DnaJ-like subfamily C member 27

Overview
NameDnaJ-like subfamily C member 27
Smed IDSMED30035194
Length (bp)1153
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ-like subfamily C member 27 (SMED30035194) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ-like subfamily C member 27 (SMED30035194) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ-like subfamily C member 27 (SMED30035194) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ-like subfamily C member 27 (SMED30035194) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035194

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035194SMESG000071551.1 SmedASXL_008754SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035194SMESG000071551.1 dd_Smed_v4_11963_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035194SMESG000071551.1 dd_Smed_v4_11963_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035194SMESG000071551.1 dd_Smed_v6_11963_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035194SMESG000071551.1 dd_Smed_v4_11963_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Human
Match: DNAJC27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:HGNC Symbol;Acc:HGNC:30290])

HSP 1 Score: 322.783 bits (826), Expect = 2.609e-109
Identity = 151/266 (56.77%), Postives = 201/266 (75.56%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE  + LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    +   I FVVCANKID    R VD  EG++W++S+ F+YFETSA + E +  +F++ +  I+      GKRP  N S++    + +EQ  AI++++N+K  ++ LGV PGA+++++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKRPTTNSSAS----FTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Human
Match: DNAJC27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:HGNC Symbol;Acc:HGNC:30290])

HSP 1 Score: 228.794 bits (582), Expect = 7.025e-74
Identity = 106/169 (62.72%), Postives = 130/169 (76.92%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFES 608
            KE  + LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    +   I FVVCANKID    R VD  EG++W++S+ F+YFETSA + E +  +F+ 
Sbjct:    9 KEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGPHGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQG 177          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Human
Match: DNAJC27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:HGNC Symbol;Acc:HGNC:30290])

HSP 1 Score: 120.939 bits (302), Expect = 2.980e-33
Identity = 54/74 (72.97%), Postives = 65/74 (87.84%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVR 326
            KE  + LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYE+R
Sbjct:    9 KEPGRSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVHVRDREIKVNIFDMAGHPFFYEMR 82          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Human
Match: AL358472.6 (novel protein)

HSP 1 Score: 112.464 bits (280), Expect = 9.350e-29
Identity = 65/188 (34.57%), Postives = 104/188 (55.32%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPN----PSSTLK 680
            K++ +G+ GVGK+CLI R+ E  F   Y++TIGID+ +  +  + K++K+ ++D AG   F  +   +Y+   G ILVYD+TD  SF+++  W++ IK   S+      +  ++  NK D +A+R V   +    +      +FETSA S+ NV   F SL   I+  L +G R   N    PS+ LK
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAG-----VERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDIL--LKSGGRRSGNGNKPPSTDLK 190          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Human
Match: RAB13 (RAB13, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9762])

HSP 1 Score: 112.464 bits (280), Expect = 9.350e-29
Identity = 65/188 (34.57%), Postives = 104/188 (55.32%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPN----PSSTLK 680
            K++ +G+ GVGK+CLI R+ E  F   Y++TIGID+ +  +  + K++K+ ++D AG   F  +   +Y+   G ILVYD+TD  SF+++  W++ IK   S+      +  ++  NK D +A+R V   +    +      +FETSA S+ NV   F SL   I+  L +G R   N    PS+ LK
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAG-----VERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDIL--LKSGGRRSGNGNKPPSTDLK 190          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Celegans
Match: rab-18 (Ras-related protein Rab-18 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXS1])

HSP 1 Score: 120.939 bits (302), Expect = 2.943e-32
Identity = 67/179 (37.43%), Postives = 102/179 (56.98%), Query Frame = 3
Query:   99 MMKENSKPLR-IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            M  ++S PL  +KI+ +G  GVGKS L+ R+ +  F  +  ATIG+D+ VT ++     +K+ I+D AG   F  +   +Y+  QG I VYDVT RSSF+ LN W+QE+ +  ++    + I  ++ ANKID   R V   EG  ++   + ++ E SA + E V   FE L + II T
Sbjct:    1 MSDDSSSPLTTLKILIIGESGVGKSSLMLRFVDDVFDPEQAATIGVDFRVTSMAIDGNRVKLAIWDTAGQERFRTLTPSYYRGAQGVICVYDVTSRSSFEKLNHWMQEVDTYCTN----DNIIKMMVANKIDMPNRVVTREEGLKFAKRHRTLFIEASAKTKEGVQCTFEELIEKIIQT 175          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Celegans
Match: rab-18 (Ras-related protein Rab-18 [Source:UniProtKB/Swiss-Prot;Acc:Q8MXS1])

HSP 1 Score: 120.939 bits (302), Expect = 2.943e-32
Identity = 67/179 (37.43%), Postives = 102/179 (56.98%), Query Frame = 3
Query:   99 MMKENSKPLR-IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            M  ++S PL  +KI+ +G  GVGKS L+ R+ +  F  +  ATIG+D+ VT ++     +K+ I+D AG   F  +   +Y+  QG I VYDVT RSSF+ LN W+QE+ +  ++    + I  ++ ANKID   R V   EG  ++   + ++ E SA + E V   FE L + II T
Sbjct:    1 MSDDSSSPLTTLKILIIGESGVGKSSLMLRFVDDVFDPEQAATIGVDFRVTSMAIDGNRVKLAIWDTAGQERFRTLTPSYYRGAQGVICVYDVTSRSSFEKLNHWMQEVDTYCTN----DNIIKMMVANKIDMPNRVVTREEGLKFAKRHRTLFIEASAKTKEGVQCTFEELIEKIIQT 175          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Celegans
Match: rab-35 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3])

HSP 1 Score: 110.538 bits (275), Expect = 2.708e-28
Identity = 62/184 (33.70%), Postives = 104/184 (56.52%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLK 680
            K++ +G+ GVGKS L+ R+ +  F E Y+ TIG+D+ +  +    + +K+ I+D AG   F  + + +Y+ T G ++VYDVT+  SF ++ RWLQEI++   S      +  V+  NK ++ + R V   + + ++ S    +FETSA  ++NV    E +F  I S + T K  + NP S  K
Sbjct:   12 KLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDS------VQKVLVGNKCEENERRVVLESDARNYAQSMNISFFETSAKEDKNV----EPMFTCITSLVLTAK--LANPQSASK 183          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 109.383 bits (272), Expect = 5.522e-28
Identity = 59/194 (30.41%), Postives = 108/194 (55.67%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLS-------------TGKRPIPNPSS 671
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYD+TD+ +F+++ +WLQEI  +  + ++ NK+   +  NK D  A+R V++   + ++      + ETSA S+ NV   F ++   I S +              TG +P+ +  S
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEI--DRYACENVNKL---LVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRMGPVQGAGGAPGVRITGSQPVQDKKS 201          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 108.612 bits (270), Expect = 1.165e-27
Identity = 59/186 (31.72%), Postives = 102/186 (54.84%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   +S      +  ++  NK D +A+R V   EG+ ++     ++ ETSA +  NV   F      I   +  G   I N ++ +K+G
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNS-----NMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNEANGIKLG 188          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Fly
Match: Rab18 (gene:FBgn0015794 transcript:FBtr0070849)

HSP 1 Score: 109.383 bits (272), Expect = 6.344e-28
Identity = 66/192 (34.38%), Postives = 107/192 (55.73%), Query Frame = 3
Query:  129 IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST--LSTGKRPIPNPSSTLKIGYNRE 698
            IK++ +G  GVGKS LI+R+ E +F + +  TIG+D+    +     + K+ ++D AG   F  +   FY+   GAILVYD+T R S   L  WL    +EL S  D   I  +V  NKID+ +R VD  EG+ ++   + ++ ETSA  ++ V ++F+ + + I+S+   + G     N S+ L I  +R+
Sbjct:    6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWL----AELDSYSDNPNIAIIVVGNKIDE-ERVVDREEGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNG-----NASAGLDIASDRD 187          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0336658)

HSP 1 Score: 108.997 bits (271), Expect = 1.039e-27
Identity = 59/186 (31.72%), Postives = 102/186 (54.84%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   +S      +  ++  NK D  ++R V   EG+ ++     ++ ETSA +  NV   F +    I   +  G   I N ++ +KIG
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNS-----NMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG 188          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Fly
Match: Rab2 (gene:FBgn0014009 transcript:FBtr0086124)

HSP 1 Score: 108.997 bits (271), Expect = 1.039e-27
Identity = 59/186 (31.72%), Postives = 102/186 (54.84%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   +S      +  ++  NK D  ++R V   EG+ ++     ++ ETSA +  NV   F +    I   +  G   I N ++ +KIG
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNS-----NMVIMLIGNKSDLDSRREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG 188          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 104.375 bits (259), Expect = 4.642e-26
Identity = 53/161 (32.92%), Postives = 93/161 (57.76%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESL 611
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYD TD+ SF+++ +WL+EI  E  + ++ NK+   +  NK D   ++ VD      ++      + ETSA S  NV   F ++
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEI--ERYACENVNKL---LVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTM 168          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Fly
Match: Rab19 (gene:FBgn0015793 transcript:FBtr0331832)

HSP 1 Score: 104.375 bits (259), Expect = 7.408e-26
Identity = 54/163 (33.13%), Postives = 93/163 (57.06%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYF--ETSALSNENVLNIFESL 611
            KI+ +G+ G GK+C++ R+    +IE++  TIG+D+ +  ++ + K++K+ I+D AG   F  +   +Y+   G ++VYD+T RSSF +L +W++E++   +S      +  ++  NK D + QR VD  E +        I F  ETSA  N NV + F  L
Sbjct:   23 KIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTAS-----NVLIILVGNKCDLEEQREVDFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCL 180          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Zebrafish
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 330.102 bits (845), Expect = 2.224e-112
Identity = 154/266 (57.89%), Postives = 201/266 (75.56%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            +EN K LR+K+IS+GN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKD+QG ILVYDV  R SFD L+ WL E+K E+ S  +   I FVVCANK+D   +R VD  EG++W++S+ F YFETSA S E +  +F+S F  I       GKRP P  S    +G+ +EQ   I++++N+K  ++ LGV PGAT+E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 RENKKSLRVKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGINEMFQSFFSSITDMCENGGKRPTPEVS----VGFTKEQADTIRRIRNSKDSWDMLGVKPGATREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTSLLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Zebrafish
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 330.102 bits (845), Expect = 2.480e-112
Identity = 154/266 (57.89%), Postives = 201/266 (75.56%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            +EN K LR+K+IS+GN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKD+QG ILVYDV  R SFD L+ WL E+K E+ S  +   I FVVCANK+D   +R VD  EG++W++S+ F YFETSA S E +  +F+S F  I       GKRP P  S    +G+ +EQ   I++++N+K  ++ LGV PGAT+E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 RENKKSLRVKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGINEMFQSFFSSITDMCENGGKRPTPEVS----VGFTKEQADTIRRIRNSKDSWDMLGVKPGATREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTSLLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Zebrafish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:373105])

HSP 1 Score: 114.39 bits (285), Expect = 1.218e-29
Identity = 62/178 (34.83%), Postives = 103/178 (57.87%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPN 662
            K++ +G+ GVGK+CLI R+ E  F   Y++TIGID+ V  +  + K++K+ ++D AG   F  +   +Y+   G ILVYD+TD  S++++  W++ IK   S+      ++ ++  NK D +A+R V    G+  +      +FETSA S+ NV   F SL   I+  L + K+P P+
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAG-----VSRMLLGNKCDIEAKRKVSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDIL--LKSNKKPGPS 180          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Zebrafish
Match: rab4a (RAB4a, member RAS oncogene family [Source:NCBI gene;Acc:403031])

HSP 1 Score: 114.39 bits (285), Expect = 1.368e-29
Identity = 65/202 (32.18%), Postives = 109/202 (53.96%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAK 734
            K + +GN G GKSCL+ ++ EKRF +    TIG+++G   +S  NK +K+ I+D AG   F  V   +Y+   GA+LVYD+T R +++ L  WL + +   S       I  ++C NK D  A R V  +E   ++   + ++ ETSAL+ ENV   F      I++ + +G+       S ++ G      AA+++L++ +
Sbjct:   10 KFLVIGNAGTGKSCLLHQFIEKRFKDDSNHTIGVEFGSKIISVVNKFVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLAS-----QNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGD-----AALRQLRSPR 201          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Zebrafish
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 114.005 bits (284), Expect = 1.851e-29
Identity = 57/161 (35.40%), Postives = 99/161 (61.49%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESL 611
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  ++++ NK+   +  NK D   ++ VD    K ++DS    + ETSA S+ NV   F ++
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTKKVVDYTAAKEFADSLSIPFLETSAKSSTNVEQAFMTM 165          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Xenopus
Match: cyp2a6.13 (cytochrome P450 family 2 subfamily A member 6 gene 13 [Source:Xenbase;Acc:XB-GENE-956774])

HSP 1 Score: 231.106 bits (588), Expect = 4.494e-74
Identity = 111/215 (51.63%), Postives = 152/215 (70.70%), Query Frame = 3
Query:  258 FKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
             K++E+K+NIFDMAGH FFYEVRNEFYKDTQG ILVYDV  + SF+ L+ WL E+K EL S  + + I F VCANKID  + R VD  EG++WS+S+ F+YFETSA             +  I+      GKRP+    S + IG+ +EQ  +I++++ +K  ++ LGV PGAT++++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:   21 LKDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFESLDAWLAEMKQELGSQGNIDNIVFAVCANKIDSTKHRCVDESEGRLWSESKGFLYFETSA------------FYSAIVDLCDNGGKRPV----SAINIGFTKEQADSIRRIRGSKDSWDMLGVKPGATRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 219          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Xenopus
Match: thsd1 (thrombospondin type 1 domain containing 1 [Source:Xenbase;Acc:XB-GENE-6044670])

HSP 1 Score: 112.849 bits (281), Expect = 1.042e-28
Identity = 62/168 (36.90%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  129 IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            +KI+ +G  GVGKS L+ R+ +  F  +  ATIG+D+ V  +S    + K+ I+D AG   F  +   +Y+  QG ILVYDVT R +F  L+ WL E+++  +     N I  ++  NKIDK  R VD  EG  ++     ++ E SA + + V   FE L + II T
Sbjct:    9 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFTRLDNWLNELETYCTR----NDIVKMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTRDGVQCAFEELVEKIIQT 172          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Xenopus
Match: thsd1 (thrombospondin type 1 domain containing 1 [Source:Xenbase;Acc:XB-GENE-6044670])

HSP 1 Score: 112.079 bits (279), Expect = 1.209e-28
Identity = 62/168 (36.90%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  129 IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            +KI+ +G  GVGKS L+ R+ +  F  +  ATIG+D+ V  +S    + K+ I+D AG   F  +   +Y+  QG ILVYDVT R +F  L+ WL E+++  +     N I  ++  NKIDK  R VD  EG  ++     ++ E SA + + V   FE L + II T
Sbjct:    9 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFTRLDNWLNELETYCTR----NDIVKMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTRDGVQCAFEELVEKIIQT 172          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Xenopus
Match: RAB2A (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:100038062])

HSP 1 Score: 111.694 bits (278), Expect = 2.249e-28
Identity = 61/186 (32.80%), Postives = 104/186 (55.91%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   +S      +  ++ ANK D +++R V   EG+ ++     I+ ETSA +  NV   F +    I   +  G   I N ++ +KIG
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNS-----NMVIMLIANKSDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG 188          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Xenopus
Match: rab21 (RAB21, member RAS oncogene family [Source:NCBI gene;Acc:549073])

HSP 1 Score: 112.079 bits (279), Expect = 2.272e-28
Identity = 60/187 (32.09%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  114 SKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSS 671
            SK    K++ +G   VGK+ L+ RYCE +F +K++ T+   +   KL+   K + + I+D AG   F+ +   +Y+D+ GAILVYD+TD  SF  +  W++E++  L      N+I   +  NK+D + +R V   E + +++S    ++ TSA  N+ +  +F  L   +I T  T +R   N  S
Sbjct:   13 SKTYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLG-----NEICLCIVGNKVDLEKERHVSVQEAETYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQTDERAKGNGPS 194          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Mouse
Match: Dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:MGI Symbol;Acc:MGI:2443036])

HSP 1 Score: 322.783 bits (826), Expect = 1.641e-109
Identity = 150/266 (56.39%), Postives = 204/266 (76.69%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE +K LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FF+EVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    + + I FVVCANKID ++ R +D  EG++W++S+ F+YFETSA + E +  +F++ +  I+      GKRP  + S++    + +EQ   I++++N+K  +E LGV PGA++E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCENGGKRPTASSSAS----FTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Mouse
Match: Dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:MGI Symbol;Acc:MGI:2443036])

HSP 1 Score: 322.783 bits (826), Expect = 1.641e-109
Identity = 150/266 (56.39%), Postives = 204/266 (76.69%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE +K LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FF+EVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    + + I FVVCANKID ++ R +D  EG++W++S+ F+YFETSA + E +  +F++ +  I+      GKRP  + S++    + +EQ   I++++N+K  +E LGV PGA++E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCENGGKRPTASSSAS----FTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Mouse
Match: Dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:MGI Symbol;Acc:MGI:2443036])

HSP 1 Score: 322.783 bits (826), Expect = 1.641e-109
Identity = 150/266 (56.39%), Postives = 204/266 (76.69%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE +K LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FF+EVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    + + I FVVCANKID ++ R +D  EG++W++S+ F+YFETSA + E +  +F++ +  I+      GKRP  + S++    + +EQ   I++++N+K  +E LGV PGA++E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCENGGKRPTASSSAS----FTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 114.005 bits (284), Expect = 2.029e-29
Identity = 65/185 (35.14%), Postives = 103/185 (55.68%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKR---PIPNPSST 674
            K++ +G+ GVGK+CLI R+ E  F   Y++TIGID+ +  +  + K +K+ ++D AG   F  +   +Y+   G ILVYD+TD  SF+++  W++ IK   S+      +  ++  NK D +A+R V   + +  +   +  +FETSA S+ NV   F SL   I+  L TG R       PSST
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAG-----VERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDIL--LKTGGRRSGTNSKPSST 187          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 111.309 bits (277), Expect = 1.702e-28
Identity = 61/185 (32.97%), Postives = 105/185 (56.76%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKI 683
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  ++++ NK+   +  NK D   ++ VD    K ++DS    + ETSA +  NV   F ++   I   +  G        S +KI
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKI 189          
BLAST of DnaJ-like subfamily C member 27 vs. UniProt/SwissProt
Match: sp|Q6IMM1|DJC27_CHICK (DnaJ homolog subfamily C member 27 OS=Gallus gallus OX=9031 GN=DNAJC27 PE=2 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 3.611e-112
Identity = 152/265 (57.36%), Postives = 203/265 (76.60%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE  K LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    + + I FVVCANKID    R+VD  EG++W++S+ F+YFETSA + E +  +F++ +  II     G +    P S++ +G+ +EQ  AI++++N+K  ++ LGV PGAT++++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KEARKSLRIKVISMGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKESFDALDAWLAEMKQELGPHGNMDNIVFVVCANKIDCTKHRSVDESEGRLWAESRGFLYFETSAQTGEGINEMFQTFYSAIIDLCDNGGK---RPPSSMGVGFTKEQADAIRRIRNSKDSWDMLGVKPGATRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. UniProt/SwissProt
Match: sp|Q6IMK3|DJC27_DANRE (DnaJ homolog subfamily C member 27 OS=Danio rerio OX=7955 GN=dnajc27 PE=2 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.679e-111
Identity = 154/266 (57.89%), Postives = 201/266 (75.56%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            +EN K LR+K+IS+GN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKD+QG ILVYDV  R SFD L+ WL E+K E+ S  +   I FVVCANK+D   +R VD  EG++W++S+ F YFETSA S E +  +F+S F  I       GKRP P  S    +G+ +EQ   I++++N+K  ++ LGV PGAT+E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 RENKKSLRVKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMENIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGINEMFQSFFSSITDMCENGGKRPTPEVS----VGFTKEQADTIRRIRNSKDSWDMLGVKPGATREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTSLLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. UniProt/SwissProt
Match: sp|Q5M7D1|DJ27B_XENLA (DnaJ homolog subfamily C member 27-B OS=Xenopus laevis OX=8355 GN=dnajc27-b PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.682e-110
Identity = 154/269 (57.25%), Postives = 206/269 (76.58%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELS---SADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            K++ KPLRIK+ISMGN  VGKSC+IKRYCEKRF+ KY ATIGIDYGVTK+  K++E+K+NIFDMAGH FFYEVRNEFYKDTQG ILVYDV  + SF+ L+ WL E+K EL    + D+ + I F VCANKID  + R VD  EG++WS+S+ F+YFETSA S E +  +F++ +  I+      GKRP+    S + IG+ +EQ  +I++++N+K  ++ LGV PGAT++++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KDSRKPLRIKVISMGNAEVGKSCIIKRYCEKRFVPKYQATIGIDYGVTKVQIKDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKESFESLDAWLAEMKQELGPQINIDNLDNIVFAVCANKIDSTKHRCVDESEGRLWSESKGFLYFETSAQSGEGINEMFQAFYSSIVDLCDNGGKRPV----SAINIGFTKEQADSIRRIRNSKDSWDMLGVKPGATRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 273          
BLAST of DnaJ-like subfamily C member 27 vs. UniProt/SwissProt
Match: sp|Q7ZYF1|DJ27A_XENLA (DnaJ homolog subfamily C member 27-A OS=Xenopus laevis OX=8355 GN=dnajc27-a PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.687e-109
Identity = 151/266 (56.77%), Postives = 203/266 (76.32%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            K++ K LRIK+ISMGN  VGKSC+IKRYCEKRF+ KY ATIGIDYGVTK+  K++E+K+NIFDMAGH FFYEVRNEFYKDTQG ILVYDV  + +F+ L+ WL E+K EL    + + I F VCANKID  + R+VD  EG++WS+S+ F+YFETSA S E +  +F++ +  I+      GKRP+    S + IG+ +EQ  +I++++N K  ++ LGV PGAT++++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KDSRKALRIKVISMGNAEVGKSCIIKRYCEKRFVPKYQATIGIDYGVTKVHIKDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGHKETFESLDGWLAEMKQELGPQGNIDNIVFAVCANKIDSTKHRSVDESEGRLWSESKGFLYFETSAQSGEGINEMFQAFYSAIVDLCDNGGKRPV----SAINIGFTKEQADSIRRIRNCKDSWDMLGVKPGATRDEVNKAYRKLAVLLHPDKCMAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. UniProt/SwissProt
Match: sp|Q8CFP6|DJC27_MOUSE (DnaJ homolog subfamily C member 27 OS=Mus musculus OX=10090 GN=Dnajc27 PE=1 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 1.148e-108
Identity = 150/266 (56.39%), Postives = 204/266 (76.69%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE +K LRIK+ISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FF+EVRNEFYKDTQG ILVYDV  + SFD L+ WL E+K EL    + + I FVVCANKID ++ R +D  EG++W++S+ F+YFETSA + E +  +F++ +  I+      GKRP  + S++    + +EQ   I++++N+K  +E LGV PGA++E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    9 KEPAKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFFEVRNEFYKDTQGVILVYDVGQKDSFDALDSWLAEMKQELGPHGNMDNIVFVVCANKIDCSKHRCIDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYLSIVDLCENGGKRPTASSSAS----FTKEQADTIRRIRNSKDSWEMLGVRPGASREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLK 270          
BLAST of DnaJ-like subfamily C member 27 vs. TrEMBL
Match: A0A433UCY7 (J domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_000607 PE=4 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 6.531e-118
Identity = 164/265 (61.89%), Postives = 212/265 (80.00%), Query Frame = 3
Query:  105 KENSKP-LRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            K   KP LR+KIISMGN   GKSC+IKRYCEKRF+ KYLATIGIDYGVTK++ K +++K+NIFDMAGH  FYEVRNEFYKDTQGAILVYDV+DRSSF+ L+RW++E+  E+ +  + + I   VCANK D  +R VD  EG++W+D++ F +FETSALS + V  +F++LF+G++ T   G +  P    T ++GY +EQI AIQ+LKNAK  YERLG++PGA+K+D+N+SYRKLAV+LHPDK++APGS+EAFKLLV ART LLK
Sbjct:    4 KTRRKPNLRVKIISMGNSETGKSCIIKRYCEKRFVNKYLATIGIDYGVTKVTLKERDIKVNIFDMAGHPLFYEVRNEFYKDTQGAILVYDVSDRSSFEALDRWMEELNGEIGNKSEVDSIVVCVCANKTD-LRRQVDESEGQLWADARGFHFFETSALSGDGVNEMFQALFEGVVKTCENGGKREP---ITTQLGYTKEQIDAIQRLKNAKNDYERLGLAPGASKDDVNKSYRKLAVLLHPDKSVAPGSEEAFKLLVAARTSLLK 264          
BLAST of DnaJ-like subfamily C member 27 vs. TrEMBL
Match: A7RXC6 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g203554 PE=4 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 4.850e-117
Identity = 159/268 (59.33%), Postives = 208/268 (77.61%), Query Frame = 3
Query:   99 MMKENS--KPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            M K+N   + +R+KIISMGN  VGKSC+IKRYCEKRFI KY+ TIGIDYGVTK+   +KE+K+NIFDMAGH  FYEVRNEFYKDTQGA+LVYDVT R SF+ L+ WL EIK ++ S  DFN + FVVCANK+D  +R V+  EG+ W+++ +F YFETSA + + +  +F++LF G++  L  G +P+    + L +GY++EQ   IQ+LKNAK HYERLG+  GATK+DINR+Y+KLAV++HPDK++APGS+EAFK LV AR  LL+
Sbjct:    1 MEKKNKAKRGIRVKIISMGNAEVGKSCIIKRYCEKRFISKYMTTIGIDYGVTKVVVDDKEIKVNIFDMAGHPVFYEVRNEFYKDTQGALLVYDVTSRESFEALDIWLDEIKKDIGSPSDFNSVVFVVCANKVDSRKRLVEESEGRQWAENHKFCYFETSAQTGDGIPEVFQTLFTGVVKALENGGKPVL-IDTALTLGYSKEQAEVIQRLKNAKDHYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAFKALVAARASLLQ 267          
BLAST of DnaJ-like subfamily C member 27 vs. TrEMBL
Match: A0A1S3JTI4 (dnaJ homolog subfamily C member 27-like OS=Lingula unguis OX=7574 GN=LOC106175993 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.513e-116
Identity = 158/260 (60.77%), Postives = 207/260 (79.62%), Query Frame = 3
Query:  117 KPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            K  R+KIISMGN   GKSC+IKRYCEKRF++KYLATIGIDYGVTK++ K +E+K+NIFDMAGH  FYEVRNEFYKDTQGA+LVYD+ DR SF+ L  WL E+++E+ +  + + I F VCANK DK +R VD  +G++W++ + F YFETSA + E V  +F+ LF+G++ST+  G +  P    T ++GY ++Q  AIQ+LKN+K  YERLG+ PGA+K+DIN++YRKLAV+LHPDKN+APGS+EAFKLLV ART+LLK
Sbjct:   11 KATRVKIISMGNAETGKSCIIKRYCEKRFVQKYLATIGIDYGVTKVTVKGQEMKVNIFDMAGHPIFYEVRNEFYKDTQGAMLVYDIADRGSFEALEAWLAEMRNEIGNPAEMDNIVFCVCANKCDK-KRVVDEADGRLWAEGKGFHYFETSAQTGEGVGEMFQVLFEGVLSTVENGGKRRP---MTTQLGYTKDQAEAIQRLKNSKNDYERLGLHPGASKDDINKAYRKLAVLLHPDKNVAPGSEEAFKLLVAARTNLLK 266          
BLAST of DnaJ-like subfamily C member 27 vs. TrEMBL
Match: V4AHB3 (J domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_224445 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.081e-115
Identity = 158/257 (61.48%), Postives = 212/257 (82.49%), Query Frame = 3
Query:  126 RIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            R+KIISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVT+++ K+KE+K+NIFDMAGH  FYEVRNEFY+DTQGAIL+YDV++RSSF  L+ W+ E+KSE+ +  D + +   VCANKIDK +R VD +EG++W+ S  + YFETSA S E V  +F++L +G+I+T+  G + +P   +  ++GY++EQI AIQ+LKN+K+ YERLG++  ATK+D+N++YRKLAV+LHPDK++APGS+EAFKLLV ART+LLK
Sbjct:    8 RVKIISMGNAEVGKSCIIKRYCEKRFVNKYLATIGIDYGVTRVTIKDKEVKVNIFDMAGHPIFYEVRNEFYRDTQGAILIYDVSERSSFTALDDWMNEMKSEIGNHGDMDNMIVCVCANKIDK-KRVVDEVEGRLWASSHGYHYFETSAQSGEGVNELFKTLLEGVINTIDNGGQKLP---TVTQLGYSKEQIDAIQRLKNSKSDYERLGLTTSATKDDVNKAYRKLAVLLHPDKSVAPGSEEAFKLLVAARTNLLK 260          
BLAST of DnaJ-like subfamily C member 27 vs. TrEMBL
Match: K1PD24 (DnaJ-like protein subfamily C member 27 OS=Crassostrea gigas OX=29159 GN=CGI_10003392 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.518e-115
Identity = 157/266 (59.02%), Postives = 211/266 (79.32%), Query Frame = 3
Query:   99 MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            M K++ KPLRIKIISMGN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK++ K +++K+NIFDMAGH  FYEVRNEFYKDTQGA++V+DV DR SFD L+ W+ E+++E+ +  + + +   VCANK DK +R VD  E ++W++++ + YFETSA + E V  +F++LF+ ++     G + +P  ++   +GY++EQ  AIQKL+NAK  YERLG+ PGATK+D+NR+YRKLAV+LHPDK++APGS+EAFKLLV ART LLK
Sbjct:    4 MDKKSKKPLRIKIISMGNAEVGKSCIIKRYCEKRFVHKYLATIGIDYGVTKVTVKERDIKVNIFDMAGHPIFYEVRNEFYKDTQGAVVVFDVADRQSFDALDSWMLEMQNEIGNQSEMDNVVVCVCANKNDK-KRVVDEAEARIWAETKGYHYFETSAQTGEGVSEMFQTLFESVVMAFENGGKRVPVQTT---LGYSKEQADAIQKLRNAKNDYERLGLPPGATKDDVNRAYRKLAVLLHPDKSVAPGSEEAFKLLVAARTTLLK 265          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Cavefish
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 325.865 bits (834), Expect = 9.342e-111
Identity = 152/266 (57.14%), Postives = 201/266 (75.56%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            +E+ K LR+K+IS+GN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKD+QG ILVYDV  R SFD L+ WL E+K E+ S  +   I FVVCANK+D   +R VD  EG++W++S+ F YFETSA S E +  +F++ F  I       GK+P P  S    IG+ +EQ   I++++N+K  ++ LGV PGAT+E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:   10 RESKKSLRVKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYEVRNEFYKDSQGVILVYDVGLRESFDALDSWLTEMKQEMGSQANMESIIFVVCANKVDLTKRRVVDESEGRLWAESRGFHYFETSAQSGEGISEMFQAFFSSITDMCENGGKKPPPEVS----IGFTKEQADTIRRIRNSKDSWDMLGVKPGATREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTSLLK 271          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Cavefish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:103044636])

HSP 1 Score: 114.005 bits (284), Expect = 1.644e-29
Identity = 63/178 (35.39%), Postives = 102/178 (57.30%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPN 662
            K++ +G+ GVGK+CLI R+ E  F   Y++TIGID+ V  +  + K++K+ ++D AG   F  +   +Y+   G ILVYD+TD  SF+++  W++ IK   S+      ++ ++  NK D +A+R V    G+  +      +FETSA S+ NV   F SL   I+  L +GK+  P 
Sbjct:   10 KLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAG-----VSRMLLGNKCDIEAKRKVSKEMGEKLAKDHGIRFFETSAKSSINVEESFMSLARDIL--LKSGKKSGPT 180          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Cavefish
Match: rab1ab (ras-related protein Rab-1A [Source:NCBI gene;Acc:103035225])

HSP 1 Score: 112.464 bits (280), Expect = 5.174e-29
Identity = 61/185 (32.97%), Postives = 105/185 (56.76%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKI 683
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  ++++ NK+   +  NK D   ++ VD    K ++DS    + ETSA +  NV   F ++   I   +  G        S +KI
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATAGGTEKSNVKI 189          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Cavefish
Match: rab4a (RAB4A, member RAS oncogene family [Source:NCBI gene;Acc:103032660])

HSP 1 Score: 111.694 bits (278), Expect = 1.526e-28
Identity = 64/202 (31.68%), Postives = 112/202 (55.45%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAK 734
            K + +GN G GKSCL+ ++ EK+F +    TIG+++G   ++  NK +K+ I+D AG   F  V   +Y+   GA+LVYD+T R +++ L  WL + +  L+S +    I  ++C NK D  A R V  +E   ++   + ++ ETSAL+ ENV   F      I++ + +G+       S ++ G      AA+++L++ +
Sbjct:   10 KFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVVNKFVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARM-LASQN----IVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGD-----AALRQLRSPR 201          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Cavefish
Match: rab1ba (zRAB1B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-040426-873])

HSP 1 Score: 110.923 bits (276), Expect = 3.753e-28
Identity = 55/161 (34.16%), Postives = 98/161 (60.87%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESL 611
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ S++++ +WLQEI  +  ++++ NK+   +  NK D   ++ VD    K ++DS    + ETSA +  NV   F ++
Sbjct:   31 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLAIPFLETSAKNATNVEQAFMTM 186          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Sea Lamprey
Match: dnajc27 (DnaJ (Hsp40) homolog, subfamily C, member 27 [Source:NCBI gene;Acc:402784])

HSP 1 Score: 319.701 bits (818), Expect = 6.701e-109
Identity = 146/270 (54.07%), Postives = 203/270 (75.19%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKA-QRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGAT-----KEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            KE  K LR+K+ISMGNP VGKSCLIKRYCEKRF+ KY+ATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKDTQGA+LV+DV  R SFD L+ WL E++ E+      + +  VVCANK++   +R VD  EG++W++S+ F+YFETSA + E V  +F++LF  I+     G R    P+  + +G+ +EQ  AI++++N++  +E LG+ PGA      +++IN++YRKLAV+LHPDK++APGS++AFK +V ART LL+
Sbjct:   10 KEVRKSLRVKVISMGNPEVGKSCLIKRYCEKRFVHKYMATIGIDYGVTKVHVRDREVKVNIFDMAGHPFFYEVRNEFYKDTQGALLVFDVGSRDSFDALDGWLAEMRHEMGPHGSPDDVLVVVCANKVETGRRRVVDDSEGRLWAESRGFLYFETSAQTGEGVGEMFQTLFAAIVELCDNGGR---RPTPAVTVGFTKEQADAIRRIRNSRDCWEMLGLKPGANSVCAHRDEINKAYRKLAVLLHPDKSVAPGSEDAFKAIVNARTVLLR 276          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 113.62 bits (283), Expect = 4.761e-30
Identity = 61/185 (32.97%), Postives = 106/185 (57.30%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKI 683
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  ++++ NK+   +  NK D   ++ VD    K ++DS +  + ETSA +  NV   F ++   I   +  G        S +KI
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGATQAGAGKSNVKI 192          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Sea Lamprey
Match: rab18b (RAB18B, member RAS oncogene family [Source:NCBI gene;Acc:445055])

HSP 1 Score: 110.923 bits (276), Expect = 4.126e-29
Identity = 60/168 (35.71%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  129 IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            +KI+ +G  GVGKS L+ R+ +  F  +  ATIG+D+ V  ++    + K+ I+D AG   F  +   +Y+  QG ILVYDVT R +F  L  WL E+++  + +D    I  ++  NKIDK  R +D  EG  ++     ++ E SA + + V   FE L + II T
Sbjct:    8 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTIAVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTKRDTFLKLENWLSELETYTTRSD----IVKMLVGNKIDKDGRVLDRTEGLKFARKHSMLFIEASAKTRDGVQCAFEELVEKIIQT 171          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 108.997 bits (271), Expect = 2.314e-28
Identity = 59/186 (31.72%), Postives = 103/186 (55.38%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   +S      +  ++  NK D +++R V   EG+ ++     ++ ETSA +  NV   F +    I   +  G   I N ++ +KIG
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNS-----NMVIMLIGNKSDLESRREVKREEGEAFAREHGLVFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG 188          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 108.227 bits (269), Expect = 5.567e-28
Identity = 58/186 (31.18%), Postives = 103/186 (55.38%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   +S      +  ++  NK D +++R V   EG+ ++     ++ ETSA +  NV   F +    I   +  G   + N ++ +KIG
Sbjct:   13 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGKQVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNS-----NMVIMLIGNKSDLESRREVKCEEGEAFAREHGLVFMETSAKTAANVEEAFINTAREIYEKIQEGVFDVNNEANGIKIG 193          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 110.153 bits (274), Expect = 5.048e-29
Identity = 58/170 (34.12%), Postives = 100/170 (58.82%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLS 638
            K++ +GN GVGKSCL+ R+ +  +   Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+ + G I+VYDVTD+ SF+ +  WLQEI    +S      +  ++  NK D K +R V+    K ++D+ +  + ETSAL + NV + F ++   I  ++S
Sbjct:   10 KLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATST-----VLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMS 174          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 106.686 bits (265), Expect = 1.622e-27
Identity = 60/184 (32.61%), Postives = 102/184 (55.43%), Query Frame = 3
Query:  123 LRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSS 671
            L  KI+ +G+ GVGKS L+ R+ +  F     +TIG+++    L    K +K  I+D AG   +  + + +Y+   GA++VYD++  SS+++ N WL E++    +ADD   +   +  NK D A  R V + E K ++   Q ++ ETSAL++ENV   FE L + I   +S  +  + + S+
Sbjct:   12 LLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELR---ENADD--NVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMDLGDSSA 190          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 101.679 bits (252), Expect = 8.261e-26
Identity = 53/161 (32.92%), Postives = 92/161 (57.14%), Query Frame = 3
Query:  129 IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESL 611
            +KI+ +G+ GVGKSCL+ R+ E +F   ++ TIGID+ +  +    K++K+ ++D AG   F  +   +Y+   G ILVYDVTD  +F ++ +W + +      A+D  ++  V   NK D   R V + +G+  +      + E+SA +++NV  IF +L
Sbjct:   21 MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEH---ANDEAQLLLV--GNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTL 176          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 99.7525 bits (247), Expect = 4.627e-25
Identity = 56/170 (32.94%), Postives = 97/170 (57.06%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ-RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLS 638
            KI+ +G+ GVGKS L+ R+    F  +  +TIG+++    +  +NK++K  I+D AG   +  + + +Y+   GA++VYD++  SS+++ N WL E++    +ADD   +   +  NK D A  R V + E K ++   Q ++ ETSAL+++NV   F  L   I   +S
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELR---ENADD--NVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVS 179          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 92.0485 bits (227), Expect = 2.357e-22
Identity = 52/168 (30.95%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  111 NSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQ----RTVDSMEGKMWSDSQQFIYFETSALSNENVLNIF 602
            N+    IK++ +G   VGKS ++ R+    F E    TIG  +   +++     +K  I+D AG   F  +   +Y++ Q A++VYDVT   SF     W++E+  + S       I   +  NKID  Q    R V   EG+  ++ +  ++FETSA + ENV ++F
Sbjct:    2 NTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASK-----DIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVF 164          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Nematostella
Match: EDO44005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC6])

HSP 1 Score: 350.517 bits (898), Expect = 6.707e-121
Identity = 159/268 (59.33%), Postives = 208/268 (77.61%), Query Frame = 3
Query:   99 MMKENS--KPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            M K+N   + +R+KIISMGN  VGKSC+IKRYCEKRFI KY+ TIGIDYGVTK+   +KE+K+NIFDMAGH  FYEVRNEFYKDTQGA+LVYDVT R SF+ L+ WL EIK ++ S  DFN + FVVCANK+D  +R V+  EG+ W+++ +F YFETSA + + +  +F++LF G++  L  G +P+    + L +GY++EQ   IQ+LKNAK HYERLG+  GATK+DINR+Y+KLAV++HPDK++APGS+EAFK LV AR  LL+
Sbjct:    1 MEKKNKAKRGIRVKIISMGNAEVGKSCIIKRYCEKRFISKYMTTIGIDYGVTKVVVDDKEIKVNIFDMAGHPVFYEVRNEFYKDTQGALLVYDVTSRESFEALDIWLDEIKKDIGSPSDFNSVVFVVCANKVDSRKRLVEESEGRQWAENHKFCYFETSAQTGDGIPEVFQTLFTGVVKALENGGKPVL-IDTALTLGYSKEQAEVIQRLKNAKDHYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAFKALVAARASLLQ 267          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Nematostella
Match: EDO42495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E6])

HSP 1 Score: 111.694 bits (278), Expect = 4.399e-29
Identity = 63/175 (36.00%), Postives = 92/175 (52.57%), Query Frame = 3
Query:  108 ENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            EN     +KI+ +G  GVGKS L+ R+ +  F     ATIG+D+ V  L+ +  + K+ I+D AG   F  +   +Y+  QG ILVYD   R +FD L  WL E++   +  D    I  ++  NKIDK  R VD  +G  ++     ++ E SA + E V   FE L + II T
Sbjct:    2 ENDVLTTLKILIVGESGVGKSSLLLRFTDDTFDPDIGATIGVDFKVKTLTVEGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDTNSRETFDKLEEWLNEVEMYSTKKD----IVKMLVGNKIDKNNREVDRKQGLQFARRHSMLFIEASARTKEGVQLAFEELVEKIIQT 172          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 111.309 bits (277), Expect = 7.178e-29
Identity = 61/186 (32.80%), Postives = 103/186 (55.38%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIG 686
            K I +G+ GVGKSCL+ ++ +KRF   +  TIG+++G   ++   K++K+ I+D AG   F  +   +Y+   GA+LVYD+T R +F+ L  WL++ +   SS      +  ++  NK D +A+R V   EG+ ++     I+ ETSA +  NV   F +    I   +  G   I N ++ +K+G
Sbjct:    8 KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSS-----NMVIMLIGNKSDLEARRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEIYQKIQEGVFDINNEANGIKLG 188          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 110.153 bits (274), Expect = 1.416e-28
Identity = 62/186 (33.33%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIP-NPSSTLKI 683
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  + ++ NK+   +  NK D   ++ VD    K +++S    + ETSA +  NV   F ++   I + +  G  P P    S +KI
Sbjct:   13 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYACENVNKL---LVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRM--GPSPAPQGAGSNVKI 191          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 104.375 bits (259), Expect = 1.315e-26
Identity = 57/179 (31.84%), Postives = 101/179 (56.42%), Query Frame = 3
Query:  102 MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKA-QRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTL 635
            M      L  K++ +G+ GVGK+C+I R+ +  F   +++TIGID+ +  L    K++K+ I+D AG   F+ +   +Y+   G +LVYDVT+  SF ++++WL++I     + +D  ++   +  NK D   +R +   +G+  + S    + ETSALSN NV   F  L + I++ +
Sbjct:    1 MANKKSDLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDH--ANEDVKRM---LVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDILNAV 174          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Medaka
Match: dnajc27 (DnaJ heat shock protein family (Hsp40) member C27 [Source:NCBI gene;Acc:101174982])

HSP 1 Score: 321.627 bits (823), Expect = 3.447e-109
Identity = 147/266 (55.26%), Postives = 202/266 (75.94%), Query Frame = 3
Query:  105 KENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLST-GKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLK 896
            + + K LR+K+IS+GN  VGKSC+IKRYCEKRF+ KYLATIGIDYGVTK+  +++E+K+NIFDMAGH FFYEVRNEFYKD+QG +LVYDV  R SF+ L+ WL E+K E+ S  + + I F+VCANK+D   +R VD  EG++W++S+ F YFETSA S E +  +F++ F  I       GKRP+    S + +G+ +EQ   I++++N+K  ++ LGV PGAT+E++N++YRKLAV+LHPDK +APGS++AFK +V ART LLK
Sbjct:    8 RRDKKSLRVKVISLGNAEVGKSCIIKRYCEKRFVPKYLATIGIDYGVTKVQVRDREIKVNIFDMAGHPFFYEVRNEFYKDSQGVLLVYDVGVRESFEALDSWLGEMKQEMGSQANMDSIVFIVCANKVDLTKRRVVDEGEGRLWAESRGFHYFETSAQSGEGINEMFQAFFSSITDMCENGGKRPV----SEVSVGFTKEQADTIRRIRNSKDSWDMLGVKPGATREEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTSLLK 269          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Medaka
Match: rab4a (RAB4A, member RAS oncogene family [Source:NCBI gene;Acc:101158840])

HSP 1 Score: 116.316 bits (290), Expect = 2.520e-30
Identity = 65/202 (32.18%), Postives = 110/202 (54.46%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAK 734
            K + +GN G GKSCL+ ++ EKRF ++   TIG+++G   +S  NK +K+ I+D AG   F  V   +Y+   GA+LVYD+T R +++ L  WL + +   S       I  ++C NK D  A R V  +E   ++   + ++ ETSAL+ ENV   F      I++ + +G+       S ++ G      AA+++L++ +
Sbjct:   10 KFLVIGNAGTGKSCLLHQFIEKRFKDESNHTIGVEFGSKIISVVNKMVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTTWLSDARMLAS-----QNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGD-----AALRQLRSPR 201          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Medaka
Match: rab1aa (ras-related protein Rab-1A [Source:NCBI gene;Acc:101162421])

HSP 1 Score: 112.464 bits (280), Expect = 4.985e-29
Identity = 62/185 (33.51%), Postives = 104/185 (56.22%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQR-TVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKI 683
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  ++++ NK+   +  NK D   R  VD    K ++D+    + ETSA S  NV   F ++   I   +  G        S +KI
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTRKVVDYTTAKEFADNLGIPFLETSAKSATNVEQAFMTMAAEIKKRMGPGATAGAAEKSNVKI 189          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Medaka
Match: rab18b (ras-related protein Rab-18-B [Source:NCBI gene;Acc:101171031])

HSP 1 Score: 111.694 bits (278), Expect = 1.097e-28
Identity = 61/168 (36.31%), Postives = 93/168 (55.36%), Query Frame = 3
Query:  129 IKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIIST 632
            +K++ +G  GVGKS L+ R+ E  F  +  ATIG+D+ V  L+ +  + K+ I+D AG   F  +   +Y+  QG ILVYDV+ R SF  L  WL E+++  +     N I  ++  NKIDK  R VD  EG  ++     ++ E SA + + V   FE L + I+ T
Sbjct:    9 LKLLIIGESGVGKSSLLLRFTEDTFDPEQSATIGVDFKVKTLAIEGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVSRRDSFTKLENWLNELETYTTR----NDIVKMLVGNKIDKDDREVDRNEGLKFARKHSMLFIEASAKTKDGVQCAFEELVEKILQT 172          
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Medaka
Match: rab1ab (ras-related protein ORAB-1 [Source:NCBI gene;Acc:101161080])

HSP 1 Score: 111.309 bits (277), Expect = 1.413e-28
Identity = 56/161 (34.78%), Postives = 98/161 (60.87%), Query Frame = 3
Query:  132 KIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKID-KAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESL 611
            K++ +G+ GVGKSCL+ R+ +  + E Y++TIG+D+ +  +    K +K+ I+D AG   F  + + +Y+   G I+VYDVTD+ SF+++ +WLQEI  +  ++++ NK+   +  NK D   ++ VD    K ++DS    + ETSA +  NV   F ++
Sbjct:   10 KLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEI--DRYASENVNKL---LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQAFMTM 165          
BLAST of DnaJ-like subfamily C member 27 vs. Planmine SMEST
Match: SMESG000071551.1 (SMESG000071551.1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 268/270 (99.26%), Postives = 268/270 (99.26%), Query Frame = 3
Query:   99 MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ 908
            MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDD NRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSST KIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ
Sbjct:    1 MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDFNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTPKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ 270          
BLAST of DnaJ-like subfamily C member 27 vs. Planmine SMEST
Match: SMESG000071551.1 (SMESG000071551.1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 267/269 (99.26%), Postives = 267/269 (99.26%), Query Frame = 3
Query:  102 MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ 908
            MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDD NRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSST KIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ
Sbjct:    1 MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDFNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTPKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ 269          
BLAST of DnaJ-like subfamily C member 27 vs. Planmine SMEST
Match: SMESG000071551.1 (SMESG000071551.1)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 255/258 (98.84%), Postives = 255/258 (98.84%), Query Frame = 3
Query:   99 MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLV 872
            MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDD NRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSST KIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLL 
Sbjct:    1 MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDFNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTPKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLA 258          
BLAST of DnaJ-like subfamily C member 27 vs. Planmine SMEST
Match: SMESG000071551.1 (SMESG000071551.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 254/257 (98.83%), Postives = 254/257 (98.83%), Query Frame = 3
Query:  102 MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLV 872
            MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDD NRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSST KIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLL 
Sbjct:    1 MKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDFNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTPKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLA 257          
BLAST of DnaJ-like subfamily C member 27 vs. Planmine SMEST
Match: SMESG000071551.1 (SMESG000071551.1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 253/255 (99.22%), Postives = 253/255 (99.22%), Query Frame = 3
Query:  144 MGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDLNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ 908
            MGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDD NRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSST KIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ
Sbjct:    1 MGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVTKLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDDFNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQFIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTPKIGYNREQIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGSDEAFKLLVTARTDLLKIAPQ 255          
The following BLAST results are available for this feature:
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC272.609e-10956.77DnaJ heat shock protein family (Hsp40) member C27 ... [more]
DNAJC277.025e-7462.72DnaJ heat shock protein family (Hsp40) member C27 ... [more]
DNAJC272.980e-3372.97DnaJ heat shock protein family (Hsp40) member C27 ... [more]
AL358472.69.350e-2934.57novel protein[more]
RAB139.350e-2934.57RAB13, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-182.943e-3237.43Ras-related protein Rab-18 [Source:UniProtKB/Swis... [more]
rab-182.943e-3237.43Ras-related protein Rab-18 [Source:UniProtKB/Swis... [more]
rab-352.708e-2833.70RAB family [Source:UniProtKB/TrEMBL;Acc:Q9U2C3][more]
rab-15.522e-2830.41RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
unc-1081.165e-2731.72pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab186.344e-2834.38gene:FBgn0015794 transcript:FBtr0070849[more]
Rab21.039e-2731.72gene:FBgn0014009 transcript:FBtr0336658[more]
Rab21.039e-2731.72gene:FBgn0014009 transcript:FBtr0086124[more]
Rab14.642e-2632.92gene:FBgn0285937 transcript:FBtr0084104[more]
Rab197.408e-2633.13gene:FBgn0015793 transcript:FBtr0331832[more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc272.224e-11257.89DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
dnajc272.480e-11257.89DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
rab131.218e-2934.83RAB13, member RAS oncogene family [Source:NCBI gen... [more]
rab4a1.368e-2932.18RAB4a, member RAS oncogene family [Source:NCBI gen... [more]
rab1aa1.851e-2935.40RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2a6.134.494e-7451.63cytochrome P450 family 2 subfamily A member 6 gene... [more]
thsd11.042e-2836.90thrombospondin type 1 domain containing 1 [Source:... [more]
thsd11.209e-2836.90thrombospondin type 1 domain containing 1 [Source:... [more]
RAB2A2.249e-2832.80RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
rab212.272e-2832.09RAB21, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc271.641e-10956.39DnaJ heat shock protein family (Hsp40) member C27 ... [more]
Dnajc271.641e-10956.39DnaJ heat shock protein family (Hsp40) member C27 ... [more]
Dnajc271.641e-10956.39DnaJ heat shock protein family (Hsp40) member C27 ... [more]
Rab132.029e-2935.14RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a1.702e-2832.97RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IMM1|DJC27_CHICK3.611e-11257.36DnaJ homolog subfamily C member 27 OS=Gallus gallu... [more]
sp|Q6IMK3|DJC27_DANRE1.679e-11157.89DnaJ homolog subfamily C member 27 OS=Danio rerio ... [more]
sp|Q5M7D1|DJ27B_XENLA1.682e-11057.25DnaJ homolog subfamily C member 27-B OS=Xenopus la... [more]
sp|Q7ZYF1|DJ27A_XENLA1.687e-10956.77DnaJ homolog subfamily C member 27-A OS=Xenopus la... [more]
sp|Q8CFP6|DJC27_MOUSE1.148e-10856.39DnaJ homolog subfamily C member 27 OS=Mus musculus... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433UCY76.531e-11861.89J domain-containing protein OS=Elysia chlorotica O... [more]
A7RXC64.850e-11759.33Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A1S3JTI44.513e-11660.77dnaJ homolog subfamily C member 27-like OS=Lingula... [more]
V4AHB31.081e-11561.48J domain-containing protein OS=Lottia gigantea OX=... [more]
K1PD241.518e-11559.02DnaJ-like protein subfamily C member 27 OS=Crassos... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc279.342e-11157.14DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
rab131.644e-2935.39RAB13, member RAS oncogene family [Source:NCBI gen... [more]
rab1ab5.174e-2932.97ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
rab4a1.526e-2831.68RAB4A, member RAS oncogene family [Source:NCBI gen... [more]
rab1ba3.753e-2834.16zRAB1B, member RAS oncogene family a [Source:ZFIN;... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc276.701e-10954.07DnaJ (Hsp40) homolog, subfamily C, member 27 [Sour... [more]
rab1aa4.761e-3032.97RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab18b4.126e-2935.71RAB18B, member RAS oncogene family [Source:NCBI ge... [more]
rab2a2.314e-2831.72RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB2B5.567e-2831.18RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT15.048e-2934.12Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT311.622e-2732.61Rab family GTPase; involved in the exocytic pathwa... [more]
SEC48.261e-2632.92Rab family GTPase; essential for vesicle-mediated ... [more]
YPT324.627e-2532.94Rab family GTPase involved in the exocytic pathway... [more]
VPS212.357e-2230.95Endosomal Rab family GTPase; required for endocyti... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO440056.707e-12159.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424954.399e-2936.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366877.178e-2932.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401671.416e-2833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408451.315e-2631.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc273.447e-10955.26DnaJ heat shock protein family (Hsp40) member C27 ... [more]
rab4a2.520e-3032.18RAB4A, member RAS oncogene family [Source:NCBI gen... [more]
rab1aa4.985e-2933.51ras-related protein Rab-1A [Source:NCBI gene;Acc:1... [more]
rab18b1.097e-2836.31ras-related protein Rab-18-B [Source:NCBI gene;Acc... [more]
rab1ab1.413e-2834.78ras-related protein ORAB-1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DnaJ-like subfamily C member 27 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071551.10.000e+099.26SMESG000071551.1[more]
SMESG000071551.10.000e+099.26SMESG000071551.1[more]
SMESG000071551.10.000e+098.84SMESG000071551.1[more]
SMESG000071551.10.000e+098.83SMESG000071551.1[more]
SMESG000071551.10.000e+099.22SMESG000071551.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035194 ID=SMED30035194|Name=DnaJ-like subfamily C member 27|organism=Schmidtea mediterranea sexual|type=transcript|length=1153bp
TTGCTAGTAAAACTATATCCAAGCGAGAATTTAAATGTATTTTTAAAGCA
AAATGAAATGTTAAGTATTTTTGTAAATTGAACACCTGTGCGCTATTTAT
GATGAAAGAAAATTCAAAACCTTTAAGAATTAAAATTATTAGTATGGGAA
ATCCTGGAGTAGGAAAGAGCTGTCTCATAAAACGCTATTGTGAAAAACGT
TTTATTGAGAAATATTTAGCAACTATTGGCATTGATTATGGAGTTACTAA
ATTAAGTTTTAAAAACAAAGAATTAAAAATTAATATTTTTGATATGGCTG
GCCATTCGTTTTTTTACGAGGTGAGAAATGAATTTTATAAAGACACTCAA
GGTGCAATTCTTGTGTACGACGTGACAGACAGATCAAGCTTTGATGATCT
CAATCGATGGCTACAAGAAATCAAAAGTGAACTATCAAGTGCTGATGATT
TCAATAAAATAACTTTCGTAGTTTGTGCTAATAAGATAGACAAAGCCCAA
AGGACTGTGGATAGCATGGAAGGAAAGATGTGGAGTGACTCTCAGCAATT
CATCTATTTCGAGACTTCTGCATTGTCAAATGAAAATGTTTTGAACATTT
TTGAGTCTCTGTTCGATGGAATTATCAGTACTCTATCTACAGGGAAACGT
CCTATACCTAACCCTTCGTCGACTCTAAAGATTGGTTATAATCGGGAACA
AATTGCAGCGATTCAGAAACTGAAAAATGCCAAAACCCATTATGAGAGAC
TCGGTGTATCCCCTGGAGCAACAAAAGAAGACATCAACCGCTCGTATAGA
AAACTCGCAGTGATATTGCATCCGGATAAAAATATAGCACCGGGTAGTGA
CGAAGCCTTCAAATTACTCGTAACAGCTCGCACAGATTTACTCAAAATTG
CTCCGCAATAGTCAAAAAACATTTTGCCATCATCTTCCGATCAAATACCG
CTCACTTGTCTCGGAGAATTCAGCGAATAATTACGTATAAAATATTGCAT
ATCAATTTACCGTAGTCTCAGTAATCCCAGTTGATGATATCGAAATATTT
TTTTTTGTTTATAATTCTCCTATATTTCACAGGTGGAAATAGAATTGGAA
TATTTATGCCATATAATACGTAATTTTCATTAGTTATTTTTCACGGATCC
AAC
back to top

protein sequence of SMED30035194-orf-1

>SMED30035194-orf-1 ID=SMED30035194-orf-1|Name=SMED30035194-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MMKENSKPLRIKIISMGNPGVGKSCLIKRYCEKRFIEKYLATIGIDYGVT
KLSFKNKELKINIFDMAGHSFFYEVRNEFYKDTQGAILVYDVTDRSSFDD
LNRWLQEIKSELSSADDFNKITFVVCANKIDKAQRTVDSMEGKMWSDSQQ
FIYFETSALSNENVLNIFESLFDGIISTLSTGKRPIPNPSSTLKIGYNRE
QIAAIQKLKNAKTHYERLGVSPGATKEDINRSYRKLAVILHPDKNIAPGS
DEAFKLLVTARTDLLKIAPQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR005225Small_GTP-bd_dom
IPR001623DnaJ_domain
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 215..233
score: 43.27
coord: 233..248
score: 53.01
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 212..269
e-value: 9.2E-13
score: 58.4
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 213..261
e-value: 1.6E-12
score: 47.4
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 213..270
score: 11.366
IPR001623DnaJ domainCDDcd06257DnaJcoord: 213..260
e-value: 3.81096E-14
score: 63.3333
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 52..74
score: 23.6
coord: 34..50
score: 31.4
coord: 153..175
score: 36.27
coord: 11..32
score: 39.31
coord: 119..132
score: 26.94
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 11..178
e-value: 2.9E-33
score: 126.5
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 16..229
e-value: 1.2E-4
score: 17.2
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 13..178
e-value: 2.2E-6
score: -36.2
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 12..178
e-value: 2.3E-12
score: 56.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..184
e-value: 1.6E-51
score: 176.3
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 9..179
NoneNo IPR availablePANTHERPTHR24073:SF269DNAJ HOMOLOG SUBFAMILY C MEMBER 27coord: 9..179
NoneNo IPR availablePROSITEPS51419RABcoord: 3..230
score: 23.843
NoneNo IPR availableCDDcd04119RJLcoord: 11..177
e-value: 7.92654E-86
score: 251.506
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 189..268
e-value: 1.5E-19
score: 71.7
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 196..264
IPR001806Small GTPasePFAMPF00071Rascoord: 12..174
e-value: 1.7E-41
score: 141.5
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 11..170
e-value: 1.6E-24
score: 84.5
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 7..191