRKIMNCGGF-GMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKN-KTREEWQNVFLIASLVHYGGVIFYGIFASGEKQPWADPEETSDEKCGFIDEDELAEETGD 531          
BLAST of slc17a-6 vs. Ensembl Zebrafish
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 215.312 bits (547), Expect = 1.124e-61
Identity = 144/475 (30.32%), Postives = 231/475 (48.63%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+I A M  LG  I + +R N+ VAIV+M N++            +      I +E  +F W      +I  SF+WGY + QIP G +        ++G + L TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P+EHP I+  E+  +  S+  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D ++SK I+S T +RKI  C G  G    +  I+    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      ++   F + D L+    D
Sbjct:   69 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST-----------IHLNGKIIIKEKAKFNWDPETVGLIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARGHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGIFWYMFWILVSYESPAEHPTITAEERCYIEESIGESAKLLGPADKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQLADHLRSKNILSTTTVRKIMNCGGF-GMEATLLLIVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKH-KTREEWQYVFLIASLVHYGGVIFYGIFASGEKQPWADPELTSDEKCGFIDEDELAEETGD 530          
BLAST of slc17a-6 vs. Ensembl Zebrafish
Match: slc17a8 (solute carrier family 17 member 8 [Source:NCBI gene;Acc:563467])

HSP 1 Score: 212.231 bits (539), Expect = 1.935e-60
Identity = 148/481 (30.77%), Postives = 236/481 (49.06%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQP-NYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDS 1566
            R+I A +  LG  I + +R N+ VAIV M N+ TV+              N +   +  +F W      +I  SF+WGY + QIP G +        ++G +   TS+L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y+GW  +FYI  +FG +W+I + LL +N P+ HP ISE E+  +  S+          ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S++P++ +       G   DF++S+KI+S T +RKI  C G  G    +  ++       + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W +VF+  S V + G + + +F S   Q WA    D E     +  +    I EDE  D 
Sbjct:   75 RYIIAMLSGLGFCISFGIRCNLGVAIVEMVNNNTVYI-------------NGTAVMQPAQFNWDPETVGLIHGSFFWGYIVTQIPGGFISNKLAANRVFGAAIFLTSVLNMFIPSAARVHYGCVMFVRILQGLVEGVTYPACHGMWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYVGWPSVFYIYGVFGIIWYIFWILLAYNSPAVHPTISEEERNYIETSIGEGANLMSSTEKFKTPWREFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGILSAVPHMVMTIIVPIGGQLADFLRSRKILSTTTVRKIMNCGGF-GMEATLLLVVGFSHTRAVAISFLILAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKH-KTRLEWQHVFVIASMVHYTGVIFYAIFASGEKQDWA----DPEN----TSDEKCGIIGEDELADE 532          
BLAST of slc17a-6 vs. Ensembl Xenopus
Match: nbeal2 (neurobeachin like 2 [Source:Xenbase;Acc:XB-GENE-6038810])

HSP 1 Score: 243.432 bits (620), Expect = 6.897e-73
Identity = 166/469 (35.39%), Postives = 261/469 (55.65%), Query Frame = 1
Query:  112 KMKIYC--RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPE-CPVSKPNNSI-KRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQ 1503
            K+ + C  R+  A M  LG  ++Y LRVN+SVA+V M NST    +N T   CP      ++    TG+ + W    Q  IL SF++GY L QIP G +      K + G   L T++ T   PLAA+ G   ++ +R L G+ EG T+P+++A+   W    E S +++    G  +GT++   +SGLI  Y+ W ++FYI    G +WFI +C LV + P  H  I++ EK  ++ +L  NQ +Y   R  +P   + KS P +  ++   +YN+T+YTL+  LP Y+  +L FN  ENG +S+LPY+  + F + +G+  D ++ K  IS   +RKIF   GM G +I +    + GCN  L ++ + LS  + G +V+  G+N +DIAP++AG LL I N F ++ G++ P +    TH   T   W  VF   +++ FFGA+ F++F S  +Q WA+ +   E 
Sbjct:   32 KVPVCCSARYNLALMALLGFFMLYALRVNLSVALVDMVNSTSTPRENTTANICPDHTSAPAVLHNSTGQKYDWDANTQGWILGSFFYGYILTQIPGGYVAGKIGGKQLLGFGILGTAVFTLLTPLAADFGAGCLIAVRALEGLGEGVTFPAMHAMWARWAPPLERSRLLSLSYAGAQLGTVVSLPVSGLICYYMDWIYVFYIFGTLGVLWFIMWCFLVSDTPQSHRSITDSEKEYILYTL-QNQLSY---RKSVPCCAMMKSLPLWAIIVAHFSYNWTFYTLLTLLPTYMKEILRFNAQENGFLSALPYLGCWVFMIMAGVIADCLREKLNISTKVVRKIFNTLGMLGPAIFLLAAGYTGCNYSLAVVFLTLSTTLGGFSVAGYGINHLDIAPSFAGLLLGITNTFATIPGMVGPVIAKALTHD-NTVEQWQIVFYIAAAINFFGAIFFIIFASGNVQDWAVDHNTEED 495          
BLAST of slc17a-6 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 225.328 bits (573), Expect = 2.207e-65
Identity = 152/497 (30.58%), Postives = 244/497 (49.09%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDER-----------TDSKSQRN 1581
            R+I A M  LG  I + +R N+ VAIV+M N+ TV+K              N I  E  +F W      MI  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG +W++ + L+ +  P+ HP ISE EK  +  S+  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF+++K+I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      ++   F   D L+  +E++            T + SQ+N
Sbjct:   41 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK-------------GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGF-GMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKH-KTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAEPEETSDEKCGFIHEDELADESEEQSQAYGAYGSYGATQTTSQQN 522          
BLAST of slc17a-6 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 224.942 bits (572), Expect = 2.782e-65
Identity = 152/497 (30.58%), Postives = 244/497 (49.09%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDER-----------TDSKSQRN 1581
            R+I A M  LG  I + +R N+ VAIV+M N+ TV+K              N I  E  +F W      MI  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG +W++ + L+ +  P+ HP ISE EK  +  S+  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF+++K+I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      ++   F   D L+  +E++            T + SQ+N
Sbjct:   46 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK-------------GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGF-GMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKH-KTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAEPEETSDEKCGFIHEDELADESEEQSQAYGAYGSYGATQTTSQQN 527          
BLAST of slc17a-6 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 224.942 bits (572), Expect = 2.850e-65
Identity = 152/497 (30.58%), Postives = 244/497 (49.09%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDER-----------TDSKSQRN 1581
            R+I A M  LG  I + +R N+ VAIV+M N+ TV+K              N I  E  +F W      MI  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG +W++ + L+ +  P+ HP ISE EK  +  S+  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF+++K+I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      ++   F   D L+  +E++            T + SQ+N
Sbjct:   52 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK-------------GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGF-GMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKH-KTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAEPEETSDEKCGFIHEDELADESEEQSQAYGAYGSYGATQTTSQQN 533          
BLAST of slc17a-6 vs. Ensembl Xenopus
Match: hgf (hepatocyte growth factor (hepapoietin A; scatter factor) [Source:Xenbase;Acc:XB-GENE-999992])

HSP 1 Score: 224.942 bits (572), Expect = 4.550e-65
Identity = 152/497 (30.58%), Postives = 244/497 (49.09%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDER-----------TDSKSQRN 1581
            R+I A M  LG  I + +R N+ VAIV+M N+ TV+K              N I  E  +F W      MI  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG +W++ + L+ +  P+ HP ISE EK  +  S+  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF+++K+I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      ++   F   D L+  +E++            T + SQ+N
Sbjct:   62 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK-------------GNKIVIEQAQFTWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIMWYMFWILVSYESPAIHPTISEEEKKYIEESIGESTGLMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGF-GMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKH-KTREEWQYVFLIASLVHYGGVLFYGIFASGEKQPWAEPEETSDEKCGFIHEDELADESEEQSQAYGAYGSYGATQTTSQQN 543          
BLAST of slc17a-6 vs. Ensembl Mouse
Match: Slc17a5 (solute carrier family 17 (anion/sugar transporter), member 5 [Source:MGI Symbol;Acc:MGI:1924105])

HSP 1 Score: 239.58 bits (610), Expect = 1.550e-71
Identity = 157/457 (34.35%), Postives = 248/457 (54.27%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPV-SKPNNSIKRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILN 1488
             R+  A + F G  ++Y LRVN+SVA+V M +S T       + EC   S P       TG+ + W    Q  IL SF++GY + QIP G +      K + GL  L TS+ T F PLAA+ GV  +V+LR L G+ EG T+P+++A+   W    E S ++T    G  +GT++   LSG+I  Y+ W ++FY+  + G VWFI +  +V + P  H  IS +EK  +++SL +   + K     +PW  + KS P +  ++   +YN+++YTL+  LP Y+  +L FN+ ENG +S+LPY   +   +  G   D+++ K   S   +R+IF+  GM G ++ +    F+GC+  L +  + +S  + G   S   +N +DIAP+YAG LL I N F ++ G+  P +    T     R  W  VF   +++  FGA+ F LF    +Q WA+ +
Sbjct:   38 ARYNLAILAFCGFFVLYALRVNLSVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKV----VPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIR-EWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSD 489          
BLAST of slc17a-6 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 218.779 bits (556), Expect = 4.581e-63
Identity = 142/479 (29.65%), Postives = 234/479 (48.85%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTD 1563
            R+I A M  LG  I + +R N+ VAIV+M N++             +     +  +  +F W      +I  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P+ HP ISE E+  + +++  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF++S+ I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      E+   F   D L+  +E E  D
Sbjct:   62 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST------------THRGGHVVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGF-GMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKH-KTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMED 526          
BLAST of slc17a-6 vs. Ensembl Mouse
Match: Slc17a7 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [Source:MGI Symbol;Acc:MGI:1920211])

HSP 1 Score: 219.164 bits (557), Expect = 5.950e-63
Identity = 147/495 (29.70%), Postives = 240/495 (48.48%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANST----------------VFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTD 1563
            R+I A M  LG  I + +R N+ VAIV+M N++                V K +  TP     +  ++   E  +F W      +I  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P+ HP ISE E+  + +++  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF++S+ I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G + + +F S   QPWA      E+   F   D L+  +E E  D
Sbjct:   62 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQTPYRSVHKQEAVTPTLGDIQGGDT---EKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGF-GMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKH-KTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMED 551          
BLAST of slc17a-6 vs. Ensembl Mouse
Match: Slc17a6 (solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [Source:MGI Symbol;Acc:MGI:2156052])

HSP 1 Score: 217.624 bits (553), Expect = 1.646e-62
Identity = 147/487 (30.18%), Postives = 237/487 (48.67%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMAN-STVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNI 1584
            R+I A M  LG  I + +R N+ VAIV M N ST+ +                + +E  +F W      MI  SF+WGY + QIP G +        ++G + L TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG VW++ + L+ +  P++HP I++ E+  +  S+  +       ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S++P++ +       G   DF++SK+I+S T +RKI  C G  G    +  ++       + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + ++R  W  VF+  + V + G + + LF S   QPWA      E+   F   D L     DE T   +Q  I
Sbjct:   70 RYIIAIMSGLGFCISFGIRCNLGVAIVDMVNNSTIHR-------------GGKVIKEKAKFNWDPETVGMIHGSFFWGYIITQIPGGYIASRLAANRVFGAAILLTSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGSFGMVWYMFWLLVSYESPAKHPTITDEERRYIEESIGESANLLGAMEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSAVPHLVMTIIVPIGGQIADFLRSKQILSTTTVRKIMNCGGF-GMEATLLLVVGYSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKN-KSREEWQYVFLIAALVHYGGVIFYALFASGEKQPWADPEETSEEKCGFIHEDEL-----DEETGDITQNYI 536          
BLAST of slc17a-6 vs. Ensembl Mouse
Match: Slc17a5 (solute carrier family 17 (anion/sugar transporter), member 5 [Source:MGI Symbol;Acc:MGI:1924105])

HSP 1 Score: 209.534 bits (532), Expect = 1.647e-60
Identity = 146/455 (32.09%), Postives = 235/455 (51.65%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILN 1488
             R+  A + F G  ++Y LRVN+SVA+V M +S T       + EC  ++ +  IK                            IP G +      K + GL  L TS+ T F PLAA+ GV  +V+LR L G+ EG T+P+++A+   W    E S ++T    G  +GT++   LSG+I  Y+ W ++FY+  + G VWFI +  +V + P  H  IS +EK  +++SL +   + K     +PW  + KS P +  ++   +YN+++YTL+  LP Y+  +L FN+ ENG +S+LPY   +   +  G   D+++ K   S   +R+IF+  GM G ++ +    F+GC+  L +  + +S  + G   S   +N +DIAP+YAG LL I N F ++ G+  P +    T     R  W  VF   +++  FGA+ F LF    +Q WA+ +
Sbjct:   38 ARYNLAILAFCGFFVLYALRVNLSVALVDMVDSNTTLTDNRTSKEC--AEHSAPIKVHHNH----------------------TIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKV----VPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIR-EWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSD 463          
BLAST of slc17a-6 vs. UniProt/SwissProt
Match: sp|Q9MZD1|S17A5_SHEEP (Sialin OS=Ovis aries OX=9940 GN=SLC17A5 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.257e-73
Identity = 160/457 (35.01%), Postives = 251/457 (54.92%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTP-ECPV-SKPNNSIKRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILN 1488
             R+  A++ F G  ++Y LRVN+SVA+V M +S      N T  EC   S P   +  +TG+ + W    Q  IL SF++GY + QIP G +      K + G     T+I T F PLAA+ GV A+V LR L G+ EG TYP+++A+   W    E S +++    G  +GT++   LSG+I  Y+ W ++FY   + G +WFI +  LV + P  H  I+ +EK  +++SL +   + K     +PW  + KS P +  ++   +YN+T+YTL+  LP Y+  VL FNI ENG +S++PY+  +   + SG   D ++++   S   +R++F+  GM G +I +    F+GC+  L +  + +S  + G   S   +N +DIAP+YAG LL I N F ++ G+I P +    T    T   W  VF   +++  FGA+ F LF    +Q WAI +
Sbjct:   38 ARYNLAFLSFFGFFVLYSLRVNLSVALVDMVDSNTTAKDNRTSYECAEHSAPIKVLHNQTGKKYRWDAETQGWILGSFFYGYIITQIPGGYVASRSGGKLLLGFGIFATAIFTLFTPLAADFGVGALVALRALEGLGEGVTYPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVVSLPLSGVICYYMNWTYVFYFFGIVGIIWFILWICLVSDTPETHKTITPYEKEYILSSLKNQLSSQKS----VPWIPMLKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEVLRFNIQENGFLSAVPYLGCWLCMILSGQAADNLRARWNFSTLWVRRVFSLIGMIGPAIFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMIGPIIARSLTPE-NTIGEWQTVFCIAAAINVFGAIFFTLFAKGEVQNWAISD 489          
BLAST of slc17a-6 vs. UniProt/SwissProt
Match: sp|Q9NRA2|S17A5_HUMAN (Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=2)

HSP 1 Score: 246.514 bits (628), Expect = 3.125e-73
Identity = 157/455 (34.51%), Postives = 250/455 (54.95%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPV-SKPNNSIKRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAI 1482
             R+  A + F G  IVY LRVN+SVA+V M +S T  +    +  CP  S P      +TG+ + W    Q  IL SF++GY + QIP G +      K + G   L T++LT F P+AA+ GV  +++LR L G+ EG T+P+++A+   W    E S +++    G  +GT++   LSG+I  Y+ W ++FY     G  WF+ +  LV + P +H  IS +EK  +++SL +   + K     +PW  + KS P +  ++   +YN+T+YTL+  LP Y+  +L FN+ ENG +SSLPY+  +   + SG   D +++K   S   +R+IF+  GM G ++ +    F+GC+  L +  + +S  + G   S   +N +DIAP+YAG LL I N F ++ G++ P +    T    T   W  VF   +++  FGA+ F LF    +Q WA+
Sbjct:   38 ARYNLAILAFFGFFIVYALRVNLSVALVDMVDSNTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLGFGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGTVISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKS----VPWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAADNLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPSYAGILLGITNTFATIPGMVGPVIAKSLT-PDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWAL 487          
BLAST of slc17a-6 vs. UniProt/SwissProt
Match: sp|Q8BN82|S17A5_MOUSE (Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV=2)

HSP 1 Score: 239.58 bits (610), Expect = 1.084e-70
Identity = 157/457 (34.35%), Postives = 248/457 (54.27%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPV-SKPNNSIKRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILN 1488
             R+  A + F G  ++Y LRVN+SVA+V M +S T       + EC   S P       TG+ + W    Q  IL SF++GY + QIP G +      K + GL  L TS+ T F PLAA+ GV  +V+LR L G+ EG T+P+++A+   W    E S ++T    G  +GT++   LSG+I  Y+ W ++FY+  + G VWFI +  +V + P  H  IS +EK  +++SL +   + K     +PW  + KS P +  ++   +YN+++YTL+  LP Y+  +L FN+ ENG +S+LPY   +   +  G   D+++ K   S   +R+IF+  GM G ++ +    F+GC+  L +  + +S  + G   S   +N +DIAP+YAG LL I N F ++ G+  P +    T     R  W  VF   +++  FGA+ F LF    +Q WA+ +
Sbjct:   38 ARYNLAILAFCGFFVLYALRVNLSVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYIVTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKV----VPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKSLTPDNTIR-EWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSD 489          
BLAST of slc17a-6 vs. UniProt/SwissProt
Match: sp|Q9V7S5|PICO_DROME (Putative inorganic phosphate cotransporter OS=Drosophila melanogaster OX=7227 GN=Picot PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 4.537e-66
Identity = 156/468 (33.33%), Postives = 237/468 (50.64%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFK---PKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSG-VYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTH--SGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQ 1503
             R+   +M FLG+   Y++R N+SVAIVAM N T  K    + +  EC   +       + GEF W  A Q  ILSSF++GY + QIP GIL   +      G   L  S+  F +P+AA  G V+ +  +RF+ G+ EGP  P  +A+   W+   E S +   +  G   GTI+   LSGL+ EY    GW  +FY+  + G VW I + + V   PS HP I E EK  + +SL        P   P+P+K + KS PF+  L     +N+ + TL+  LP Y+  VL F++  NG +SSLPY+A++ FS+   +  D++ S K  S+T  RK+    G  G  + +    + GC+  LT+ ++ + V + G   S   +N +D+ P +AG L++I N   +L G++AP   G+     S      W  VF   + V       + +FGS   Q W     D ++
Sbjct:   39 TRYFVTFMLFLGMANAYVMRTNMSVAIVAMVNHTAIKSGEAEEYDDECG-DRDIPIDDSQDGEFAWSSALQGYILSSFFYGYVITQIPFGILAKKYGSLRFLGYGMLINSVFAFLVPVAARGGGVWGLCAVRFIQGLGEGPIVPCTHAMLAKWIPPNERSRMGAAVYAGAQFGTIISMPLSGLLAEYGFDGGWPSIFYVFGIVGTVWSIAFLIFVHEDPSSHPTIDEREKKYINDSLWGTDVVKSP---PIPFKAIIKSLPFYAILFAHMGHNYGYETLMTELPTYMKQVLRFSLKSNGLLSSLPYLAMWLFSMFISVVADWMISSKRFSHTATRKLINSIGQYGPGVALIAASYTGCDRALTLAILTIGVGLNGGIYSGFKINHLDLTPRFAGFLMSITNCSANLAGLLAPIAAGHLISDPSKPMMGQWQIVFFIAAFVYIICGTFYNIFGSGERQYWDNPEDDEQK 502          
BLAST of slc17a-6 vs. UniProt/SwissProt
Match: sp|Q6INC8|VGLU1_XENLA (Vesicular glutamate transporter 1 OS=Xenopus laevis OX=8355 GN=slc17a7 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.361e-64
Identity = 151/497 (30.38%), Postives = 244/497 (49.09%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDER-----------TDSKSQRN 1581
            R+I A M  LG  I + +R N+ VAIV+M N+ TV+K              N +  E  +F W      MI  SF+WGY + QIP G +   F    ++G + + TS L   IP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P++HP ISE E+  +  S+  +     P  +   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   DF+++K+I+S T +RK+  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T   +TR  W  VF+  S V + G V + +F S   QPWA      ++   F   D L+  +E++            T + SQ+N
Sbjct:   62 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNNTVYK-------------GNKLVIEQAQFNWDPETVGMIHGSFFWGYIVTQIPGGYICQKFAANRVFGFAIVATSTLNMLIPSAARVHFACVICVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGITWYMFWILVSYESPAQHPTISEEERKYIEESIGESTGFMNPMAKFKAPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFAISKVGLLSALPHLVMTIIVPIGGQIADFLRTKRIMSTTNVRKMMNCGGF-GMEATLLLVVGYSHSRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKH-KTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWAEPEETSDEKCGFIHEDELADESEEQTQAHGGYGSYGATQTTSQQN 543          
BLAST of slc17a-6 vs. TrEMBL
Match: A0A0H3YJ71 (Slc17a-6 OS=Schmidtea mediterranea OX=79327 GN=slc17a-6 PE=2 SV=1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 491/491 (100.00%), Postives = 491/491 (100.00%), Query Frame = 1
Query:  115 MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ 1587
            MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ
Sbjct:    1 MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ 491          
BLAST of slc17a-6 vs. TrEMBL
Match: A0A0H3YFB4 (Slc17a-9 OS=Schmidtea mediterranea OX=79327 GN=slc17a-9 PE=2 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 320/478 (66.95%), Postives = 379/478 (79.29%), Query Frame = 1
Query:  115 MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINE 1548
            M+ Y RF+FA MGF GL IVYMLRVN+SV I+AM NST FKPKN+T ECP    NN+ K+ TGEF+W   DQTMILSSFYWGY + QIPS ILL++FKPKWIYGLST+ T I T  IP  A  GVY MV LRF+ G+CEGPTY SL ALCG WVL AESS VVT I  GG IGTI GQSL+GLII+ +GWRW FYI A  GCVWF+ YC +V+NRP EHPFIS+ EK +LI+SLPHNQPN++ KRVP+PWK V  S  F GFLI+ + YNFTWYTLINCLP+YIG+VLGFNIS+NGGISSLPY+ALF  ++S+G+ QDFIKSKKI+SNT LRK FAC GM  +SIIM+C+I+  CNIPL I LVCLSVA+MG    VT VN+ID+APAYAG L+ +CNLFNS+CGI+APYVK YYT +GETR NW NVFITN++++FFGA+ F LFGS  LQ WAIL+ +LE LV   + +S   IN+
Sbjct:    1 MRCYWRFVFALMGFFGLFIVYMLRVNLSVGIIAMVNSTYFKPKNYTAECPTLLQNNTDKKTTGEFMWDVNDQTMILSSFYWGYAITQIPSVILLIYFKPKWIYGLSTVATPIFTLIIPAIAQLGVYPMVALRFVTGLCEGPTYASLIALCGYWVLEAESSGVVTFICVGGLIGTITGQSLTGLIIDNMGWRWSFYIQATVGCVWFVIYCFVVYNRPVEHPFISDQEKNLLISSLPHNQPNFRHKRVPVPWKRVLTSSSFLGFLIMVSAYNFTWYTLINCLPMYIGSVLGFNISQNGGISSLPYVALFICNLSAGVLQDFIKSKKILSNTNLRKTFACSGMILSSIIMYCMIYTECNIPLAISLVCLSVALMGFAGPVTSVNVIDMAPAYAGQLIGVCNLFNSVCGIVAPYVKSYYTQTGETRKNWENVFITNAAILFFGALTFALFGSGKLQTWAILDPELENLVSCKKVESEGVIND 478          
BLAST of slc17a-6 vs. TrEMBL
Match: R7URJ7 (MFS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183805 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 2.320e-84
Identity = 170/456 (37.28%), Postives = 262/456 (57.46%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNS--IKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            CR+  A+M FLG + VY LRVN+SVA+V+M NS+     NF+ ECP  + + +      TG F W    Q ++L +F++GY   Q+P G L      K +YGL  L TS LT   P+AA++ VY  ++LR   G+ EG T+P++ A+   W    E S + T +  G  +GT++   +SG++ +Y    GW  +FY+    GC+WF+ + LL ++ P++HP IS  E+  + N++      YK K  P PW  +F S P +  ++     N+ +YTL+ CLP Y+  VL F+IS+NG +S +PY  ++   VS G   D ++S+KI+S T++RKIF   G+   +I +    ++GCN    +  V ++V   GI +S  GVN +D+AP +AG LL I N   ++ G + P V G  TH   +R  W  VF  +S+V  FG +V+L+FGS   Q W+
Sbjct:   28 CRWTLAFMAFLGFVNVYCLRVNLSVAMVSMVNSSYQAKVNFSDECPGEENSTTPASNEPTGTFNWDSNMQGLVLGAFFYGYITTQLPGGWLAERIGGKLLYGLGILCTSALTLLTPIAADTNVYLFIVLRVFEGIGEGVTFPAMNAILAQWAPPLERSKISTFVFAGAQLGTVVSSPVSGILCKYGFAGGWPSVFYVFGTLGCIWFVFWMLLCYDSPAKHPRISPQERAFIENAIGATT-KYK-KGYPTPWAKIFTSVPVWAIIVAHFCNNWGYYTLLTCLPTYMMQVLHFDISQNGVLSGMPYFFMWLLMVSGGQIADCLRSRKILSTTRVRKIFTTVGLGLPAIFLVVAGYLGCNTVAAVATVAMAVGFAGIAMSGWGVNHLDLAPPFAGTLLGITNAAATIPGFVGPQVVGALTHDDPSRQQWRKVFFISSAVYCFGLIVYLIFGSGERQYWS 481          
BLAST of slc17a-6 vs. TrEMBL
Match: A0A3P8Y7E8 (Solute carrier family 17 member 5 OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 1.084e-82
Identity = 161/455 (35.38%), Postives = 251/455 (55.16%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPV--SKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILN 1488
            R+  +++   G  + Y LRVN+SVA+V M N+T       T  CP   + P  +       + W    Q  IL SF++GY L QIP G L   +  KW+ GL  L T + T   P+AA+ G   ++ +R L G+ EG T+P+++A+   W    E S ++T   TG  +GT++   LSG I  YL W W+FYI  + G VWFI +  LV N PS HP ISE E++ ++++L      + P    +PW  +  S P +  ++   +YN+T+YTL+  LP Y+  VLGF+I ENG +S+LPYI     +V  G   D+++ K+      +RK+F+  GM G ++ +  +   GCN  L +  + +S ++ G+  S   +N +DIAP+YAG LL I N F ++ G++ P +    T +  T   W +VF  ++ +  FGA  + +FG   +QPWA+ N
Sbjct:   36 RYALSFLSCYGFFVAYALRVNLSVAMVDMLNNTGVSGNTSTSVCPAHFNPPRPTHNHTASVYDWDSETQGWILGSFFYGYILTQIPGGYLARKYGAKWLLGLGILGTVVFTLLTPVAADLGAGYLIAVRVLEGIGEGVTFPAMHAMWASWAPPLERSRLLTIAYTGAQLGTVVALPLSGQICFYLDWTWVFYIFGIVGIVWFILWAFLVSNTPSTHPRISEQERLYILSTL---NKEHSPLGNHIPWASILTSLPLWAIVVAHFSYNWTFYTLLTLLPTYMSNVLGFSIKENGALSALPYIGCGLLAVLGGQLADYLREKRFYRTVVVRKVFSLIGMIGPAVFIVAVGHTGCNYILAVAFLTISSSLGGMVASGFNINHLDIAPSYAGILLGITNSFATIPGMVGPVIARALTKN-NTIEEWQSVFYISAGINLFGAAFYTVFGRGVVQPWAVHN 486          
BLAST of slc17a-6 vs. TrEMBL
Match: A0A3Q3ERG4 (Solute carrier family 17 member 5 OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 3.539e-82
Identity = 165/458 (36.03%), Postives = 251/458 (54.80%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFT-PECPV-SKPNNSIKRETGE-FLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCD 1494
            R+  A +  LG  +VY LRVN+SVA+V M N+T     N +   CP  + P       T   + W    Q  IL SF++GY L QIP G L     PKW+ G   L T++ T   P+AA+ G   ++ LR L GV EG T+P++Y +   W    E S ++T    G  +GT++   LSG I  YL W ++FY+    G VWF+ +  LVF+ P+ HP ISE EK  +  SL +        +  +PWK +  SRP +  ++   +YN+T+YTL+  LP Y+  +LGF+I +NG +S+LPY+    F+V SG   D+++   +     +RK F   GM G ++ +  + + GCN  L +  + LS A+ G++ S   +N +DIAP+YAG LL I N F ++ G++ P +    T    T   W  VF   +++   GA V+ +FG  T+QPWA+ + +
Sbjct:   36 RYCLALLSSLGFFVVYSLRVNLSVAMVDMLNTTHQSSTNHSFSVCPAHASPTRPKHNHTARVYDWDSETQGWILGSFFYGYILTQIPGGYLAGRLGPKWLMGFGILGTAVFTLLTPVAADLGAGYLIALRVLEGVGEGVTFPAMYTMWAAWAPPLERSRLLTISYIGAQLGTVIALPLSGEICFYLDWTYVFYVFGAIGVVWFVFWAFLVFDTPNTHPRISEREKNYITASLKNE---LSTSQGVIPWKAIVTSRPLWAIVVAHFSYNWTFYTLLTLLPTYMNDILGFSIQQNGILSALPYMGCAVFAVLSGQLADYLRETLLYRTVVVRKSFTLVGMIGPALFLVAVGYTGCNYTLAVTFLTLSSALGGVSASGFNINHLDIAPSYAGILLGITNTFATIPGMVGPVIARALTKH-NTIEEWQAVFYIAAAINLLGASVYTVFGRGTVQPWAVHSSN 489          
BLAST of slc17a-6 vs. Ensembl Cavefish
Match: si:ch1073-513e17.1 (sialin-like [Source:NCBI gene;Acc:103042153])

HSP 1 Score: 240.35 bits (612), Expect = 8.436e-72
Identity = 164/465 (35.27%), Postives = 248/465 (53.33%), Query Frame = 1
Query:  127 CRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPK---NFTPECP--VSKPNNSIKRETG--EFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLE 1500
             R   A M F G  +VY LRVN+SVA+VAM N T  +P    + T ECP  ++  + S  +  G   + W    Q M+L +F++GY   QIP G L   F  +   G   L T+ILT   PLAA  G   +  LR L G  EG TYP++ A+  CW    E + +++    GG  G  +   L+G I   LGW  +FY     GC+W I + +LV + P +HP IS+ EK  ++N++     ++      LP   +  S P +  +I     N+++YTL+  LP Y+ TVL F++ +N  +S+LPY+  + FSV SG+  D +  ++++  T +RKIF   GM   +  +  + F GC+  L +  + LS  + G + +   +N IDIAP YAG LL I N F ++ G++AP V G       +   W+NVF  ++ V   GA++F +FGS  LQ WA+   + E
Sbjct:   41 ARCNLAIMMFFGFAVVYGLRVNLSVAMVAMVNGTNSQPSLNGSETHECPGALNSSSQSPDQLDGVPRYNWDSQMQGMLLGAFFFGYLFTQIPGGYLSGHFGGRIFLGGGVLCTAILTLLTPLAAELGARWLFALRALEGFGEGVTYPAMMAMWACWAPPLERARLMSLSGAGGNFGAFVSFPLTGFICHSLGWPAVFYWCGGAGCLWAILWFILVSDDPRKHPRISDQEKEYIVNTIGSEGGSHGWSVPLLP---MLLSVPLWAIIITQMCSNWSYYTLLTSLPTYMDTVLHFDLRQNSFLSALPYLGGWLFSVLSGVIADNLLERELMGVTAIRKIFTVVGMVVPAGFLVAVAFSGCSGGLAVTFLTLSSTIGGASSAGVYMNQIDIAPRYAGVLLGITNTFGTIPGVLAPIVVGQLAKD-HSLTGWSNVFYVSAGVSVVGAIIFTVFGSGKLQNWAVSEDERE 501          
BLAST of slc17a-6 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 224.172 bits (570), Expect = 3.177e-65
Identity = 145/475 (30.53%), Postives = 237/475 (49.89%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+I A M  LG  I + +R N+ VAIV+M N++            + +    I +E  +F W      MI  SF+WGY + QIP G +        ++G + + TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG VW++ + L+ +  P+EHP I++ E+  +  S+  +     P ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D+++SK ++S T +RKI  C G  G    +  I+    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W  VF+  S V + G + + +F S   QPWA      E+   F + D L+    D
Sbjct:   48 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST-----------IHENGKIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGF-GMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKN-KTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWADPELTSEEKCGFIDEDELAEETGD 509          
BLAST of slc17a-6 vs. Ensembl Cavefish
Match: slc17a6b (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:103031917])

HSP 1 Score: 224.172 bits (570), Expect = 6.561e-65
Identity = 145/475 (30.53%), Postives = 237/475 (49.89%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+I A M  LG  I + +R N+ VAIV+M N++            + +    I +E  +F W      MI  SF+WGY + QIP G +        ++G + + TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG VW++ + L+ +  P+EHP I++ E+  +  S+  +     P ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D+++SK ++S T +RKI  C G  G    +  I+    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W  VF+  S V + G + + +F S   QPWA      E+   F + D L+    D
Sbjct:   70 RYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNST-----------IHENGKIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVIAMPLAGILVQYTGWSSVFYVYGCFGLVWYMFWILVSYESPAEHPTITDEERCYIEESIGESAKLLGPAEKFKTPWRQFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGMLSALPHLVMTIIVPIGGQIADYLRSKNLMSTTNVRKIMNCGGF-GMEATLLLIVGYSHSKGMAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGTMTKN-KTREEWQYVFLIASMVHYGGVIFYGIFASGEKQPWADPELTSEEKCGFIDEDELAEETGD 531          
BLAST of slc17a-6 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 221.476 bits (563), Expect = 5.339e-64
Identity = 145/475 (30.53%), Postives = 234/475 (49.26%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNY-KPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+  A M  LG  I + +R N+ VAIV M N++            + K    I +E  +F W      MI  SF+WGY + QIP G +        ++G + L TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FYI   FG VW++ + L+ +  P++HP I++ E++ +  S+          ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D+++S  I+S T +RKI  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W NVF+  S V + G V + +F S   QPWA      ++   F + D L+    D
Sbjct:   70 RYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNST-----------IHKDGKIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGF-GMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKN-KTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWADPEETSDEKCGFIDEDELAEETGD 531          
BLAST of slc17a-6 vs. Ensembl Cavefish
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:103044031])

HSP 1 Score: 221.476 bits (563), Expect = 5.339e-64
Identity = 145/475 (30.53%), Postives = 234/475 (49.26%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNY-KPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+  A M  LG  I + +R N+ VAIV M N++            + K    I +E  +F W      MI  SF+WGY + QIP G +        ++G + L TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FYI   FG VW++ + L+ +  P++HP I++ E++ +  S+          ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D+++S  I+S T +RKI  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W NVF+  S V + G V + +F S   QPWA      ++   F + D L+    D
Sbjct:   70 RYTIAIMSGLGFCISFGIRCNLGVAIVDMVNNST-----------IHKDGKIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAILLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTSFCGSYAGAVVAMPLAGVLVQYSGWSSVFYIYGSFGIVWYMFWILVSYESPADHPTITDEERLYIEESIGEGANLLGATEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGAVSALPHLVMTIIVPIGGQLADYLRSNNILSTTTVRKIMNCGGF-GMEATLLLVVGFSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKN-KTREEWQNVFLIASLVHYGGVVFYGIFASGEKQPWADPEETSDEKCGFIDEDELAEETGD 531          
BLAST of slc17a-6 vs. Ensembl Sea Lamprey
Match: slc17a6b (solute carrier family 17 member 6b [Source:NCBI gene;Acc:100149756])

HSP 1 Score: 178.333 bits (451), Expect = 4.499e-49
Identity = 141/492 (28.66%), Postives = 225/492 (45.73%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFY---------W-GYTLVQIPSGILLLF----FKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNY-KPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFAC--FGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDE 1554
            R++ A M  LG  I + +R N+ VA+V M N++ +               + +  + G   W   D  M L   Y         W G+ +V+  S    L       P W+                    +   A +    L  V +G TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W+I +  + +  P++HP IS+ EK  +  S+  +       ++   PWK  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G IS+LP++ +       G   DF +SKKI+S T +RK+  C  FGM  A++++      G  I +T ++  L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T  G+TR  W NVF+  + V + G + + LF S   QPWA    D E+    +  +    INEDE
Sbjct:   30 RYVIAVMSGLGFCISFGIRCNLGVAVVDMVNNSSYHS------------GDKLIVQKGSLGW-SMDLAMQLHELYNFFLFFLATWQGHIVVKSMSREERLHQCSTLPPHWL------------PVHVEERRAVPCACLTSLSLSSVEQGVTYPACHGIWAKWAPPLERSRLATTAFCGSYAGAVVAMPLAGILVQYAGWSSVFYVYGSFGLFWYIFWLCIAYESPAKHPTISDEEKTYIEESIGESYGILGSTQKFKTPWKKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGIISALPHLVMTIVVPIGGQLADFFRSKKIMSTTTVRKMMNCGGFGME-ATLLLVVGFSHGKGIAITFLV--LAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMT-KGKTREEWQNVFLIAALVHYGGVIFYGLFASGEKQPWA----DPEE----TSDEKCGFINEDE 484          
BLAST of slc17a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010352.1 (pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene:ENSPMAG00000009375.1 transcript:ENSPMAT00000010352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.703 bits (426), Expect = 2.023e-48
Identity = 91/256 (35.55%), Postives = 144/256 (56.25%), Query Frame = 1
Query:  715 GCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSL-PHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWA 1479
            G +W I + L  F+ P  HP IS  E+  ++ SL    Q N+      +PW+HV+   P +   +      + +Y L+  LP Y+ TVL + + +NG +S+LPY+A + F+V+ G+  D ++ + ++S T +RK+    G+   S+ +    F+GCN  L +  + LSVA    T +  G+N +DIAP YAG LL I N FN+L G +AP + GY T   +T   W  VF  ++++  FGA+ +L+FGS   Q WA
Sbjct:    4 GLLWSIVWFLFAFDSPERHPRISAEEREFILKSLQAERQANHG---TSIPWRHVWTCMPLWAINVAMFCSGWGFYVLLTSLPTYMSTVLHYEMQQNGLLSALPYLAGWVFTVAGGMAADALRIRGLLSITAIRKVATTLGLAVPSLCLVASGFVGCNHLLAVSFLTLSVAFGAFTTAGCGINQLDIAPQYAGVLLGISNTFNNLPGFLAPTLTGYLTEH-DTLKEWHMVFFISAAINMFGALFYLVFGSGKQQSWA 255          
BLAST of slc17a-6 vs. Ensembl Nematostella
Match: EDO45514 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSS9])

HSP 1 Score: 224.172 bits (570), Expect = 2.390e-66
Identity = 155/464 (33.41%), Postives = 247/464 (53.23%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFK-PKNFTPECPV-SKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFG-MTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQ 1503
            R+  A +  LG  +VY LRVN+SVA+VAM NST      N   ECP  + P+ + K   G+F W +  Q +IL SF++GY   Q+P G L   F  K ++G   L TSI T   P AA+ G+  ++ LR L G+ EG T+P+++A+   W    E S ++T    G  +G I+   L+G++       GW  +FYI    G +WF+ + L+V  +P++HP ISE E+  +I+S+  +Q + K  +   PW  ++ S   +  +I     N+ +YT +  LP Y   VL F+I  NG +S++PY   + F V +G   D++  ++I S + +RK+F     +  A +++           L++ L   ++   G  +S   VN +DIAP YAG L+ I N F ++ GI APYV G+ T+    R +W  VF  ++ +   GA+ F+     + + W I   D+ Q
Sbjct:   25 RYTLALLACLGFCVVYGLRVNLSVALVAMVNSTYDGIDGNTNSECPGGNTPDTTYKN--GDFNWDQKTQGLILGSFFYGYICTQLPGGWLASQFGGKHLFGFGVLCTSIFTLLTPWAAHQGIPMLIALRILEGLGEGVTFPAMHAIWSSWAPPLERSKLLTLSYAGCQLGNIIFMPLAGVLCASEIAGGWPSVFYIFGSLGILWFVVWTLMVTEKPADHPTISEAERDYIISSIGTSQ-DRKTTKQNTPWSAIWSSPAVWAIIIAHFCNNWGFYTFLTLLPSYFKEVLNFSILTNGFLSAVPYSTQWLFIVIAGQIADWLLRRRISSVSDVRKVFCVTAFIIPACLLVATSYTGCTTTTLSVCLFSTALGFTGFNLSGFNVNHLDIAPRYAGILMGITNSFGTVPGIAAPYVAGWITNKKPDRAHWQIVFFISAGLYVIGAISFVTLSKGSERRWNIPEKDMIQ 485          
BLAST of slc17a-6 vs. Ensembl Nematostella
Match: EDO46366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH0])

HSP 1 Score: 218.394 bits (555), Expect = 3.793e-64
Identity = 166/502 (33.07%), Postives = 254/502 (50.60%), Query Frame = 1
Query:  109 TKMKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLI-IEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTG--VNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPW------AILNCDL--EQLVIFSESDSLSSINEDERTDSKSQRN 1581
            +K  + CR+I A +G  GL + + LRVN+SVA+VAM NST                  + + +   F W +  + +IL SF++GY ++ IP G L      K   GL  L +S+L+   PLAA      +++LR L G+ +G  YPS+  L  CW    E S ++    TG   G I+G  +SGL+      W  +FY+    G VW++ +C LV++ PS HP IS  EK  ++ ++  +Q     K+ P PW+ +  SR      I     N+ + T +  LP Y   VL FNI+ NG +S+LPY   +F S+ +G   D++    II+ T++RKIF     T AS IM  + F   N P+ + +  L V  M  T+   G  ++ ++ AP Y G L AI N   +  GI AP+V GY T+   TR+ W  V+   + +  FGAV F   G+S  QPW       ++  DL  E+LV     +++S + +     S  + +
Sbjct:    4 SKCILPCRYILAVLGCFGLTVTFSLRVNLSVALVAMVNST-----------------QTGQPKEDYFSWDQQTRGIILGSFFYGYIVMLIPGGWLAERNGGKHFVGLGVLISSVLSLLTPLAARYSYKMLIVLRILEGLAQGVIYPSVNVLLSCWAPPEERSKMLVITWTGCQAGNIIGLVVSGLLCASRFQWPSVFYLFGASGIVWYLFWCFLVYDSPSVHPRISLEEKEYIVTAIGASQDKVV-KKHPTPWRQILTSRAVLAISISFFCSNWGFCTFLTSLPTYFQEVLHFNITTNGLLSALPYFCQYFTSLPAGFLADWLIHSHIITVTEVRKIF-----TLASCIMVALGFT--NQPV-VAVTLLCVLFMFQTIDTCGHWISPMEFAPRYCGLLFAIANSIGTSTGIAAPFVVGYLTNGQPTRDQWQKVYYIGAGIYVFGAVAFAALGTSKEQPWNTPPEENLVPVDLPHEKLVSQGSRETMSLLRKPHGYKSLQETS 479          
BLAST of slc17a-6 vs. Ensembl Nematostella
Match: EDO48671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIA9])

HSP 1 Score: 204.142 bits (518), Expect = 3.870e-59
Identity = 158/462 (34.20%), Postives = 243/462 (52.60%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRET----GEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYL---GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQD-FIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIP-LTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILN 1488
            R+I A M FLG+ + Y LRVN+SVAI AM N        FT +  +     +++R       EF W    Q  IL +FY+GY  +Q+P G L   F    ++G+     S+LT   PLAA + V A++ LR + G+  G  +P  +A+   W   +E + + T  + G  +GTIL   LSGL+ +Y    GW  +FY     G +WF  + L +   PSEHP ISE EK+ +  ++  +QP  K   + +PWK +  S P +  +I   T ++  YT++ CLP Y   VL F++++ G +++LPY+   F   + G+  D  IK+K  + NT+ R +F   G T ASI +    +   N P L + L+ + V + GI  +   VN++DIAP YAG ++ + N+F +  G I+P + G  T + +T   W  VF     V   G V+F L  S   Q WA+ +
Sbjct:    1 RYIVAIMVFLGICVQYALRVNLSVAIGAMCNPHTVTENGFTIKKVLVVYCVTVRRHQKVLPAEFDWSSKLQGTILGAFYYGYMTMQLPGGWLGQRFGGTRVFGICLGIASVLTMLTPLAARTSVVALITLRVIEGLTLGALFPCNHAIWSKWAPPSERTRLFTITVAGCPVGTILSMPLSGLMSKYGFDGGWASVFYCFGAVGLLWFFVWQLSIHATPSEHPTISEEEKVYIETAI-ADQPGVK---LSIPWKSILTSGPVWAIIIANFTADWGMYTILICLPKYFIEVLKFDLAKTGFLAALPYVLKAFVGPTGGVIVDWLIKNKLSVKNTR-RCVFTV-GCTVASIFVLATGY--ANQPYLAVGLLTIGVGITGINAAGYAVNILDIAPKYAGVIMGVTNVFGAAPGFISPQIVGIITPN-KTAKEWRVVFWITFIVYIVGIVLFGLLVSGDKQKWAMDD 453          
BLAST of slc17a-6 vs. Ensembl Nematostella
Match: EDO34186 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ43])

HSP 1 Score: 192.586 bits (488), Expect = 5.179e-55
Identity = 129/442 (29.19%), Postives = 220/442 (49.77%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKN----FTPECPVSKPNNSIK-----RETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLI--IEYL--GWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQP---------------NYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIP-LTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHS 1368
            R +   M F G + VY +R N+SVA+VAM N T     +    + PEC +   N+++      R  G F W +  Q ++L +F++GY + Q+P G L   +  K ++GL    T+I T   P+AA + V  +V +R + G  EG TYP+   L   W   AE S  +    TGG  G I     SG +  ++++  GW   FY+    G +WF+ +  ++   P+EHP I+  E+  +   +  +Q                N+    VP+PW  +  S P +   + G  Y++ WY  +  LP +   VL F+I +NG +++LP+IA      +SG   D ++    IS + +RK         A+ ++  + F+ C+   ++++L+ LS   +G+       N +D++P +AG  +AI N F+++ GI+ P V G  T++
Sbjct:    1 RNVLVLMQFAGFVTVYGMRANLSVALVAMVNQTYANSASGTRVYVPECRLDGGNHTVDHTLEVRNDGPFKWDQDTQGLVLGAFFYGYLVTQLPGGWLAGHYGGKSVFGLGVFFTAIFTLLTPIAARTHVALLVAVRLMAGFGEGVTYPAATVLWSRWTSPAERSAYLVFSFTGGDFGAITSMPASGYLSSLKHVDEGWPLAFYVFGALGMLWFLVWVCIIHESPAEHPRIASWERDYIEEGIGDSQDKVVKVQYTQTLSEKKNFLSLFVPVPWLKILTSVPLWAVTVEGCAYSWGWYMFLTGLPSFFKEVLDFDIKKNGALTALPFIATLIVKNTSGYVSDRLQKHPSISRSVVRKGMTFLSFLFAATLLVPVGFLNCSQQNISVLLLTLSCGSLGLYAPTGSANSVDLSPRFAGVTMAIYNCFSNITGILVPTVIGLMTNN 442          
BLAST of slc17a-6 vs. Ensembl Nematostella
Match: EDO31704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX52])

HSP 1 Score: 177.178 bits (448), Expect = 7.447e-49
Identity = 145/497 (29.18%), Postives = 227/497 (45.67%), Query Frame = 1
Query:  109 TKMKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEY---LGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLI--LGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNI 1584
            TK  I  R++   M +LG I +Y +RVN++VAIV M N                   + IK+   EF W  A Q ++L SF++GY ++QIP   L +      ++G     TS+L    P+A    V+ +V +R   G+  G T+P  +A+   W    E S ++T  + G   G I+   L+GL+ +Y    GW  +FY     G +W+  + L+V   P+ HP IS+ E+ ++ NS+  +  + K +   LPW H+ + +  +  +I   GA + +  YTL   +P Y   VL F+I + G +++ PY+     +   GI  D++    I+    +R IF   G   A + +    +        I LV L V   G+      VN +DIAP YAG L+ + N F S  G I+P + G  T   + +  W  VF     V     + +    S   QPWA     +E          LS    DE    K  R+I
Sbjct:   32 TKWGIPKRYVLLAMTWLGFINIYSMRVNLNVAIVGMVNDQTISKGRL----------HFIKK--AEFNWDSALQGLVLGSFFYGYWVLQIPGAWLAMRIGGTRVFGYGVFVTSLLALLTPVATRYSVWGLVGVRIFQGLFLGVTFPCNHAIWSKWAPPFERSTLITISIAGCPFGNIVAIPLTGLLSKYGFDGGWPSVFYCFGTSGIIWYCCWELVVHESPATHPTISKEERELIENSIASS--DNKAQFEGLPWHHILRCKAVWAIVIGHFGACWGY--YTLFTGMPTYFKDVLDFDIEQTGFLAACPYLFKALLAPLGGILADYLIKHNILRIGTVRVIFYAVGCLLAGVFIVATSYATTRHMCVIFLV-LGVGFSGLNAIGYAVNHLDIAPQYAGVLMGLTNTFASTPGFISPQITGIVTKH-KKQEEWRIVFWITMIVYVVAVIGYSALCSGYRQPWAGGRDQVE----------LSEKERDEENGKKGHRDI 500          
BLAST of slc17a-6 vs. Ensembl Medaka
Match: slc17a5 (solute carrier family 17 member 5 [Source:NCBI gene;Acc:101165833])

HSP 1 Score: 268.085 bits (684), Expect = 1.646e-82
Identity = 158/455 (34.73%), Postives = 252/455 (55.38%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPV----SKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAI 1482
            R+  A +   G  +VY LRVN+SVA+V M N+T  +  +    CP     ++P N        + W    Q  IL SF++GY L QIP G +   F  KW+ G   L T++ T   PLAA+ G   ++ +R L G+ EG ++P++Y +   W    E S ++T    G  +GT++   +SG I  YLGW ++FYI  + G VWF+ +   VF+ P+ HP ISE E++ + NSL +      P    +PW+ +  SRP    ++   +YN+T+YTL+  LP Y+  +LGF+I +NG +S+LPY+    F+V SG   D+++   +     +RK F+  GM G ++ +    F+GC+  L +  + LS ++ G++ S   +N +DIAP+YAG LL I N F ++ G++ P +    T    T   W  VF   +++   GA+ + +FG  T+QPWA+
Sbjct:   37 RYGLALLSCYGFFVVYSLRVNLSVAMVDMLNTT-HQTNHSASVCPAHPSPARPKN--NHTANVYNWDSETQGWILGSFFYGYILTQIPGGYMAGRFGAKWLMGFGILGTAVFTLLTPLAADLGASYLIAVRVLEGIGEGVSFPAMYTMWAAWAPPLERSRLLTISYLGAQLGTVISLPVSGQICFYLGWTYVFYIFGIIGLVWFVLWAFFVFDSPNTHPRISERERLYITNSLKNE---LSPSAGFIPWRAILTSRPLLAIVVAHFSYNWTFYTLLTLLPTYMNDILGFSIQQNGMLSALPYVGCALFAVVSGQIADYLRETCLYPTVTVRKCFSLVGMIGPALFLVAAGFIGCDYTLAVTFLTLSSSLGGVSASGFNINHLDIAPSYAGILLGITNTFATIPGMVGPVIARALTQH-NTIAEWQVVFYIAAAINVVGALFYSVFGRGTVQPWAV 484          
BLAST of slc17a-6 vs. Ensembl Medaka
Match: slc17a5 (solute carrier family 17 member 5 [Source:NCBI gene;Acc:101165833])

HSP 1 Score: 227.254 bits (578), Expect = 2.575e-67
Identity = 146/455 (32.09%), Postives = 236/455 (51.87%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPV----SKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAI 1482
            R+  A +   G  +VY LRVN+SVA+V M N+T  +  +    CP     ++P N        + W    Q  IL SF++GY L QIP G +   F  KW+ G   L T++ T   PLAA+ G   ++ +R L G+ EG ++P++Y +   W    E S ++T    G  +GT++   +SG I  YLGW ++FYI  + G VWF+ +   VF+ P+ HP ISE E++ + NSL +      P    +PW+ +  SRP    ++   +YN+T+YTL+  LP Y+  +LGF+I +                         ++  K+    +L ++ A   M G ++ +    F+GC+  L +  + LS ++ G++ S   +N +DIAP+YAG LL I N F ++ G++ P +    T    T   W  VF   +++   GA+ + +FG  T+QPWA+
Sbjct:   40 RYGLALLSCYGFFVVYSLRVNLSVAMVDMLNTT-HQTNHSASVCPAHPSPARPKN--NHTANVYNWDSETQGWILGSFFYGYILTQIPGGYMAGRFGAKWLMGFGILGTAVFTLLTPLAADLGASYLIAVRVLEGIGEGVSFPAMYTMWAAWAPPLERSRLLTISYLGAQLGTVISLPVSGQICFYLGWTYVFYIFGIIGLVWFVLWAFFVFDSPNTHPRISERERLYITNSLKN---ELSPSAGFIPWRAILTSRPLLAIVVAHFSYNWTFYTLLTLLPTYMNDILGFSIQQ-------------------------VRMLKLTGCCRLCRMSAVLCMIGPALFLVAAGFIGCDYTLAVTFLTLSSSLGGVSASGFNINHLDIAPSYAGILLGITNTFATIPGMVGPVIARALTQH-NTIAEWQVVFYIAAAINVVGALFYSVFGRGTVQPWAV 462          
BLAST of slc17a-6 vs. Ensembl Medaka
Match: slc17a6a (solute carrier family 17 member 6 [Source:NCBI gene;Acc:101175075])

HSP 1 Score: 221.861 bits (564), Expect = 4.117e-64
Identity = 145/475 (30.53%), Postives = 236/475 (49.68%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+I A +  LG  I + +R N+ VAIV+M N++            + +    I +E  +F W      MI  SF+WGY + QIP G +        ++G + + TS L  FIP AA S    ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+   FG  W++ + L+ +  P+EHP I+E E+  +  S+  +     P ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D+++S  I+S T +RKI  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W  VF+  S V + G V + +F S   QPWA      E+   F + D L+    D
Sbjct:   70 RYIIAILSGLGFCISFGIRCNLGVAIVSMVNNST-----------IHQNGKIIVKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYISSRLAANRVFGAAIVLTSTLNMFIPSAARSHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATLSFCGSYAGAVIAMPLAGVLVQYTGWSSVFYVYGSFGIFWYMFWILVSYESPAEHPTITEEERRYIEESIGESAQLMGPSEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPLGGQLADYLRSHNIMSTTMVRKIMNCGGF-GMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKN-KTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPEETKEEKCGFIDEDELAEETGD 531          
BLAST of slc17a-6 vs. Ensembl Medaka
Match: SLC17A6 (vesicular glutamate transporter 2.1 [Source:NCBI gene;Acc:101166288])

HSP 1 Score: 214.542 bits (545), Expect = 1.702e-61
Identity = 142/475 (29.89%), Postives = 233/475 (49.05%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKP-KRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINED 1551
            R+I A M  +G  I + +R N+ VAIV M N++            + +    I +E  +F W      MI  SF+WGY + QIP G +        ++G + + TS L  FIP AA      ++ +R L G+ EG TYP+ + +   W    E S + T    G   G ++   L+G++++Y GW  +FY+    G  W+I + L+ +  P++HP I++ E+  +  S+  +     P ++   PW+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S+LP++ +       G   D ++SK I++ T +RKI  C G  G    +  ++    +  + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W  VF+  S V + G V + +F S   QPWA      E+   F + D L+    D
Sbjct:   66 RYIIAIMSGMGFCISFGIRCNLGVAIVGMVNNST-----------IHQNGKIIIKEKAKFNWDPETVGMIHGSFFWGYIVTQIPGGYICSRLAANRVFGAAIVLTSTLNMFIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATISFCGSYAGAVIAMPLAGILVQYSGWSSVFYVYGCVGIFWYIFWILVSYESPADHPTITDEERCYIEESIGESARLSGPGEKFKTPWRKFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLLSALPHLVMTIIVPIGGQLADHLRSKNILTTTTVRKIMNCGGF-GMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGAMTKN-KTREEWQYVFLIASLVHYGGVVFYGIFASGEKQPWADPELTSEEKCGFIDEDELAEETGD 527          
BLAST of slc17a-6 vs. Ensembl Medaka
Match: slc17a8 (vesicular glutamate transporter 3 [Source:NCBI gene;Acc:101165727])

HSP 1 Score: 213.386 bits (542), Expect = 5.877e-61
Identity = 150/487 (30.80%), Postives = 245/487 (50.31%), Query Frame = 1
Query:  130 RFIFAWMGFLGLIIVYMLRVNISVAIVAMANS-TVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ 1587
            R+I A +  LG  I + +R N+ VAIV M N+ TV+   N TP             +  +F W      +I  SF+WGY + QIP G +        ++G +   TS+L  FIP AA      ++ +R L G+ EG TYP+ + L   W    E S + T    G   G ++   L+G++++Y+GW  +FYI  +FG +W++ + LL +  P++HP I+E E++ +  ++          R P  W+  F S P +  ++     ++T+Y L+   P Y   V GF IS+ G +S++P++ +       G   DF++SKKI+S T +RK+  C G  G    +  ++       + I  + L+V   G  +S   VN +DIAP YA  L+ I N   +L G++ P + G  T + +TR  W +VF+  S V + G + + +F S   Q WA    + E L      D    I+EDE  + +S+ N++
Sbjct:   73 RYIIAILSGLGFCISFGIRCNLGVAIVEMVNNNTVYI--NGTPVL-----------QRAQFNWDPETVGLIHGSFFWGYIVTQIPGGFIANKLSANRVFGAAIFLTSVLNMFIPSAARVHYGCVLFVRILQGLVEGVTYPACHGLWAKWAPPLERSRLATTSFCGSYAGAVIAMPLAGVLVQYVGWPSVFYIYGVFGIMWYVMWLLLAYGSPADHPTITEEERLYIEAAIGETVNQLSKFRTP--WRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFPISKVGLLSAVPHMVMTIVVPIGGQLADFLRSKKIMSTTNVRKLMNCGGF-GMEATLLLVVGFSHTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIVGALTKN-KTRLEWQHVFVIASMVHYSGVIFYAIFASGEQQDWA----NPESL----SEDKCGIIDEDELAE-ESELNME 533          
BLAST of slc17a-6 vs. Planmine SMEST
Match: SMESG000049463.1 (SMESG000049463.1)

HSP 1 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 488/491 (99.39%), Postives = 489/491 (99.59%), Query Frame = 1
Query:  115 MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ 1587
            MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNS+KRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGY LLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDE TDSKSQRNIQ
Sbjct:    1 MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSMKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYSLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDEGTDSKSQRNIQ 491          
BLAST of slc17a-6 vs. Planmine SMEST
Match: SMESG000049463.1 (SMESG000049463.1)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 477/480 (99.38%), Postives = 478/480 (99.58%), Query Frame = 1
Query:  148 MGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ 1587
            MGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNS+KRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGY LLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDE TDSKSQRNIQ
Sbjct:    1 MGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSMKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYSLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDEGTDSKSQRNIQ 480          
BLAST of slc17a-6 vs. Planmine SMEST
Match: SMESG000049463.1 (SMESG000049463.1)

HSP 1 Score: 877.47 bits (2266), Expect = 0.000e+0
Identity = 467/470 (99.36%), Postives = 468/470 (99.57%), Query Frame = 1
Query:  178 MLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ 1587
            MLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNS+KRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGY LLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDE TDSKSQRNIQ
Sbjct:    1 MLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSMKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYSLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINEDEGTDSKSQRNIQ 470          
BLAST of slc17a-6 vs. Planmine SMEST
Match: SMESG000049462.1 (SMESG000049462.1)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 319/478 (66.74%), Postives = 378/478 (79.08%), Query Frame = 1
Query:  115 MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIEYLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLEQLVIFSESDSLSSINE 1548
            M+ Y RF+FA MGF GL IVYMLRVN+SV I+AM NST FKPKN+T ECP    NN+ K+ TGEF+W   DQTMILSSFYWGY + QIPS ILL++FKPKWIYGLST+ T I T  IP  A  GVY MV LRF+ G+CEGPTY SL ALCG WVL AESS VVT I  GG IGTI GQSL+GLII+ +GWRW FYI A  GCVWF+ YC +V+NRP EHPFIS+ EK +LI+SLPHNQPN++ KRVP+PWK V  S  F GFLI+ + YNFTWYTLINCLP+YIG+VLGFNIS+NGGISSLPY+ALF  ++S+G+ QDFIKSKKI+SNT LRK FAC GM  +SIIM+C+I+  CNIP  I LVCLSVA+MG    VT VN+ID+APAYAG L+ +CNLFNS+CGI+APYVK YYT +GETR NW NVFITN++++FFGA+ F LFGS  LQ WAIL+ +LE LV   + +S   IN+
Sbjct:    1 MRCYWRFVFALMGFFGLFIVYMLRVNLSVGIIAMVNSTYFKPKNYTAECPTLLQNNTDKKTTGEFMWDVNDQTMILSSFYWGYAITQIPSVILLIYFKPKWIYGLSTVATPIFTLIIPAIAQLGVYPMVALRFVTGLCEGPTYASLIALCGYWVLEAESSGVVTFICVGGLIGTITGQSLTGLIIDNMGWRWSFYIQATVGCVWFVIYCFVVYNRPVEHPFISDQEKNLLISSLPHNQPNFRHKRVPVPWKRVLTSSSFLGFLIMVSAYNFTWYTLINCLPMYIGSVLGFNISQNGGISSLPYVALFICNLSAGVLQDFIKSKKILSNTNLRKTFACSGMILSSIIMYCMIYTECNIPFAISLVCLSVALMGFAGPVTSVNVIDMAPAYAGQLIGVCNLFNSVCGIVAPYVKSYYTQTGETRKNWENVFITNAAILFFGALTFALFGSGKLQTWAILDPELENLVSCKKVESEGVIND 478          
BLAST of slc17a-6 vs. Planmine SMEST
Match: SMESG000066847.1 (SMESG000066847.1)

HSP 1 Score: 277.715 bits (709), Expect = 3.996e-86
Identity = 176/465 (37.85%), Postives = 264/465 (56.77%), Query Frame = 1
Query:  121 IYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPK--NFTPECPVSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPKWIYGXXXXXXXXXXXXXXXAANSGVYAMVILRFLMGVCEGPTYPSLYALCGCWVLAAESSXXXXXXXXXXXXXXXXXQSLSGLIIE---YLGWRWMFYIMAMFGCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPWKHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISSLPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCIIFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLFNSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSSTLQPWAILNCDLE 1500
            I  R++ A  GFLG  +VY LRVN+SVAI+AM N++  K    N TPECP S  N S   + GEF+W +  Q ++L +F+WGY  +QIP+G + +    KW +G+  L TS+LT   P+AA  G   ++ LR L G  E  TYP+++ + G W    E++ +   + +G   G ++G   S  +IE     GW  +FYI  + G VWFI +  + F+ P+ HP I+  EK  + +S+  +    + +   +PWK +  S P +   +      ++ YTL+  LPLY   VLGF+I++NG +++LPY+      V SG   D I+S+K +S T  RK+F   GMT  +I +  I ++GCN  L +  +C++VA+     +   VN ID+AP YAG L  I N   ++ GII P V G  T+  ETR  W  VF  +S++  FGA+ FL+FGS   Q WAI   ++E
Sbjct:   44 IPTRYVIAVWGFLGFAVVYALRVNLSVAILAMVNNSAIKDPGLNLTPECPNS--NLSKVTKDGEFVWDQNIQGLVLGAFFWGYIPLQIPAGAIAVKVGGKWFFGIGVLWTSLLTLLTPVAARLGYGWLIGLRILEGAGESITYPAMHTMLGYWAPVMETTFIGGIVYSGSFAGLVIGLLASAQLIESNVMGGWPSVFYIPGIIGIVWFIIWSFVAFSTPANHPRITMTEKRFIESSVNLSS---EERHSNVPWKSILLSLPVWAISVANFCSMWSLYTLLTSLPLYFEHVLGFSIAQNGYVNALPYLLSAIVFVVSGKIADIIRSRKWLSTTVTRKLFNTVGMTINAIFIVAISYIGCNKVLVVTFLCIAVALGTSNSAGYNVNHIDLAPQYAGVLYGITNSIATVAGIIGPSVVGVLTNHQETRKQWQIVFYISSAITLFGAIFFLIFGSGDRQSWAIEKSEIE 503          
The following BLAST results are available for this feature:
BLAST of slc17a-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC17A56.508e-7434.51solute carrier family 17 member 5 [Source:HGNC Sym... [more]
SLC17A74.467e-6329.44solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A63.262e-6229.98solute carrier family 17 member 6 [Source:HGNC Sym... [more]
SLC17A76.820e-6229.18solute carrier family 17 member 7 [Source:HGNC Sym... [more]
SLC17A81.097e-6030.83solute carrier family 17 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc-17.25.122e-5728.95Uncharacterized transporter slc-17.2 [Source:UniP... [more]
slc-17.12.117e-5129.05SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
slc-17.12.758e-5129.05SLC (SoLute Carrier) homolog [Source:UniProtKB/Tr... [more]
eat-42.280e-4827.21Probable vesicular glutamate transporter eat-4 [S... [more]
eat-42.987e-4827.21Probable vesicular glutamate transporter eat-4 [S... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFS109.230e-6831.67gene:FBgn0030452 transcript:FBtr0339677[more]
MFS109.230e-6831.67gene:FBgn0030452 transcript:FBtr0073724[more]
MFS109.230e-6831.67gene:FBgn0030452 transcript:FBtr0339678[more]
Picot3.321e-6733.40gene:FBgn0024315 transcript:FBtr0340067[more]
Picot3.321e-6733.40gene:FBgn0024315 transcript:FBtr0087114[more]
back to top
BLAST of slc17a-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a59.449e-7735.05solute carrier family 17 member 5 [Source:ZFIN;Acc... [more]
si:ch1073-513e17.12.551e-6635.64si:ch1073-513e17.1 [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
slc17a6a6.989e-6430.53solute carrier family 17 member 6a [Source:NCBI ge... [more]
slc17a6b1.124e-6130.32solute carrier family 17 member 6b [Source:NCBI ge... [more]
slc17a81.935e-6030.77solute carrier family 17 member 8 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nbeal26.897e-7335.39neurobeachin like 2 [Source:Xenbase;Acc:XB-GENE-60... [more]
hgf2.207e-6530.58hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf2.782e-6530.58hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf2.850e-6530.58hepatocyte growth factor (hepapoietin A; scatter f... [more]
hgf4.550e-6530.58hepatocyte growth factor (hepapoietin A; scatter f... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc17a51.550e-7134.35solute carrier family 17 (anion/sugar transporter)... [more]
Slc17a74.581e-6329.65solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a75.950e-6329.70solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a61.646e-6230.18solute carrier family 17 (sodium-dependent inorgan... [more]
Slc17a51.647e-6032.09solute carrier family 17 (anion/sugar transporter)... [more]
back to top
BLAST of slc17a-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9MZD1|S17A5_SHEEP2.257e-7335.01Sialin OS=Ovis aries OX=9940 GN=SLC17A5 PE=2 SV=1[more]
sp|Q9NRA2|S17A5_HUMAN3.125e-7334.51Sialin OS=Homo sapiens OX=9606 GN=SLC17A5 PE=1 SV=... [more]
sp|Q8BN82|S17A5_MOUSE1.084e-7034.35Sialin OS=Mus musculus OX=10090 GN=Slc17a5 PE=1 SV... [more]
sp|Q9V7S5|PICO_DROME4.537e-6633.33Putative inorganic phosphate cotransporter OS=Dros... [more]
sp|Q6INC8|VGLU1_XENLA2.361e-6430.38Vesicular glutamate transporter 1 OS=Xenopus laevi... [more]
back to top
BLAST of slc17a-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ710.000e+0100.00Slc17a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFB40.000e+066.95Slc17a-9 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
R7URJ72.320e-8437.28MFS domain-containing protein OS=Capitella teleta ... [more]
A0A3P8Y7E81.084e-8235.38Solute carrier family 17 member 5 OS=Esox lucius O... [more]
A0A3Q3ERG43.539e-8236.03Solute carrier family 17 member 5 OS=Labrus bergyl... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch1073-513e17.18.436e-7235.27sialin-like [Source:NCBI gene;Acc:103042153][more]
slc17a6b3.177e-6530.53vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6b6.561e-6530.53vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a6a5.339e-6430.53solute carrier family 17 member 6 [Source:NCBI gen... [more]
slc17a6a5.339e-6430.53solute carrier family 17 member 6 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc17a6b4.499e-4928.66solute carrier family 17 member 6b [Source:NCBI ge... [more]
ENSPMAT00000010352.12.023e-4835.55pep scaffold:Pmarinus_7.0:GL492704:416:4460:1 gene... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc17a-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455142.390e-6633.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463663.793e-6433.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486713.870e-5934.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341865.179e-5529.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317047.447e-4929.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc17a-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a51.646e-8234.73solute carrier family 17 member 5 [Source:NCBI gen... [more]
slc17a52.575e-6732.09solute carrier family 17 member 5 [Source:NCBI gen... [more]
slc17a6a4.117e-6430.53solute carrier family 17 member 6 [Source:NCBI gen... [more]
SLC17A61.702e-6129.89vesicular glutamate transporter 2.1 [Source:NCBI g... [more]
slc17a85.877e-6130.80vesicular glutamate transporter 3 [Source:NCBI gen... [more]
back to top
BLAST of slc17a-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049463.10.000e+099.39SMESG000049463.1[more]
SMESG000049463.10.000e+099.38SMESG000049463.1[more]
SMESG000049463.10.000e+099.36SMESG000049463.1[more]
SMESG000049462.10.000e+066.74SMESG000049462.1[more]
SMESG000066847.13.996e-8637.85SMESG000066847.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035201
GenBankAKN21529.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035201 ID=SMED30035201|Name=slc17a-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1811bp
TTTGAAGTTATTATTTTTTTTATTCATTTAATTAATATAGCTAAATTATA
CATTTTCATTTTAAAAAATATTTTTTAATAGTAAAAATCATTTTAACAAT
CTATCTAAACTAAGATGAAAATTTATTGCCGATTTATTTTTGCATGGATG
GGATTTCTGGGATTAATTATAGTCTACATGTTGAGGGTTAACATTAGCGT
TGCTATCGTGGCAATGGCAAATTCAACGGTTTTCAAGCCGAAAAATTTCA
CTCCAGAATGCCCAGTTTCTAAACCAAATAATTCTATTAAAAGAGAAACT
GGGGAATTCTTGTGGGGAGAGGCTGATCAGACAATGATTTTATCTTCGTT
TTATTGGGGATACACTTTAGTGCAAATACCCAGCGGAATCCTTTTGTTAT
TTTTCAAACCGAAATGGATTTACGGACTGTCAACCCTTACCACGTCAATT
CTTACATTTTTCATCCCGTTGGCGGCCAATAGTGGAGTTTATGCAATGGT
GATATTGCGATTTCTGATGGGGGTTTGTGAGGGACCGACTTATCCATCTC
TTTACGCTCTTTGCGGATGTTGGGTACTGGCCGCGGAAAGTTCGATTGTC
GTTACCTGTATAATGACAGGTGGAACGATTGGCACAATTTTGGGCCAAAG
TTTATCAGGACTCATTATTGAGTATTTAGGGTGGAGATGGATGTTTTATA
TAATGGCCATGTTTGGATGTGTTTGGTTCATTGGGTATTGCTTATTGGTG
TTCAACCGTCCGTCCGAACATCCCTTCATTAGTGAGCATGAAAAGATGAT
GTTAATAAATTCTCTGCCGCACAATCAACCAAATTACAAGCCTAAAAGAG
TTCCACTTCCTTGGAAACATGTTTTCAAATCCCGACCATTTTTTGGATTT
CTCATACTTGGTGCAACATATAATTTCACATGGTATACGCTCATAAATTG
CCTACCACTGTACATAGGAACAGTTCTTGGATTCAATATATCAGAGAATG
GCGGAATCTCCTCCCTCCCCTACATCGCCCTGTTTTTTTTCAGTGTTTCT
AGTGGAATCTTTCAAGATTTCATCAAATCAAAGAAAATAATATCAAATAC
AAAACTCAGGAAAATCTTTGCGTGTTTTGGAATGACAGGAGCATCTATAA
TAATGTTTTGCATCATTTTCATGGGGTGCAACATACCCCTGACCATTATG
TTGGTTTGCTTGAGTGTCGCAATGATGGGCATCACAGTATCGGTGACCGG
GGTCAATTTGATTGATATTGCACCCGCATATGCTGGACCGTTGTTAGCCA
TTTGCAATTTGTTCAATTCTCTATGTGGTATAATTGCACCGTATGTCAAA
GGTTATTATACACACAGTGGAGAAACAAGAAATAACTGGGCTAATGTATT
CATCACGAATTCCTCTGTTATGTTCTTCGGTGCCGTTGTTTTCTTATTAT
TCGGATCTTCGACATTGCAGCCTTGGGCAATCCTGAATTGCGATTTAGAA
CAACTAGTCATTTTCTCTGAATCTGATTCTCTATCCAGCATCAATGAAGA
TGAGAGAACCGACAGTAAAAGTCAAAGAAATATTCAGTGAATTTTTTTGA
AATTTTTTTTTGTACTTTATAAAAATTATGTTTTTTTGTTTTTATTTAAT
TTTATTTTTATCCCGAAAATTTGTTTTATTCGAATTGATAATAAATAATT
TTTTATTGATTGTTAAAATATTTGTCAACATTTGGATTTAAACAAACAAG
AAAATTTCTCTAATATATGGAGCCTCGCCGCAAGTGAATTCTGTTGTAAC
GGTTCTCAGAG
back to top

protein sequence of SMED30035201-orf-1

>SMED30035201-orf-1 ID=SMED30035201-orf-1|Name=SMED30035201-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MKIYCRFIFAWMGFLGLIIVYMLRVNISVAIVAMANSTVFKPKNFTPECP
VSKPNNSIKRETGEFLWGEADQTMILSSFYWGYTLVQIPSGILLLFFKPK
WIYGLSTLTTSILTFFIPLAANSGVYAMVILRFLMGVCEGPTYPSLYALC
GCWVLAAESSIVVTCIMTGGTIGTILGQSLSGLIIEYLGWRWMFYIMAMF
GCVWFIGYCLLVFNRPSEHPFISEHEKMMLINSLPHNQPNYKPKRVPLPW
KHVFKSRPFFGFLILGATYNFTWYTLINCLPLYIGTVLGFNISENGGISS
LPYIALFFFSVSSGIFQDFIKSKKIISNTKLRKIFACFGMTGASIIMFCI
IFMGCNIPLTIMLVCLSVAMMGITVSVTGVNLIDIAPAYAGPLLAICNLF
NSLCGIIAPYVKGYYTHSGETRNNWANVFITNSSVMFFGAVVFLLFGSST
LQPWAILNCDLEQLVIFSESDSLSSINEDERTDSKSQRNIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015293symporter activity
GO:0015319sodium:inorganic phosphate symporter activity
GO:0015321sodium-dependent phosphate transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006814sodium ion transport
GO:0006836neurotransmitter transport
GO:0035435phosphate ion transmembrane transport
GO:0035725sodium ion transmembrane transport
GO:0044341sodium-dependent phosphate transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0030054cell junction
GO:0030672synaptic vesicle membrane
GO:0031410cytoplasmic vesicle
GO:0043005neuron projection
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 14..409
e-value: 2.2E-47
score: 161.7
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 247..450
e-value: 6.4E-26
score: 92.9
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..225
e-value: 6.2E-32
score: 112.6
NoneNo IPR availablePANTHERPTHR11662:SF427FI19708P1coord: 5..455
NoneNo IPR availablePANTHERPTHR11662SODIUM-DEPENDENT PHOSPHATE TRANSPORTERScoord: 5..455
NoneNo IPR availableCDDcd17318MFS_SLC17coord: 10..447
e-value: 2.18905E-110
score: 330.35
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 359..381
NoneNo IPR availableTMHMMTMhelixcoord: 259..277
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 102..121
NoneNo IPR availableTMHMMTMhelixcoord: 297..316
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 425..447
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
NoneNo IPR availableTMHMMTMhelixcoord: 335..354
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 14..451
score: 15.121
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 6..448