Chromosome 8 open reading frame 37

Overview
NameChromosome 8 open reading frame 37
Smed IDSMED30035183
Length (bp)712
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromosome 8 open reading frame 37 (SMED30035183) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromosome 8 open reading frame 37 (SMED30035183) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromosome 8 open reading frame 37 (SMED30035183) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromosome 8 open reading frame 37 (SMED30035183) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035183

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035183SMESG000035388.1 SmedASXL_003330SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035183SMESG000035388.1 dd_Smed_v4_8015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035183SMESG000035388.1 dd_Smed_v4_8015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30035183SMESG000035388.1 dd_Smed_v4_8015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035183SMESG000035388.1 dd_Smed_v6_8015_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035183SMESG000035388.1 dd_Smed_v4_8015_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Human
Match: C8orf37 (chromosome 8 open reading frame 37 [Source:HGNC Symbol;Acc:HGNC:27232])

HSP 1 Score: 91.2781 bits (225), Expect = 4.812e-22
Identity = 64/214 (29.91%), Postives = 103/214 (48.13%), Query Frame = 2
Query:   71 MADDIDSLLNDADA------FIRKEVKKENRQIQDFKNAS--------------LDLRRQSSIDRDIDEILDCELIYNEKPN------SIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MA+D+D LL++ ++       +R+ + ++ +      ++S                 +++  +D  I+EIL       E+PN       +K     +     +I    KSC P+++       GIG++++ RACD LRC  CD  V+      W+   DYLF RNN PE  KL+ KL K+  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:    1 MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEIL-------EEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH 207          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Xenopus
Match: C8orf37 (chromosome 8 open reading frame 37 [Source:NCBI gene;Acc:100489713])

HSP 1 Score: 114.005 bits (284), Expect = 8.616e-31
Identity = 56/147 (38.10%), Postives = 85/147 (57.82%), Query Frame = 2
Query:  194 SIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            S+D  I++ILD  +  ++K  + K    N     ++     K C P++++      GIG+S++ RACD LRCT CD +V+   +  W+   DYLF RN+ P+++KL  KL ++  ++AY CQC   S QE   +T  P L WVCGKH
Sbjct:   53 SLDDLIEDILD--ISCHDKNTTQKPRPQNQPACRSSYQMHSKKCGPVYVAGSSVPFGIGTSISERACDQLRCTACDFNVMVFDNSQWDASCDYLFFRNSMPDLSKLRPKLIRKKGARAYACQCSWRSVQELTNITVYPQLRWVCGKH 197          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Mouse
Match: 2610301B20Rik (RIKEN cDNA 2610301B20 gene [Source:MGI Symbol;Acc:MGI:1914407])

HSP 1 Score: 100.138 bits (248), Expect = 1.922e-25
Identity = 55/159 (34.59%), Postives = 83/159 (52.20%), Query Frame = 2
Query:  179 LRRQSSIDRDIDEILDCELIYNEKPNSIKEN--KFNHIKKENT-----ISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
             +++  +D  I+EI        E+P+  +++  KF      NT     +    KSC P+++S      GIG++ + RACD LRC  CD  ++      W+   DYLF RNN PE  KL+ KL ++  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:   58 FKKEDDLDSLINEIF-------EEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQTDHQLRWVCGKH 209          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Mouse
Match: 2610301B20Rik (RIKEN cDNA 2610301B20 gene [Source:MGI Symbol;Acc:MGI:1914407])

HSP 1 Score: 95.5153 bits (236), Expect = 1.047e-23
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 2
Query:  179 LRRQSSIDRDIDEILDCELIYNEKPNSIKEN--KFNHIKKENT-----ISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFL-RNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
             +++  +D  I+EI        E+P+  +++  KF      NT     +    KSC P+++S      GIG++ + RACD LRC  CD  ++      W+   DYLF  RNN PE  KL+ KL ++  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:   58 FKKEDDLDSLINEIF-------EEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFSRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQTDHQLRWVCGKH 210          
BLAST of Chromosome 8 open reading frame 37 vs. UniProt/SwissProt
Match: sp|P0DOC8|CH037_DANRE (Protein C8orf37 homolog OS=Danio rerio OX=7955 GN=dkey-242e21.4 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.830e-26
Identity = 57/146 (39.04%), Postives = 78/146 (53.42%), Query Frame = 2
Query:  197 IDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            ID  + EILD ++   + P S  E   +  K  ++  +  K C P+F+       GIG+SV+ RAC+ LRCT CD SV+      W++  DYLF RNN P+  KL+  L ++   +AY CQC   S      L   P L WVCGKH
Sbjct:   60 IDAMLHEILDDDV---DTPTSTHEP--SPAKASSSAQTISKKCCPVFLGGSSVAHGIGTSVSERACNRLRCTYCDFSVITFDDHEWDSSCDYLFFRNNMPDYHKLKVHLRRRAGVRAYACQCSWISILTLSHLREQPQLKWVCGKH 200          
BLAST of Chromosome 8 open reading frame 37 vs. UniProt/SwissProt
Match: sp|Q3UJP5|CH037_MOUSE (Protein C8orf37 homolog OS=Mus musculus OX=10090 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.345e-24
Identity = 55/159 (34.59%), Postives = 83/159 (52.20%), Query Frame = 2
Query:  179 LRRQSSIDRDIDEILDCELIYNEKPNSIKEN--KFNHIKKENT-----ISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
             +++  +D  I+EI        E+P+  +++  KF      NT     +    KSC P+++S      GIG++ + RACD LRC  CD  ++      W+   DYLF RNN PE  KL+ KL ++  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:   58 FKKEDDLDSLINEIF-------EEPDFDRKSFQKFKSKSSSNTCVRAPMQGVSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFRIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQTDHQLRWVCGKH 209          
BLAST of Chromosome 8 open reading frame 37 vs. UniProt/SwissProt
Match: sp|Q6AY71|CH037_RAT (Protein C8orf37 homolog OS=Rattus norvegicus OX=10116 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.436e-24
Identity = 46/111 (41.44%), Postives = 63/111 (56.76%), Query Frame = 2
Query:  302 ISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            I    KSC P+++S      GIG++ + RACD LRC  CD  ++      W+   DYLF RNN PE  KL+ KL ++  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:  100 IQGLSKSCSPVYLSGSAIPCGIGTNTSQRACDRLRCVACDFQIVSYNDYMWDKSCDYLFFRNNMPEFHKLKTKLIEKKGARAYACQCSWRTVEELTDLQADHELRWVCGKH 210          
BLAST of Chromosome 8 open reading frame 37 vs. UniProt/SwissProt
Match: sp|E1BC52|CH037_BOVIN (Protein C8orf37 homolog OS=Bos taurus OX=9913 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.890e-24
Identity = 61/172 (35.47%), Postives = 88/172 (51.16%), Query Frame = 2
Query:  119 RKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            R E K+  R  + F+       ++  +D  I+EI + E  +++K   +K     +     +I    KSC P++I       GIG++ + RACD LRCT CD  V       W+   DYLF RNN PE  KL+ KL K+  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:   44 RAEAKENLRSAETFE-------KEDDLDSLINEIFE-EPHFDKKHFKLKSKSSGNTSVRASIQGLGKSCSPVYIGGSTVPCGIGTNASPRACDHLRCTACDFWVESYDDYRWDKSCDYLFFRNNMPEFHKLKTKLVKKKGTRAYACQCSWKAVEELTDLQTDHQLRWVCGKH 207          
BLAST of Chromosome 8 open reading frame 37 vs. UniProt/SwissProt
Match: sp|Q96NL8|CH037_HUMAN (Protein C8orf37 OS=Homo sapiens OX=9606 GN=C8orf37 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.311e-21
Identity = 64/214 (29.91%), Postives = 103/214 (48.13%), Query Frame = 2
Query:   71 MADDIDSLLNDADA------FIRKEVKKENRQIQDFKNAS--------------LDLRRQSSIDRDIDEILDCELIYNEKPN------SIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MA+D+D LL++ ++       +R+ + ++ +      ++S                 +++  +D  I+EIL       E+PN       +K     +     +I    KSC P+++       GIG++++ RACD LRC  CD  V+      W+   DYLF RNN PE  KL+ KL K+  ++AY CQC   + +E  +L     L WVCGKH
Sbjct:    1 MAEDLDELLDEVESKFCTPDLLRRGMVEQPKGCGGGTHSSDRNQAKAKETLRSTETFKKEDDLDSLINEIL-------EEPNLDKKPSKLKSKSSGNTSVRASIEGLGKSCSPVYLGGSSIPCGIGTNISWRACDHLRCIACDFLVVSYDDYMWDKSCDYLFFRNNMPEFHKLKAKLIKKKGTRAYACQCSWRTIEEVTDLQTDHQLRWVCGKH 207          
BLAST of Chromosome 8 open reading frame 37 vs. TrEMBL
Match: A0A1S3J1B3 (protein C8orf37 homolog OS=Lingula unguis OX=7574 GN=LOC106169202 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 9.919e-33
Identity = 66/191 (34.55%), Postives = 109/191 (57.07%), Query Frame = 2
Query:   71 MADDIDSLLNDADA-FIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILD--CELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MADDID LL++ ++ FI    +K+ ++I + K +    R +   D D+D+++   C++     P  +  +K      E  ++S +K C+P+++ N    +G+ S++  R+CD LRCTDCD  ++   +  W    DYLFLRNN P+  KL+K+LD +   +AY CQCK  +  E  ++     L WVCG+H
Sbjct:    1 MADDIDDLLDEVESKFIASSPRKDAKKITNVKVSKPPARPRKPGDEDLDDMISDICDV-----PEPL--DKLETGPVERVVTSAQKRCYPVYLGNSTCAQGMASTMNKRSCDKLRCTDCDFKIVTFDNFQWAASTDYLFLRNNVPDFKKLQKQLDPKNGMRAYACQCKWRNVSEVKDVKTDQDLKWVCGRH 184          
BLAST of Chromosome 8 open reading frame 37 vs. TrEMBL
Match: A0A3Q3MS94 (Uncharacterized protein OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.800e-31
Identity = 66/194 (34.02%), Postives = 101/194 (52.06%), Query Frame = 2
Query:   74 ADDIDSLLNDADAFIRKEV-------KKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
             DD+D LL++ +    + V        K++ Q Q+ + ++   +  SS   DID  L+ EL+ ++ P    E K   ++K+    +  + C P+F+       G+G++ + R+CD LRC  CD  VL      W++  DYLF RNN P+  KL  KL +    +AY CQC  +SC EP +L     L WVCGKH
Sbjct:    4 GDDLDRLLDEVEEKFCRGVSVAAPARGKDDGQKQN-RFSTKSGQNSSSAADDIDAFLE-ELLEDDAPELKTETKGPQVEKKLPCHTGGRRCFPVFVGGSFMTNGVGTATSKRSCDQLRCISCDFRVLMFDDCEWDSSCDYLFFRNNVPDRQKLRAKLKRSRGVRAYACQCSWFSCSEPTDLQDQAQLRWVCGKH 195          
BLAST of Chromosome 8 open reading frame 37 vs. TrEMBL
Match: A0A218V7C2 (Protein C8orf37 OS=Lonchura striata domestica OX=299123 GN=CH037 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.352e-30
Identity = 64/193 (33.16%), Postives = 100/193 (51.81%), Query Frame = 2
Query:   71 MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILD---CELIYNEKPNSIKENKFNHIKKENT--ISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MADD+D LL++ +  +      E         ++  L    S + D+D+I+D    +  + + P  ++ N  N   + N+  + +  K C P+++   L+  GIG++++ R CD LRCT CD  V       W+   DYLF RNN PE++KL  K+ K+  ++AY CQC   S  E  +L     L WVCGKH
Sbjct:    1 MADDLDGLLDEVERRLWHRHGGEEGPAAARGRSAKVLLSAGSSEEDLDDIIDEICSDSSFAKTPPKLQSNSANLTPERNSGVVQAHGKRCCPVYLGGSLSPSGIGTNISKRTCDQLRCTACDFRVSLFNDYVWDQSCDYLFFRNNMPELSKLRAKMIKKKGARAYACQCSWRSIDELTDLQTEQQLRWVCGKH 193          
BLAST of Chromosome 8 open reading frame 37 vs. TrEMBL
Match: C3YFQ9 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_270207 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.852e-30
Identity = 69/196 (35.20%), Postives = 108/196 (55.10%), Query Frame = 2
Query:   71 MADDIDSLLNDADA-FIRKE-----VKKENRQIQDFKNASLDLRRQSSIDRDIDEILD--CELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MADDID LL++ +  F+ K+     V K+ +      N ++  R++S+ D D+D ++D  CE     +P   K    N  +     +  K+ C  +++       G+GSS+  R+CD LRCTDCD  V+   +  W+   +YLF RNN P+  KL+ KL+K+  S+AY CQCK  S Q+ +++ +     WVCGKH
Sbjct:    1 MADDIDDLLDEVETKFLEKKEKSGGVAKKAKTPVSKTNPNVPSRKKSTGDADLDAMIDDICEAPEPLEPLVDKAPAQNSPRTPRG-AEGKRRCAVLYLGGSKHAMGLGSSMNQRSCDQLRCTDCDFRVVFYDNYEWDASCEYLFFRNNVPDFGKLKAKLNKRKGSRAYACQCKWTSVQDLVDIQKKTDFKWVCGKH 195          
BLAST of Chromosome 8 open reading frame 37 vs. TrEMBL
Match: A0A096MGD0 (Chromosome 8 open reading frame 37 OS=Poecilia formosa OX=48698 GN=C8orf37 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.602e-29
Identity = 62/154 (40.26%), Postives = 86/154 (55.84%), Query Frame = 2
Query:  188 QSSIDRDIDEILDCELI---YNEKPNSIKE--NKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            +SS+  DID +L+ EL+   Y+  P S  E  +K    +K+ +  S  + C P+FI       G+G++ + R+CD LRC  CD  VL      W+   DYLFLRNN P+  KL+ KL K+   +AY CQC  +S  E  +L   P L WVCGKH
Sbjct:   49 KSSVSEDIDALLE-ELLEDDYDSSPQSKGEQFSKREQAEKKLSSQSAGRKCCPVFIGGSSVTNGVGTATSKRSCDQLRCNSCDFRVLMFDDSEWDPSCDYLFLRNNVPDRHKLQAKLKKRKGLRAYACQCNWFSSSETTDLRNQPQLRWVCGKH 201          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Cavefish
Match: C8orf37 (chromosome 11 C8orf37 homolog [Source:NCBI gene;Acc:103027925])

HSP 1 Score: 115.931 bits (289), Expect = 1.216e-31
Identity = 71/206 (34.47%), Postives = 109/206 (52.91%), Query Frame = 2
Query:   71 MADDIDSLLNDAD-AFIRK-----------EVKKENRQIQDFKNA-SLDLRRQSSIDRDID----EILDCELIYNEKPNS-IKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MAD++D LL++ +  F R            ++K EN +++  + + S  +R+  +   DI+    EILD +   ++  +S I     +H K     ++ KK C P+F+   L   G+G+S++ RACD LRCT CD  +       W++  DYLF RNN P+  KL  KL ++  ++AY CQC  YS     EL   P L WVCG+H
Sbjct:    1 MADNLDDLLDEVEEKFCRNASVSARPAREIKLKPENFRVRRSEESLSSPVRKHEAYGDDIEAVLQEILDNDDDDDQTGSSDIPATVRSHAKDSCPQTASKKCC-PVFLGGSLVTSGVGTSISQRACDQLRCTACDFGIAMFNDHEWDSSCDYLFFRNNMPDRTKLRAKLKRRQGARAYACQCSWYSANSLSELRHNPQLKWVCGQH 205          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008238.1 (pep scaffold:Pmarinus_7.0:GL482562:9141:16193:1 gene:ENSPMAG00000007454.1 transcript:ENSPMAT00000008238.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 1.860e-24
Identity = 42/104 (40.38%), Postives = 62/104 (59.62%), Query Frame = 2
Query:  323 CHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            C P+++       G+G++++ RACD L CT CD  V+   +  W++  DYLF RNN P++ KL  +L ++  ++AY CQC   S QEP E     +L WVC KH
Sbjct:    1 CCPVYLGGSKLPCGLGTTISCRACDRLHCTVCDFRVVTFDNMEWHHSCDYLFFRNNMPDVEKLRARLVRRLGTRAYACQCSWRSVQEPTEPGS--NLRWVCSKH 102          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Nematostella
Match: EDO49219 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHF6])

HSP 1 Score: 88.9669 bits (219), Expect = 7.146e-22
Identity = 41/111 (36.94%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  302 ISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            +++ K  C  + +      +G+ +    R CD LRCT CD  V+   + +W+ D DYLF RNN P+  KL+ KL  +  ++AY CQC   S  + ++L    +L WVCGKH
Sbjct:   84 LTAHKSKCFTLLLGGTRFSKGLCTVSEQRTCDKLRCTSCDFKVVVFDNYAWDGDCDYLFFRNNVPDFHKLKVKLKTRKGTRAYACQCCWRSIVDLMDLQTDATLKWVCGKH 194          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Medaka
Match: ENSORLT00000041138.1 (chromosome 16 C8orf37 homolog [Source:NCBI gene;Acc:101160691])

HSP 1 Score: 104.76 bits (260), Expect = 2.164e-27
Identity = 61/155 (39.35%), Postives = 88/155 (56.77%), Query Frame = 2
Query:  188 QSSIDRDIDEILDCELIYNE---KPNS-IKENKFNHIKKENTISS--DKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            +S I  DID +L+ EL+ ++    P S  ++N+    + EN +S    ++ C P+F+       G+G++ + R+CD LRC  CD  V+      W+   DYLFLRNN P+  KL KKL K+   +AY CQC  +S  EP +L   P L WVCGKH
Sbjct:   56 ESDISEDIDALLE-ELLEDKDTYSPQSKSQQNRPKETQVENKLSFQIGRRKCCPVFVGGSSVTNGVGTATSKRSCDQLRCVSCDFRVVMFDDCEWDQSCDYLFLRNNMPDCQKLRKKLKKKRGQRAYACQCSWFSASEPADLRDQPQLRWVCGKH 209          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Medaka
Match: ENSORLT00000045435.1 (chromosome 16 C8orf37 homolog [Source:NCBI gene;Acc:101160691])

HSP 1 Score: 104.375 bits (259), Expect = 4.770e-27
Identity = 61/156 (39.10%), Postives = 88/156 (56.41%), Query Frame = 2
Query:  188 QSSIDRDIDEILDCELI-----YNEKPNSIKENKFNHIKKENTISS--DKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            +S I  DID +L+ EL+     Y+ +  S ++N+    + EN +S    ++ C P+F+       G+G++ + R+CD LRC  CD  V+      W+   DYLFLRNN P+  KL KKL K+   +AY CQC  +S  EP +L   P L WVCGKH
Sbjct:   63 ESDISEDIDALLE-ELLEDKDTYSPQSKS-QQNRPKETQVENKLSFQIGRRKCCPVFVGGSSVTNGVGTATSKRSCDQLRCVSCDFRVVMFDDCEWDQSCDYLFLRNNMPDCQKLRKKLKKKRGQRAYACQCSWFSASEPADLRDQPQLRWVCGKH 216          
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Medaka
Match: ENSORLT00000019319.2 (chromosome 16 C8orf37 homolog [Source:NCBI gene;Acc:101160691])

HSP 1 Score: 104.375 bits (259), Expect = 4.770e-27
Identity = 61/156 (39.10%), Postives = 88/156 (56.41%), Query Frame = 2
Query:  188 QSSIDRDIDEILDCELI-----YNEKPNSIKENKFNHIKKENTISS--DKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            +S I  DID +L+ EL+     Y+ +  S ++N+    + EN +S    ++ C P+F+       G+G++ + R+CD LRC  CD  V+      W+   DYLFLRNN P+  KL KKL K+   +AY CQC  +S  EP +L   P L WVCGKH
Sbjct:   63 ESDISEDIDALLE-ELLEDKDTYSPQSKS-QQNRPKETQVENKLSFQIGRRKCCPVFVGGSSVTNGVGTATSKRSCDQLRCVSCDFRVVMFDDCEWDQSCDYLFLRNNMPDCQKLRKKLKKKRGQRAYACQCSWFSASEPADLRDQPQLRWVCGKH 216          
BLAST of Chromosome 8 open reading frame 37 vs. Planmine SMEST
Match: SMESG000035388.1 (SMESG000035388.1)

HSP 1 Score: 384.415 bits (986), Expect = 1.080e-137
Identity = 188/188 (100.00%), Postives = 188/188 (100.00%), Query Frame = 2
Query:   71 MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH
Sbjct:    1 MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 188          
BLAST of Chromosome 8 open reading frame 37 vs. Planmine SMEST
Match: SMESG000035388.1 (SMESG000035388.1)

HSP 1 Score: 379.793 bits (974), Expect = 9.121e-136
Identity = 188/190 (98.95%), Postives = 188/190 (98.95%), Query Frame = 2
Query:   71 MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKS--CHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 634
            MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKS  CHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH
Sbjct:    1 MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEILDCELIYNEKPNSIKENKFNHIKKENTISSDKKSFSCHPIFISNCLTEEGIGSSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKKLDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH 190          
The following BLAST results are available for this feature:
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C8orf374.812e-2229.91chromosome 8 open reading frame 37 [Source:HGNC Sy... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C8orf378.616e-3138.10chromosome 8 open reading frame 37 [Source:NCBI ge... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
2610301B20Rik1.922e-2534.59RIKEN cDNA 2610301B20 gene [Source:MGI Symbol;Acc:... [more]
2610301B20Rik1.047e-2334.38RIKEN cDNA 2610301B20 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DOC8|CH037_DANRE1.830e-2639.04Protein C8orf37 homolog OS=Danio rerio OX=7955 GN=... [more]
sp|Q3UJP5|CH037_MOUSE1.345e-2434.59Protein C8orf37 homolog OS=Mus musculus OX=10090 P... [more]
sp|Q6AY71|CH037_RAT1.436e-2441.44Protein C8orf37 homolog OS=Rattus norvegicus OX=10... [more]
sp|E1BC52|CH037_BOVIN7.890e-2435.47Protein C8orf37 homolog OS=Bos taurus OX=9913 PE=1... [more]
sp|Q96NL8|CH037_HUMAN2.311e-2129.91Protein C8orf37 OS=Homo sapiens OX=9606 GN=C8orf37... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J1B39.919e-3334.55protein C8orf37 homolog OS=Lingula unguis OX=7574 ... [more]
A0A3Q3MS943.800e-3134.02Uncharacterized protein OS=Mastacembelus armatus O... [more]
A0A218V7C22.352e-3033.16Protein C8orf37 OS=Lonchura striata domestica OX=2... [more]
C3YFQ92.852e-3035.20Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A096MGD03.602e-2940.26Chromosome 8 open reading frame 37 OS=Poecilia for... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C8orf371.216e-3134.47chromosome 11 C8orf37 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008238.11.860e-2440.38pep scaffold:Pmarinus_7.0:GL482562:9141:16193:1 ge... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO492197.146e-2236.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000041138.12.164e-2739.35chromosome 16 C8orf37 homolog [Source:NCBI gene;Ac... [more]
ENSORLT00000045435.14.770e-2739.10chromosome 16 C8orf37 homolog [Source:NCBI gene;Ac... [more]
ENSORLT00000019319.24.770e-2739.10chromosome 16 C8orf37 homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Chromosome 8 open reading frame 37 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035388.11.080e-137100.00SMESG000035388.1[more]
SMESG000035388.19.121e-13698.95SMESG000035388.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035183 ID=SMED30035183|Name=Chromosome 8 open reading frame 37|organism=Schmidtea mediterranea sexual|type=transcript|length=712bp
GTATTCTTTTTGAAATATTAATTTAATGATTGATTCTAATTTTACTGTTA
AGAGATAATTTCCAAAATTAATGGCAGATGATATCGATTCACTTTTAAAC
GATGCTGATGCATTTATTAGAAAAGAAGTTAAAAAGGAAAATCGACAAAT
CCAAGATTTTAAAAACGCCTCATTGGATTTACGAAGACAATCTAGCATTG
ACAGAGATATTGATGAAATATTGGATTGCGAATTAATTTACAATGAAAAA
CCGAATTCAATTAAAGAAAATAAATTTAATCATATAAAAAAAGAAAATAC
GATTTCAAGTGATAAAAAAAGTTGTCATCCGATTTTCATTTCAAATTGTT
TGACAGAAGAAGGAATAGGAAGTTCGGTCACAGTAAGAGCTTGCGATATG
CTTCGTTGTACAGATTGTGACTCGTCTGTTTTGCAAATCAAACATAGATC
CTGGAACAATGATGTCGATTATTTATTTCTGAGAAATAATTTCCCGGAAA
TAGCCAAACTCGAGAAGAAATTAGATAAACAGACAAATTCAAAAGCATAT
TGCTGCCAGTGCAAATCTTATTCTTGCCAAGAACCGATAGAGTTGACCAG
GCTTCCATCACTGCACTGGGTTTGCGGAAAGCATTAAATGTGGAAACTGC
GTCCGTTTTCCCATTGACGGGAATAGAGAATCTGGTGTAAAATTGATTTT
TATCTGTTTAGT
back to top

protein sequence of SMED30035183-orf-1

>SMED30035183-orf-1 ID=SMED30035183-orf-1|Name=SMED30035183-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MADDIDSLLNDADAFIRKEVKKENRQIQDFKNASLDLRRQSSIDRDIDEI
LDCELIYNEKPNSIKENKFNHIKKENTISSDKKSCHPIFISNCLTEEGIG
SSVTVRACDMLRCTDCDSSVLQIKHRSWNNDVDYLFLRNNFPEIAKLEKK
LDKQTNSKAYCCQCKSYSCQEPIELTRLPSLHWVCGKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001917photoreceptor inner segment
GO:0005829cytosol
GO:0005886plasma membrane
GO:0030054cell junction
GO:0097546ciliary base
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0008594photoreceptor cell morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029239C8orf37
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 20..40
IPR029239C8orf37 proteinPFAMPF14996RMPcoord: 62..188
e-value: 1.5E-37
score: 129.2
IPR029239C8orf37 proteinPANTHERPTHR33958FAMILY NOT NAMEDcoord: 1..188