SMED30035174

Overview
NameSMED30035174
Smed IDSMED30035174
Length (bp)2687
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035174 (SMED30035174) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035174 (SMED30035174) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035174

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30035174 dd_Smed_v4_6013_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035174 dd_Smed_v4_6013_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035174 dd_Smed_v4_6013_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035174 dd_Smed_v4_6013_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30035174 dd_Smed_v4_6013_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30035174 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.406e-6
Identity = 35/95 (36.84%), Postives = 53/95 (55.79%), Query Frame = -1
Query:  846 MFLSYKSKEELLNYFEM--PQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPMPHMNFLMKSQVKKA 1124
            +FL+ K KE    Y E+  PQ+I  L FL D+  +LN  N+ LQG+ + LP L++ +     KL LF + +   + THFP      L+K+  +KA
Sbjct:  367 LFLAEKHKE----YPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPT-----LLKASGQKA 452          
BLAST of SMED30035174 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.632e-6
Identity = 30/72 (41.67%), Postives = 38/72 (52.78%), Query Frame = -1
Query:  894 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHF 1109
            K    LL +     F+  L FLTDIT  LN  NL LQGR Q +  L   I+  + KL L  S +  ++LTHF
Sbjct:  374 KCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHF 445          
BLAST of SMED30035174 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 52.7582 bits (125), Expect = 2.634e-6
Identity = 30/72 (41.67%), Postives = 38/72 (52.78%), Query Frame = -1
Query:  894 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHF 1109
            K    LL +     F+  L FLTDIT  LN  NL LQGR Q +  L   I+  + KL L  S +  ++LTHF
Sbjct:  374 KCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHF 445          
BLAST of SMED30035174 vs. TrEMBL
Match: A0A2I4C1A0 (general transcription factor II-I repeat domain-containing protein 2-like OS=Austrofundulus limnaeus OX=52670 GN=LOC106524500 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 4.493e-7
Identity = 32/93 (34.41%), Postives = 50/93 (53.76%), Query Frame = -1
Query:  840 LSYKSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPMPHMNFLMKSQVKKAVY 1118
            +  K K+      +  +F+  + FL DIT+HLN  N++LQGR   +  +   +   K KL L+ +Q++  NL+HFP       MK QV  AV+
Sbjct:    1 MRRKGKQREDGELQNKKFLCEVAFLCDITNHLNALNMQLQGRGHIITDMYAAVKAFKTKLRLWETQMLQDNLSHFPCCQT---MKEQVSGAVF 90          
BLAST of SMED30035174 vs. TrEMBL
Match: A0A1A8U9C8 (Dimer_Tnp_hAT domain-containing protein (Fragment) OS=Nothobranchius furzeri OX=105023 GN=Nfu_g_1_025840 PE=4 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 4.712e-7
Identity = 33/131 (25.19%), Postives = 55/131 (41.98%), Query Frame = -2
Query: 1169 ALEASLKISWILVQNQKPFSDGQTVELCF*ESADSF------------------------------------------------SLPLDESSDVIDTEELIIWVRFEMGHK--FQEEL*TLILFKNTTRGK 1411
            A E+SL++SWIL Q++KPF+DG+ V+ C    A++                                                  L +DES+DV D  +L+++VRF    +  F E+L  +   + +T G+
Sbjct:  113 AHESSLRVSWILGQHKKPFTDGEVVKECMTAVAETLFEGKEKQEVCEKIKQIPISASSATKKSEILTQDVVAQLDGAIQKAPCVGLAVDESTDVCDNAQLLVYVRFYYTEQKAFYEDLLGITPLQTSTTGE 243          

HSP 2 Score: 27.335 bits (59), Expect = 4.712e-7
Identity = 10/23 (43.48%), Postives = 15/23 (65.22%), Query Frame = -1
Query: 1554 YVFTVSNDKPVCLICQDYVSVLK 1622
            +V      KPVCLIC + V+++K
Sbjct:   37 FVLPTGGTKPVCLICSETVALIK 59          

HSP 3 Score: 26.5646 bits (57), Expect = 4.712e-7
Identity = 11/20 (55.00%), Postives = 14/20 (70.00%), Query Frame = -2
Query: 1640 KSKSSEGKKRKVTEENRTFN 1699
            K++ +  KKRKV  ENR FN
Sbjct:    9 KAEMAASKKRKVDSENRAFN 28          

HSP 4 Score: 24.6386 bits (52), Expect = 4.712e-7
Identity = 13/36 (36.11%), Postives = 20/36 (55.56%), Query Frame = -3
Query: 1450 NVHKHHITMHPNFTEHYSIGTRVK-DKVECLKKNLD 1554
            NV +H+ T H  F E Y + + V+ +K+  LK   D
Sbjct:   62 NVKRHYETKHKCFEETYPLRSEVRSEKIRSLKAQYD 97          
BLAST of SMED30035174 vs. TrEMBL
Match: A0A1A8AR98 (Uncharacterized protein OS=Nothobranchius furzeri OX=105023 GN=Nfu_g_1_025840 PE=4 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 5.508e-7
Identity = 33/131 (25.19%), Postives = 55/131 (41.98%), Query Frame = -2
Query: 1169 ALEASLKISWILVQNQKPFSDGQTVELCF*ESADSF------------------------------------------------SLPLDESSDVIDTEELIIWVRFEMGHK--FQEEL*TLILFKNTTRGK 1411
            A E+SL++SWIL Q++KPF+DG+ V+ C    A++                                                  L +DES+DV D  +L+++VRF    +  F E+L  +   + +T G+
Sbjct:  173 AHESSLRVSWILGQHKKPFTDGEVVKECMTAVAETLFEGKEKQEVCEKIKQIPISASSATKKSETLTQDVVAQLDGAIQKAPCVGLAVDESTDVCDNAQLLVYVRFYYTEQKAFYEDLLGITPLQTSTTGE 303          

HSP 2 Score: 27.335 bits (59), Expect = 5.508e-7
Identity = 10/23 (43.48%), Postives = 15/23 (65.22%), Query Frame = -1
Query: 1554 YVFTVSNDKPVCLICQDYVSVLK 1622
            +V      KPVCLIC + V+++K
Sbjct:   97 FVLPTGGTKPVCLICSETVALIK 119          

HSP 3 Score: 26.1794 bits (56), Expect = 5.508e-7
Identity = 11/20 (55.00%), Postives = 14/20 (70.00%), Query Frame = -2
Query: 1640 KSKSSEGKKRKVTEENRTFN 1699
            K++ +  KKRKV  ENR FN
Sbjct:   69 KAEMAASKKRKVDSENRAFN 88          

HSP 4 Score: 24.6386 bits (52), Expect = 5.508e-7
Identity = 13/36 (36.11%), Postives = 20/36 (55.56%), Query Frame = -3
Query: 1450 NVHKHHITMHPNFTEHYSIGTRVK-DKVECLKKNLD 1554
            NV +H+ T H  F E Y + + V+ +K+  LK   D
Sbjct:  122 NVKRHYETKHKCFEETYPLRSEVRSEKIRSLKAQYD 157          
BLAST of SMED30035174 vs. TrEMBL
Match: A0A3Q3GMI1 (DUF4371 domain-containing protein OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.138e-6
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = -1
Query:  888 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPM 1109
            +SK +L++    P+++     L DITDHL + N KLQGR Q +  +   I+  + KLDL++ QV   NL HFP+
Sbjct:  362 QSKGKLMSELSDPKWLCDFAVLCDITDHLAQLNQKLQGRKQVITQMSDTITAFQRKLDLWMWQVKQDNLVHFPV 435          
BLAST of SMED30035174 vs. TrEMBL
Match: A0A3Q3B228 (DUF4371 domain-containing protein OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.191e-6
Identity = 30/74 (40.54%), Postives = 45/74 (60.81%), Query Frame = -1
Query:  888 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPM 1109
            +SK +L++    P+++     L DITDHL + N KLQGR Q +  +   I+  + KLDL++ QV   NL HFP+
Sbjct:  408 QSKGKLMSELSDPKWLCDFAVLCDITDHLAQLNQKLQGRKQVITQMSDTITAFQRKLDLWMWQVKQDNLVHFPV 481          
BLAST of SMED30035174 vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 7.619e-10
Identity = 35/88 (39.77%), Postives = 51/88 (57.95%), Query Frame = -1
Query:  861 MFLSYKSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPMPHMNFLMKS 1124
            +FL  K K+ L+   E   +I  L FLTD+T  LN+ NLKLQG+ + +  L + +   + KL+LF +Q+   NLTHFP     F  K+
Sbjct:  360 LFLEQKGKDTLV--MENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAHKN 445          
BLAST of SMED30035174 vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 8.871e-10
Identity = 35/87 (40.23%), Postives = 50/87 (57.47%), Query Frame = -1
Query:  864 MFLSYKSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPMPHMNFLMK 1124
            +FL  K K+ L+   E   +I  L FLTD+T  LN+ NLKLQG+ + +  L + +   + KL+LF +Q+   NLTHFP     F  K
Sbjct:  548 LFLEQKGKDTLV--MENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAHK 632          
BLAST of SMED30035174 vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 59.3066 bits (142), Expect = 1.312e-8
Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = -1
Query:  888 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPM 1109
            +SK   L+    P+++     L DIT+HL + N KLQGR Q +  +   I+  + KLDL++ Q    NL HFP+
Sbjct:  358 QSKGNPLSELSDPKWLCDFAVLCDITEHLAQLNQKLQGRKQVITQMSDMITAFQRKLDLWMCQAKQDNLAHFPV 431          
BLAST of SMED30035174 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 2.715e-6
Identity = 26/72 (36.11%), Postives = 42/72 (58.33%), Query Frame = -1
Query:  894 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHF 1109
            KS++E         +++ L FLTD+T  LN+ N +LQG+   +P ++  ++  K KL L+ SQ+    LTHF
Sbjct:  361 KSRKEEYRELADDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHF 432          
BLAST of SMED30035174 vs. Ensembl Cavefish
Match: ENSAMXT00000052657.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000487.1:56485:62130:1 gene:ENSAMXG00000033834.1 transcript:ENSAMXT00000052657.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 4.561e-6
Identity = 26/62 (41.94%), Postives = 36/62 (58.06%), Query Frame = -1
Query:  891 QFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVN--SNLTHFP 1070
            QF+  + FLTDI+ HLN  N  LQG+ Q +  L   ++  + KL LFI    +  +NL HFP
Sbjct:  327 QFLCDMAFLTDISAHLNHLNTLLQGKDQTVCDLYSHMTAFQCKLGLFIDGFSSPRANLAHFP 388          
BLAST of SMED30035174 vs. Ensembl Medaka
Match: ENSORLT00000028655.1 (pep primary_assembly:ASM223467v1:8:18412528:18414615:1 gene:ENSORLG00000023148.1 transcript:ENSORLT00000028655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 5.534e-8
Identity = 29/76 (38.16%), Postives = 43/76 (56.58%), Query Frame = -1
Query:  840 FIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFPMPHMNFLMKSQVKKAVY 1067
            F+  + FL DIT HLN  NL+LQGR + +  +   + V K KL L+ + +   NL+HFP       MK ++  AV+
Sbjct:  385 FLCEMAFLCDITSHLNVMNLQLQGRGRVISDMYSTVQVFKTKLSLWETHMRKENLSHFPSCQT---MKEKLSTAVF 457          
BLAST of SMED30035174 vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.073e-7
Identity = 26/73 (35.62%), Postives = 45/73 (61.64%), Query Frame = -1
Query:  891 KSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFP 1109
            KSK E  +  E P++++ L FLTD+T +LN  N +LQG+ + +   +  ++  +AKL +F +Q+    + HFP
Sbjct:  363 KSKGEDTSLLEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFP 435          
BLAST of SMED30035174 vs. Ensembl Medaka
Match: ENSORLT00000017252.2 (pep primary_assembly:ASM223467v1:13:14820116:14821987:-1 gene:ENSORLG00000013757.2 transcript:ENSORLT00000017252.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 6.274e-6
Identity = 26/76 (34.21%), Postives = 42/76 (55.26%), Query Frame = -1
Query:  891 LSYKSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFP 1118
            L  +   +  N+ +    +  + FL DIT HLN+ NLKLQG+   +  LMK +   + KLD+F  + + ++  HFP
Sbjct:  372 LKSQKATQFANFLQDQHKMDVVAFLVDITGHLNELNLKLQGQKNSICDLMKTVRSFQIKLDIF-KEDLQADCEHFP 446          
BLAST of SMED30035174 vs. Planmine SMEST
Match: SMESG000020950.1 (SMESG000020950.1)

HSP 1 Score: 47.7506 bits (112), Expect = 3.060e-6
Identity = 25/73 (34.25%), Postives = 42/73 (57.53%), Query Frame = -1
Query:  867 EMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPTLMKEISVLKAKLDLFISQVVNSNLTHFP--MPHMNFLM 1079
            E  +++V L FLTD    LN  NL+LQG+ + +  ++  +   K KL L + ++  +NL +FP  M  +N L+
Sbjct:   51 EDEKWLVDLAFLTDFRSKLNDLNLELQGKDKTIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMTQLNSLV 123          
The following BLAST results are available for this feature:
BLAST of SMED30035174 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AL928808.11.406e-636.84pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of SMED30035174 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000016563.12.632e-641.67pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
spag12.634e-641.67sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of SMED30035174 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I4C1A04.493e-734.41general transcription factor II-I repeat domain-co... [more]
A0A1A8U9C84.712e-725.19Dimer_Tnp_hAT domain-containing protein (Fragment)... [more]
A0A1A8AR985.508e-725.19Uncharacterized protein OS=Nothobranchius furzeri ... [more]
A0A3Q3GMI11.138e-640.54DUF4371 domain-containing protein OS=Kryptolebias ... [more]
A0A3Q3B2281.191e-640.54DUF4371 domain-containing protein OS=Kryptolebias ... [more]
back to top
BLAST of SMED30035174 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000052542.17.619e-1039.77pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037725.18.871e-1040.23pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000035253.11.312e-837.84general transcription factor II-I repeat domain-co... [more]
ENSAMXT00000039226.12.715e-636.11pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052657.14.561e-641.94pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30035174 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035174 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000028655.15.534e-838.16pep primary_assembly:ASM223467v1:8:18412528:184146... [more]
ENSORLT00000033470.11.073e-735.62pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000017252.26.274e-634.21pep primary_assembly:ASM223467v1:13:14820116:14821... [more]
back to top
BLAST of SMED30035174 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020950.13.060e-634.25SMESG000020950.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035174 ID=SMED30035174|Name=SMED30035174|organism=Schmidtea mediterranea sexual|type=transcript|length=2687bp
GATTTTTAGCATGTTAATATGGAACCGTGGTACAAGGCACAAAACTAGTG
CGGCGCAAATTTCTAAGATAGAATACGTAAATTAAAGGATGAAAGTTTAT
CTCATGATTATTTGTTTGAATATTTGAATTGTACTGGAAAATATTTTATA
TACTTTAAAGCAGTGCTGTCCAACCTTTGGGCGACTAACAAATTTCTTTT
GAAGTCGAGGGCCTCACAAATAAATATGATGACCACTAAATTGTACTGAA
AATTATAATATTTATTTTTCAATCAGTATCGCACGTGTTCGATAATTGTA
CAAATGCTTTAGTTTAGAGTTTTAGACTATTAAAGTCTATTAGTATTAGA
CAGTTCAATGCTCAAGATTAATTAATAAAAATAAAGTGAATAAAACTTTC
AATCACGTTTTTAGTGAGATGTTTGGTTTTGAATTGTGCTTGCAATGTTT
TATAGTTTATGGTATGTATTCAATAACTAACGCCCTCATTAGGTCTTTCA
AATGGTCACCAGTCAATAAGCTTCATTTCTTTGACTTGATTTTGGTCATT
GCAGGAAATCCAGCTTCACAGATAGTAGTTGCTTCCTAACATCGTCAATA
ATTTTTTACAACGTTTTGACATATGTGGAAATTCATCCTAAAATCAGTTG
GTAGCAATATTATGTTGAGTTTCAATTATTTCAAGCTGTGCTGCACCTTC
ATCTCCTCTCAATAACTGCACATTAGTTGACATGATGGAAATATTGCTTG
TGAATGCTTTTCAACAAAAAGTAGCATGGAAGTCAAACTGCGAATATCTT
TGAAACAAACCGAGAAATCCCATTTCAACTTTTCTGCTGATAGACTGCTT
TTTTCACTTGTGACTTCATAAGGAAATTCATGTGAGGCATTGGAAAGTGT
GTAAGGTTTGAATTAACCACTTGAGAGATGAATAAGTCTAGCTTTGCTTT
TAAAACACTAATTTCCTTCATAAGCGTTGGCAACTTTTGATATCGCCCTT
GTAATTTCAAATTATATTTGTTTAGATGGTCTGTGATGTCAGTAAGAAAT
ACAAGCGTTACAATAAACTGTGGCATTTCGAAATAGTTTAACAACTCTTC
TTTGGATTTATAGCTGAGGAACATTGTACAACAATATCCATTACATTTTT
CAGTTCATCATCTTTTAGTTTGCCGCGCGTTGTATTTTTAAATAGAATCA
GTGTCTACAATTCTTCTTGAAATTTATGTCCCATTTCAAATCTAACCCAA
ATTATAAGTTCCTCTGTATCAATAACGTCACTTGACTCATCCAATGGAAG
ACTGAAAGAATCTGCACTTTCTTAAAAACATAGTTCCACAGTTTGCCCAT
CAGAAAACGGTTTCTGATTCTGAACTAAAATCCAGCTTATCTTTAAAGAT
GCCTCTAGCGCAATCATTAAAGCAATCGACGAAAACAAATTTGCTGGCAA
TCCAAATTCTTTTTAAGGCATTCAACTTTGTCTTTTACCCTCGTGCCAAT
TGAATAATGTTCTGTAAAATTTGGATGCATAGTAATGTGATGTTTGTGTA
CATTTTCAAAACAGAGACATAATCCTGACATATCAAGCACACAGGTTTAT
CATTTGACACTGTAAATACATAGTTCAGTTTCGTGACTTGTTAAACGTAC
GATTCTCTTCCGTAACTTTCCGTTTCTTCCCTTCACTGGATTTACTTTTC
ATATTTTGAGATTTAAAAAAAAATACTTTAAAAAGGAATCTATTTAGTTA
AGTCATATTTAAAAAACAGTTGTGCATGCTACATAAATAATAATTATAGA
CAATATTCAATATTCGTGATGTCACCACTCGATGTCACTACATTTATTAT
ATCATCAGTTAATTTTATAGCACAGTTTGACTTCACTCAAGGATATATGC
GCACTCTCTAGTTCTACTGGGTGTAGCTTAATTTTAATATATCCAGGAAT
CTCCGGTTTAATTATTTGGGTGCGTTTTTTATTATCATTGCAATGCAATT
ACTGGATATTCTTACTTACATTCCATAAATGGTGCTAGCTATAAATAAAC
ATTCTGTGTTGGCGTGTCATGCTCATATATTTTACCTGGTTACCAAGAAT
AGCTATAAAAATGCCTGGGGAAAGTTTTATTTTTATTTTTTACACAAAAT
TTTATGGCTCTGGTGTGGCGCGTTTTGGAGAGCACTGCTTTAAAGATATG
TTATATCATTTTATTTGGTAATATTGATTTAATTTATATATGCACTGTAA
ATATAGTTATTATACATTCGATGTCTCCATACAAAACCAAATTATGGCGC
CAGATTCATGATCGGTACAGTGAGCAATTATAACATGAACACGTAGAATA
GTTAAATTAATTTTTACTGTTTCTAGTCATTCAAATCGTAATAAATAGCA
AACCACCCTTTTTTGATTGAAAGCATCGAATTAAACACTAAATGGCCGAG
TTTGAAGAAGCAGTTGTGATTTGAAAATGGTAGTGATATGAACTCAATGC
AAAGGTTTTCAAAATACATTTAACAATATCTGTATATTTAGTAAACATTT
TCAAATCCGAATAATAAACACAGAACAGAAATAAATAAATAAATACCGAA
TAGAAATTTATTAAATTACAAGTGAAGTCTAAATTTTTTAAATAGAAAGT
GGCCTACACAATTTTTTAATATTTTTTTTCGCAAAAA
back to top

protein sequence of SMED30035174-orf-1

>SMED30035174-orf-1 ID=SMED30035174-orf-1|Name=SMED30035174-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MFLSYKSKEELLNYFEMPQFIVTLVFLTDITDHLNKYNLKLQGRYQKLPT
LMKEISVLKAKLDLFISQVVNSNLTHFPMPHMNFLMKSQVKKAVYQQKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 15..37