Ubiquitin-ligase E3C

Overview
NameUbiquitin-ligase E3C
Smed IDSMED30035160
Length (bp)3239
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-ligase E3C (SMED30035160) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-ligase E3C (SMED30035160) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-ligase E3C (SMED30035160) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-ligase E3C (SMED30035160) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035160

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035160SMESG000068094.1 dd_Smed_v4_13725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035160SMESG000068094.1 dd_Smed_v4_13725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035160SMESG000068094.1 dd_Smed_v4_13725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035160SMESG000068094.1 dd_Smed_v4_13725_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035160SMESG000068094.1 OX_Smed_1.0.06768ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035160SMESG000068094.1 OX_Smed_1.0.14284ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-ligase E3C vs. Ensembl Human
Match: UBE3C (ubiquitin protein ligase E3C [Source:HGNC Symbol;Acc:HGNC:16803])

HSP 1 Score: 107.071 bits (266), Expect = 9.306e-23
Identity = 59/192 (30.73%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D EV KNLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L++QI+  C  F++G+ +V+S   L +    ++  LIS
Sbjct:  775 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADV-DIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLIS 965          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Human
Match: UBE3B (ubiquitin protein ligase E3B [Source:HGNC Symbol;Acc:HGNC:13478])

HSP 1 Score: 96.6709 bits (239), Expect = 1.496e-19
Identity = 56/196 (28.57%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF +  G++ LYP+P     + ++   +E+ GK+    +  G  +   F+ FFL +L+  + SV+  ++++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  IPVT +NK  YIH +  F +  QIK Q      G  S++    + + ST +L +LIS D
Sbjct:  733 EFLEEIIKRVFDPALNLFKTTSGDERLYPSP-TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGD 927          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Human
Match: UBE3B (ubiquitin protein ligase E3B [Source:HGNC Symbol;Acc:HGNC:13478])

HSP 1 Score: 96.6709 bits (239), Expect = 1.496e-19
Identity = 56/196 (28.57%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF +  G++ LYP+P     + ++   +E+ GK+    +  G  +   F+ FFL +L+  + SV+  ++++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  IPVT +NK  YIH +  F +  QIK Q      G  S++    + + ST +L +LIS D
Sbjct:  733 EFLEEIIKRVFDPALNLFKTTSGDERLYPSP-TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGD 927          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Human
Match: NEDD4 (NEDD4 E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:7727])

HSP 1 Score: 75.485 bits (184), Expect = 5.272e-13
Identity = 50/175 (28.57%), Postives = 91/175 (52.00%), Query Frame = 3
Query: 2649 FSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTD-DELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            +S   N  L  NP       D   Y+++ G++  + + HG  L   F  PF+    M L++ +  ++D+ +VD E   +L  + + D  ELD    +F++ +  FG+ H +E+   G++I VT  NK EYI+ VI++    +I+ Q   FK+G   ++  +++ I   N+L  L+
Sbjct:  957 YSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYK---MMLHKPI-TLHDMESVDSEYYNSLRWILENDPTELD---LRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLM 1124          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Human
Match: NEDD4 (NEDD4 E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:7727])

HSP 1 Score: 75.0998 bits (183), Expect = 6.149e-13
Identity = 50/175 (28.57%), Postives = 91/175 (52.00%), Query Frame = 3
Query: 2649 FSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTD-DELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            +S   N  L  NP       D   Y+++ G++  + + HG  L   F  PF+    M L++ +  ++D+ +VD E   +L  + + D  ELD    +F++ +  FG+ H +E+   G++I VT  NK EYI+ VI++    +I+ Q   FK+G   ++  +++ I   N+L  L+
Sbjct: 1029 YSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYK---MMLHKPI-TLHDMESVDSEYYNSLRWILENDPTELD---LRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLM 1196          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Celegans
Match: oxi-1 (OXidative stress Induced [Source:UniProtKB/TrEMBL;Acc:Q9XXE6])

HSP 1 Score: 87.0409 bits (214), Expect = 5.303e-17
Identity = 48/191 (25.13%), Postives = 100/191 (52.36%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F+   L    DP  +LFS     +LYP+P   + + D    + + G++    +  G  +  + +P  L  ++  +  +   ++L+ +D E+ ++L  + + + E+   +  F + ++  GK+ T ++V +G  I VT +NK +Y+H +    + ++ + QC+ F  GM+S++    LS+ + NDL  LIS
Sbjct:  735 EFLELTLKKVFDPQLNLFSTTSTGVLYPSP-TSSLHDDHLALFTFVGRMLGKAVYEGIVVDVQLAPVLLAAVLG-SHRLCAFDELSQLDPELYRSLTFVKRYEGEMADLSLTFSVDEDFMGKISTVDLVPSGRTISVTNENKIDYVHRMAHHRVFRRTQEQCKAFVTGMQSILQPTWLSLFAPNDLQCLIS 923          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Celegans
Match: Y92H12A.2 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:Q9BKW4])

HSP 1 Score: 80.1073 bits (196), Expect = 3.358e-15
Identity = 56/174 (32.18%), Postives = 88/174 (50.57%), Query Frame = 3
Query: 2649 FSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            +S   N  L  NP+ E    +   Y+ + G+I  + I HG  L   F  PF+    M L + +  + D+ +VD E   N L+  K +D  D     F L  + FG+    E++ NGA +PVT+DNK EYI  VI +    +I+ Q     KG++ V+ +N+L +   N+L  L+
Sbjct:  206 YSATDNYTLQINPHSEACNPEHLSYFHFIGRIIGMAIYHGKLLDAFFIRPFYK---MMLGKKI-TLFDMESVDNEYY-NSLIYVKDNDPAD-LELTFSLDDSIFGETQNIELIPNGANVPVTEDNKEEYIEAVISWRFVNRIEKQMNQILKGLQEVVPSNLLRLFDANELELLM 373          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 69.707 bits (169), Expect = 6.266e-12
Identity = 54/185 (29.19%), Postives = 91/185 (49.19%), Query Frame = 3
Query: 2628 LDPVNHLFSCDGNQ----LLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTD-DELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            L+P+  LF   GN      + P  +V     D   Y+EY G+  A+ + HG  +   F+  F +K+  LN+ +  + D+  VD E+  +L+ +   + DE D     FV      G+L TYE+ E G +I VT++NK EYI  ++E+  ++ ++ Q + F  G  SV     +      +L  L+
Sbjct:  209 LNPMYCLFMYAGNNNYSLQINPASFVN---PDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKM--LNKKIV-LKDIEQVDSEIYNSLMWIKDNNIDECD-MELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLL 386          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 69.707 bits (169), Expect = 6.266e-12
Identity = 54/185 (29.19%), Postives = 91/185 (49.19%), Query Frame = 3
Query: 2628 LDPVNHLFSCDGNQ----LLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTD-DELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            L+P+  LF   GN      + P  +V     D   Y+EY G+  A+ + HG  +   F+  F +K+  LN+ +  + D+  VD E+  +L+ +   + DE D     FV      G+L TYE+ E G +I VT++NK EYI  ++E+  ++ ++ Q + F  G  SV     +      +L  L+
Sbjct:  209 LNPMYCLFMYAGNNNYSLQINPASFVN---PDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKM--LNKKIV-LKDIEQVDSEIYNSLMWIKDNNIDECD-MELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLL 386          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Celegans
Match: wwp-1 (E3 ubiquitin-protein ligase [Source:UniProtKB/TrEMBL;Acc:V6CJJ8])

HSP 1 Score: 69.707 bits (169), Expect = 6.289e-12
Identity = 54/185 (29.19%), Postives = 91/185 (49.19%), Query Frame = 3
Query: 2628 LDPVNHLFSCDGNQ----LLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTD-DELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            L+P+  LF   GN      + P  +V     D   Y+EY G+  A+ + HG  +   F+  F +K+  LN+ +  + D+  VD E+  +L+ +   + DE D     FV      G+L TYE+ E G +I VT++NK EYI  ++E+  ++ ++ Q + F  G  SV     +      +L  L+
Sbjct:  207 LNPMYCLFMYAGNNNYSLQINPASFVN---PDHLKYFEYIGRFIAMALFHGKFIYSGFTMPFYKKM--LNKKIV-LKDIEQVDSEIYNSLMWIKDNNIDECD-MELYFVADYELLGELKTYELKEGGTEIAVTEENKLEYIELLVEWRFNRGVEQQTKAFFTGFNSVFPLEWMQYFDERELELLL 384          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Fly
Match: CG3356 (gene:FBgn0034989 transcript:FBtr0072262)

HSP 1 Score: 100.908 bits (250), Expect = 3.592e-21
Identity = 56/191 (29.32%), Postives = 99/191 (51.83%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F+S+++    DP    F    +  LYPNP V + + D++ +Y + G+I   +I     ++   + FFL KL      V +I+ L ++D E+ +NLL L     ++   N  F +  ++ G+    E+   G  IPVT  N+ EY+  + ++ L+ QI+  C  F+KG+ +V+    L + S  +L  LIS
Sbjct:  816 EFLSELIKTAFDPNRGFFMVTTDNKLYPNPNVADLFEDYEKHYYFIGRILGKSIYENLLVELPLAEFFLTKLAGKYSDV-DIHQLASLDPELYRNLLYLKDYSGDVSELNLDFTVASSSLGQTQIVELKPQGQSIPVTNSNRIEYLQLIADYKLNVQIRRHCNAFRKGLSNVLPIEWLYMFSNKELQILIS 1005          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Fly
Match: CG5087 (gene:FBgn0035953 transcript:FBtr0333908)

HSP 1 Score: 85.5001 bits (210), Expect = 1.831e-16
Identity = 72/297 (24.24%), Postives = 137/297 (46.13%), Query Frame = 3
Query: 2340 LLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEI---ILNNETLP---------IPKFISQILDAGLDPVNHLFSCDGNQLLYPNP--YVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMF-LNESVYN-INDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYS 3182
            +LLL  +P     E ++ L   +    K       +       A+ +IH +D I++D    +    T+    K  I    +N + L            +F+ + +    DP  +LF    +Q LYP+P  YV++ + +    +E+ G++    +  G  +   F+ FFL +L+    +++Y+ +++L ++D E+ ++L  +     ++   N  F + Q+  GK+ T  +   G    V   NK  YIH +  F ++ QI+ Q   F +G  S+++   LS+ S  +L +LIS D S
Sbjct:  648 MLLLAKMPHIIPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIH-RDRIVEDGYRQLAAQPTQ--ALKGVIRVRFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQRLYPSPISYVQDNHLEL---FEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKHYKQDVSDLNLTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFNRGFRSIVNPEWLSLFSPPELQRLISGDTS 938          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Fly
Match: CG5087 (gene:FBgn0035953 transcript:FBtr0076520)

HSP 1 Score: 85.5001 bits (210), Expect = 1.863e-16
Identity = 72/297 (24.24%), Postives = 137/297 (46.13%), Query Frame = 3
Query: 2340 LLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEI---ILNNETLP---------IPKFISQILDAGLDPVNHLFSCDGNQLLYPNP--YVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMF-LNESVYN-INDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYS 3182
            +LLL  +P     E ++ L   +    K       +       A+ +IH +D I++D    +    T+    K  I    +N + L            +F+ + +    DP  +LF    +Q LYP+P  YV++ + +    +E+ G++    +  G  +   F+ FFL +L+    +++Y+ +++L ++D E+ ++L  +     ++   N  F + Q+  GK+ T  +   G    V   NK  YIH +  F ++ QI+ Q   F +G  S+++   LS+ S  +L +LIS D S
Sbjct:  649 MLLLAKMPHIIPHEDRVKLFRKFVQNEKAVMGLTESACASPRSALIVIH-RDRIVEDGYRQLAAQPTQ--ALKGVIRVRFINQQGLHEAGIDQDGVFKEFLEETIKKVFDPSLNLFKTTSDQRLYPSPISYVQDNHLEL---FEFVGRMLGKAVYEGIVVDVPFASFFLSQLLGQTQQALYSCMDELPSLDNELYRSLTFIKHYKQDVSDLNLTFSVDQDVMGKIVTLALHPGGKARVVNDHNKLVYIHYMAFFHMNTQIREQTIAFNRGFRSIVNPEWLSLFSPPELQRLISGDTS 939          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Fly
Match: Nedd4 (gene:FBgn0259174 transcript:FBtr0300520)

HSP 1 Score: 68.9366 bits (167), Expect = 2.159e-11
Identity = 44/150 (29.33%), Postives = 79/150 (52.67%), Query Frame = 3
Query: 2721 YYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            Y+++ G+I  + + HG  L   F  PF+  K+M   +   ++ D+ +VD E   +L+ + + D  +      F L ++ FG+   +E+   GA I VT +NK+EYI  VIE+    ++K Q   F  G  S++  N++ I   ++L  L+
Sbjct:  568 YFKFIGRIAGMAVYHGKLLDAFFIRPFY--KMML--QKPIDLKDMESVDTEYYNSLMWIKENDPRI--LELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLM 711          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Fly
Match: Nedd4 (gene:FBgn0259174 transcript:FBtr0299642)

HSP 1 Score: 68.9366 bits (167), Expect = 2.175e-11
Identity = 44/150 (29.33%), Postives = 79/150 (52.67%), Query Frame = 3
Query: 2721 YYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            Y+++ G+I  + + HG  L   F  PF+  K+M   +   ++ D+ +VD E   +L+ + + D  +      F L ++ FG+   +E+   GA I VT +NK+EYI  VIE+    ++K Q   F  G  S++  N++ I   ++L  L+
Sbjct:  527 YFKFIGRIAGMAVYHGKLLDAFFIRPFY--KMML--QKPIDLKDMESVDTEYYNSLMWIKENDPRI--LELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLM 670          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Zebrafish
Match: ube3c (ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-GENE-040426-1211])

HSP 1 Score: 102.449 bits (254), Expect = 1.388e-21
Identity = 56/198 (28.28%), Postives = 103/198 (52.02%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH 3188
            +F++++L +G +P    F      LLYP+P  E    + F  +Y + G+I    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   + +++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    ++   +S   S+H
Sbjct:  773 EFLNELLKSGFNPNQGFFKTTNEGLLYPSPTAEMLVGESFTRHYYFLGRILGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEGDVEDLGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRAHCLAFRQGLANVVNLEWLRMFDQQEIQVKLSAKVSEH 969          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Zebrafish
Match: ube3c (ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-GENE-040426-1211])

HSP 1 Score: 101.679 bits (252), Expect = 3.092e-21
Identity = 55/195 (28.21%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDY 3179
            +F++++L +G +P    F      LLYP+P  E    + F  +Y + G+I    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   + +++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    ++  L+S  +
Sbjct:  773 EFLNELLKSGFNPNQGFFKTTNEGLLYPSPTAEMLVGESFTRHYYFLGRILGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEGDVEDLGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRAHCLAFRQGLANVVNLEWLRMFDQQEIQVLVSGAH 966          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Zebrafish
Match: ube3b (ubiquitin protein ligase E3B [Source:ZFIN;Acc:ZDB-GENE-060526-231])

HSP 1 Score: 93.9745 bits (232), Expect = 6.310e-19
Identity = 55/196 (28.06%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    +P  +LF +  GN+ LYP+P   + + +    +E+ GK+    +  G  +   F+ FFL +++  + S +  +I++L ++D E  KNL  + + D ++          +   G+L  +E++  G  +PVT +NK  YIH +  F +  QIK Q   F +G  S+++   L + ST ++ +LIS D
Sbjct:  734 EFLEEIIKKVFNPALNLFKTTSGNERLYPSP-TSSIHENHLQLFEFVGKMLGKAMYEGIVVDVPFASFFLSQVLGHHHSTFYSSIDELPSLDSEFYKNLTSIKRYDGDVSDLGLTLSYDEEVMGQLVCHELIPGGKTMPVTNENKISYIHLMAHFRMHTQIKEQTAAFIRGFRSIINPEWLHMFSTPEVQRLISGD 928          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Zebrafish
Match: smurf1 (SMAD specific E3 ubiquitin protein ligase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2744])

HSP 1 Score: 67.0106 bits (162), Expect = 1.090e-10
Identity = 43/155 (27.74%), Postives = 79/155 (50.97%), Query Frame = 3
Query: 2709 DFKVYYEYFGKIFALNILHGNGLKRRFS-PFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            D   Y+ + G+I  L + HG+ +   F+ PF+ +    L + +  + DL TVD E+ K+L+ + + +D     +  F +  N FGK   +E+  NG  IPVT++NK EY+   + +   + I+ Q    +KG   ++  ++L      +L  +I 
Sbjct:  458 DHLSYFHFVGRIMGLAVFHGHYINGGFTLPFYKQ---LLGKPI-QLCDLETVDPELHKSLVWILE-NDITSVLDHTFCVEHNAFGKFLQHELKPNGKNIPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGFNELIPQHLLKPFDNKELELIIG 607          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Zebrafish
Match: nedd4a (NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;Acc:ZDB-GENE-051005-2])

HSP 1 Score: 66.2402 bits (160), Expect = 1.800e-10
Identity = 48/171 (28.07%), Postives = 84/171 (49.12%), Query Frame = 3
Query: 2649 FSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDD-ELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDL 3155
            +S   N  L  NP       D   Y+++ G++  + + HG  L   F  PF+  K+M   +    + D+ +VD E   +L  + + D  +LD    +F + +  FG+ H +E+   GA I V   NK EYIH V+++    +I+ Q   FK+G   ++  +++ I   N+L
Sbjct:  620 YSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFY--KMML--QKPITLQDMESVDSEYFNSLRWILENDPTDLD---LRFTIDEELFGQTHQHELKPGGADIVVNDTNKKEYIHLVMQWRFVDRIQRQMTAFKEGFYELIPQDLIKIFDENEL 783          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:Xenbase;Acc:XB-GENE-945047])

HSP 1 Score: 107.071 bits (266), Expect = 8.873e-23
Identity = 58/192 (30.21%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    +L  LIS
Sbjct:  774 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKAGGKDIPVTSANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLIS 964          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:Xenbase;Acc:XB-GENE-945047])

HSP 1 Score: 107.071 bits (266), Expect = 9.467e-23
Identity = 58/192 (30.21%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    +L  LIS
Sbjct:  769 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKAGGKDIPVTSANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLIS 959          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:Xenbase;Acc:XB-GENE-945047])

HSP 1 Score: 106.686 bits (265), Expect = 1.032e-22
Identity = 58/192 (30.21%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    +L  LIS
Sbjct:  771 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKAGGKDIPVTSANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRMFDQQELQVLIS 961          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:Xenbase;Acc:XB-GENE-945047])

HSP 1 Score: 101.679 bits (252), Expect = 4.112e-21
Identity = 54/181 (29.83%), Postives = 97/181 (53.59%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSI 3137
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +
Sbjct:  768 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKAGGKDIPVTSANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVNLEWLRM 947          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Xenopus
Match: rpa1 (replication protein A1 [Source:Xenbase;Acc:XB-GENE-945047])

HSP 1 Score: 95.9005 bits (237), Expect = 2.249e-19
Identity = 51/169 (30.18%), Postives = 89/169 (52.66%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKG 3101
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++ 
Sbjct:  771 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKAGGKDIPVTSANRIAYIHLVADYRLNKQIRPHCLAFRQA 938          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Mouse
Match: Ube3c (ubiquitin protein ligase E3C [Source:MGI Symbol;Acc:MGI:2140998])

HSP 1 Score: 105.145 bits (261), Expect = 2.377e-22
Identity = 58/192 (30.21%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D EV +NLL L   +++++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V+S   L +    ++  LIS
Sbjct:  775 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADV-DIHHLASLDPEVYRNLLFLKSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLIS 965          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Mouse
Match: Ube3b (ubiquitin protein ligase E3B [Source:MGI Symbol;Acc:MGI:1891295])

HSP 1 Score: 96.2857 bits (238), Expect = 1.251e-19
Identity = 56/196 (28.57%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF +  G++ LYP+P     + ++   +E+ GK+    +  G  +   F+ FFL +++  + SV+  ++++L ++D E  KNL  + + D ++          ++  G+L  +E+V  G  IPVT +NK  YIH +  F +  QIK Q      G  S++    + + ST +L +LIS D
Sbjct:  735 EFLEEIIKRVFDPALNLFKTTSGDERLYPSP-TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQMLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDIADLGLTLSYDEDVMGQLVCHELVPGGKTIPVTDENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGD 929          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Mouse
Match: Hecw2 (HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2685817])

HSP 1 Score: 70.8626 bits (172), Expect = 1.052e-11
Identity = 57/246 (23.17%), Postives = 119/246 (48.37%), Query Frame = 3
Query: 2472 ITIIHQKDSIIKDILAPVLNYSTEFWICKNEI---ILNNETL----PIPKFISQILDAGLDPVNHLFSCDGN-----QLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFS-PFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            + +I ++D +++D    ++ YS +  + +N++    +  E L    P  +F   +     +P   LF    N     Q+   + +V+N +     ++ + G+I  L ++H   L   F+ PF+   L  L +    ++DL  +D E  ++L  + K +D  D  +  F + +  FG++   E+   GA IPVT+ NK EYI  ++++ +++ +  Q E   +G   V+   ++S+    +L  +I+
Sbjct: 1222 LKLIIRRDHLLEDAFNQIMGYSRKD-LQRNKLYVTFVGEEGLDYSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHE----WFRFSGRILGLALIHQYLLDAFFTRPFYKALLRILCD----LSDLEYLDEEFHQSLQWM-KDNDIHDILDLTFTVNEEVFGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIA 1457          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Mouse
Match: Hecw2 (HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2685817])

HSP 1 Score: 70.8626 bits (172), Expect = 1.052e-11
Identity = 57/246 (23.17%), Postives = 119/246 (48.37%), Query Frame = 3
Query: 2472 ITIIHQKDSIIKDILAPVLNYSTEFWICKNEI---ILNNETL----PIPKFISQILDAGLDPVNHLFSCDGN-----QLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFS-PFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            + +I ++D +++D    ++ YS +  + +N++    +  E L    P  +F   +     +P   LF    N     Q+   + +V+N +     ++ + G+I  L ++H   L   F+ PF+   L  L +    ++DL  +D E  ++L  + K +D  D  +  F + +  FG++   E+   GA IPVT+ NK EYI  ++++ +++ +  Q E   +G   V+   ++S+    +L  +I+
Sbjct: 1222 LKLIIRRDHLLEDAFNQIMGYSRKD-LQRNKLYVTFVGEEGLDYSGPSREFFFLVSRELFNPYYGLFEYSANDTYTVQISPMSAFVDNHHE----WFRFSGRILGLALIHQYLLDAFFTRPFYKALLRILCD----LSDLEYLDEEFHQSLQWM-KDNDIHDILDLTFTVNEEVFGQITERELKPGGANIPVTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIA 1457          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Mouse
Match: Nedd4 (neural precursor cell expressed, developmentally down-regulated 4 [Source:MGI Symbol;Acc:MGI:97297])

HSP 1 Score: 69.707 bits (169), Expect = 1.587e-11
Identity = 50/175 (28.57%), Postives = 91/175 (52.00%), Query Frame = 3
Query: 2649 FSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDD-ELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            +S   N  L  NP       D   Y+++ G++  + + HG  L   F  PF+  K+M   + +  ++D+ +VD E   +L  + + D  ELD    +F++ +  FG+ H +E+   G++I VT  NK EYI+ VI++    +I+ Q   FK+G   ++  +++ I   N+L  L+
Sbjct:  597 YSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFY--KMML--QKLITLHDMESVDSEYYSSLRWILENDPTELD---LRFIIDEELFGQTHQHELKTGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLM 764          
BLAST of Ubiquitin-ligase E3C vs. UniProt/SwissProt
Match: sp|Q15386|UBE3C_HUMAN (Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 4.469e-22
Identity = 59/192 (30.73%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D EV KNLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L++QI+  C  F++G+ +V+S   L +    ++  LIS
Sbjct:  775 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADV-DIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLIS 965          
BLAST of Ubiquitin-ligase E3C vs. UniProt/SwissProt
Match: sp|Q80U95|UBE3C_MOUSE (Ubiquitin-protein ligase E3C OS=Mus musculus OX=10090 GN=Ube3c PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.662e-21
Identity = 58/192 (30.21%), Postives = 102/192 (53.12%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L +G +P    F      LLYPNP  +    D F  +Y + G++    +     ++  F+ FFL KL+  +  V +I+ L ++D EV +NLL L   +++++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V+S   L +    ++  LIS
Sbjct:  775 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADV-DIHHLASLDPEVYRNLLFLKSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLIS 965          
BLAST of Ubiquitin-ligase E3C vs. UniProt/SwissProt
Match: sp|Q7Z3V4|UBE3B_HUMAN (Ubiquitin-protein ligase E3B OS=Homo sapiens OX=9606 GN=UBE3B PE=1 SV=3)

HSP 1 Score: 96.6709 bits (239), Expect = 7.184e-19
Identity = 56/196 (28.57%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF +  G++ LYP+P     + ++   +E+ GK+    +  G  +   F+ FFL +L+  + SV+  ++++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  IPVT +NK  YIH +  F +  QIK Q      G  S++    + + ST +L +LIS D
Sbjct:  733 EFLEEIIKRVFDPALNLFKTTSGDERLYPSP-TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGD 927          
BLAST of Ubiquitin-ligase E3C vs. UniProt/SwissProt
Match: sp|Q9ES34|UBE3B_MOUSE (Ubiquitin-protein ligase E3B OS=Mus musculus OX=10090 GN=Ube3b PE=1 SV=3)

HSP 1 Score: 96.2857 bits (238), Expect = 8.749e-19
Identity = 56/196 (28.57%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF +  G++ LYP+P     + ++   +E+ GK+    +  G  +   F+ FFL +++  + SV+  ++++L ++D E  KNL  + + D ++          ++  G+L  +E+V  G  IPVT +NK  YIH +  F +  QIK Q      G  S++    + + ST +L +LIS D
Sbjct:  735 EFLEEIIKRVFDPALNLFKTTSGDERLYPSP-TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQMLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDIADLGLTLSYDEDVMGQLVCHELVPGGKTIPVTDENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGD 929          
BLAST of Ubiquitin-ligase E3C vs. UniProt/SwissProt
Match: sp|Q08CZ0|UBE3B_XENTR (Ubiquitin-protein ligase E3B OS=Xenopus tropicalis OX=8364 GN=ube3b PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.558e-17
Identity = 55/196 (28.06%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF +      LYP+P     + ++   +E+ GK+    +  G  +   F+ FFL +L+  + S++  ++++L ++D E  KNL  + + D ++          ++  G+L  +E+V  G  IPVT +NK  YIH +  F +  QIK Q   F  G  S++    + + S  +L +LIS D
Sbjct:  737 EFLEEIIKRVFDPALNLFKTTSSGDRLYPSP-TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSIFYSSVDELPSLDSEFYKNLTSIKRYDGDISDLGLTLSYDEDVMGQLVCHELVPGGKSIPVTNENKISYIHLMAHFRMHTQIKNQTVAFISGFRSIIRPEWIRMFSAPELQRLISGD 931          
BLAST of Ubiquitin-ligase E3C vs. TrEMBL
Match: E2A6Z2 (Ubiquitin-protein ligase E3C OS=Camponotus floridanus OX=104421 GN=EAG_07219 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 2.226e-25
Identity = 138/612 (22.55%), Postives = 257/612 (41.99%), Query Frame = 3
Query: 1470 IRECI-----SQNINEVLKIAFTGLLDPDVVL-PLAYLYQNL--TKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAE--TRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEI-QSILRLLRIFYVHIDKLNVDYCSIDEIL-----------MDFDFENLR----------KLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIET--YFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILA-------PVLNYSTEFWICKN----EIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +R+C+      Q +N +L        DP  +L PL  L  +L  T  L + K  ++    +L+    F+++LW+      + R+ S   GS    T        + ++IS G  +S ED  R + +L+      +  + TL+  E    + +S+   P+     +      EL  ++  L  + +GL+++A         D  +N      +T    H   I   + + ++ LLR   +H   L   +C  +  +            DF F   R          + F++E+ E                E   +   E+  L LL+ +P       ++ + ++  Y D+ +Q  +  + +  P   +I I  +++ + +D          P L       +       E  ++   L   +F+S++L    DP    F    + +LYPNP V     DF  +Y + G+I    +     ++  F+ FFL K++     V +++ L ++D  + +NLL L     ++   N  F +  +  G+    E+  +GA IPVT  N+ EYIH + ++ L+KQI+ QC  FK+G+ SV+  + L + +  +L  LIS
Sbjct:  374 LRKCVEMLNEQQRVNCILSTIEHSQSDPAALLQPLCRLCHHLLITNKLAVHKYKLL---YMLAFKPMFLKHLWT---NLTSIRQTSLFGGSGAAATP-------LLQIISRGIALSAEDTERIVPLLAVFCSLFSLLIATLHDTEFFLEQNNSAEQIPNNRQQHAMPFTIAELAILSGHLKGVCLGLVELAFPDTRPTVRDDYKNAVLGPTSTVQGRHDTQIWTHLFKVMVGLLR--QLHTRDLRRQFCPANHWIASNVVIPIDKPQDFAFRRRRLRGYVPFQSLRAFTREEFE----------------EGPPLSATEVRTLTLLREIPFVVPFNNRVVVFQSLIYKDKAEQQGELTHFMQGP---SIQISVRRNYLYEDAFEKLSRENEPELRLKMRVQLVNTAGLEEAGVDGGGL-FREFLSELLKTSFDPNRGFFKLTKDNMLYPNPTVHLLVDDFPKHYYFIGRILGKALYENLLVELPFAEFFLSKIVGRQSDV-DVHHLASLDPIMYRNLLYLKSYMGDVADLNLDFTVLSDELGERRVDELKPSGANIPVTNHNRIEYIHLMADYKLNKQIRAQCYAFKQGIGSVVPLDWLQMFNNKELQVLIS 949          
BLAST of Ubiquitin-ligase E3C vs. TrEMBL
Match: A0A151IE76 (Ubiquitin-protein ligase E3C OS=Cyphomyrmex costatus OX=456900 GN=ALC62_10298 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.128e-24
Identity = 144/621 (23.19%), Postives = 262/621 (42.19%), Query Frame = 3
Query: 1470 IRECI-----SQNINEVLKIAFTGLLDPDVVL-PLAYLYQNL--TKDLKLSKSTIIGCRMILSKNVAFMRYLW-SLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAE--TRRKSSSSYGPSPAAVCSNFLLW--PELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHC-------QCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCS------------IDEILMDFDFENLR----------KLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIET--YFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPV-LNYSTEFWICKNEIILNNETLP---------IPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +R+CI      + +NE+L        DP V+L PL  L  +L  T  L + K  ++    +L+    F+++LW SL     TS    F  G+           + + ++IS G  +S ED  R + +L+      +  + TL+  E    + S+         +  N + +   EL  M+  L  + +GL+++A         D   N         QC  +T+  +H   + K    +LR L     H   L   +C             ID+   DF F   R          + F++E+ E                E   +   E+  L LL+ +P       ++ + ++  Y D+ +Q  +  + +  P   +I I  +++ + +D    + L    E  +     ++N   L            +F+S++L    DP    F    + +LYPNP V+  + DF  +Y + G+I    +     ++  F+ FFL K++   +S  +++ L ++D  + +NLL L     ++      F +  +  G+    E+  +GA I VT+ N+ EYIH + ++ L+KQI+ QC  FK G+ SV+  + L + +  +L  LIS
Sbjct:  375 LRKCIEILNEQERVNEILSAIEQSQSDPPVLLQPLCRLCHHLLITNKLAVQKYKLL---YMLAFKPVFLKHLWISLASIRQTS---LFGGGTA----------TSLLQIISRGIALSTEDTDRIVPLLAVFCSLFSLLIATLHDTEFFLEQTSAEHMSNDCTYIQQNAMPFTIAELAVMSGHLKGVCLGLVELAFPDTRPTVRDDYRNAVLGLTSAIQCRHDTQIWTH---LFKVTVGLLRQL-----HTRDLRRQFCPEGHWIASNVVIPIDKP-QDFAFRRRRLRGYVPFQNLRAFTREEFE----------------EGPPLSATEVRTLTLLREIPFVVPFNNRVVVFQSLIYKDKAEQQGELAHFMQGP---SIQISVRRNYLYEDAFDKLSLENEPELRLKMRVQLVNTAGLEEAGVDGGGLFREFLSELLKTSFDPNRGFFKLTKDNMLYPNPTVQLLFDDFPKHYYFIGRILGKALYENLLVELPFAEFFLSKIVG-RQSDVDVHHLASLDPVMYRNLLSLKTYTGDVSELGLDFTVLSDELGERRIDELKPSGANITVTEHNRIEYIHLMADYKLNKQIRAQCFAFKNGIGSVVPLDWLQMFNNKELQVLIS 950          
BLAST of Ubiquitin-ligase E3C vs. TrEMBL
Match: A0A293L7M4 (HECT domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 9.561e-24
Identity = 66/197 (33.50%), Postives = 110/197 (55.84%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENF--YSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYS 3182
            +F++++L    DP   LF C  ++ LYPNP V     Y D+  +Y + G++ A  I  G  ++   + FFLEK++   +   +I+ L ++D  V +NLL L + + ++      F +T +  G+    E+  NGA IPVT  N+ EYIH + ++ L+KQI+ QC  FK+G+  V+    LS+ S  +L  LIS  ++
Sbjct:  733 EFMNELLRTTFDPNRGLFRCTYDRRLYPNPGVGLLPDYRDYHRHYTFAGRMLAKAIYEGMLVELPLAVFFLEKILCPGD--LDIHHLASLDPLVYRNLLYLKRYEGDVSDLGLDFTVTNSDLGESKIEELKPNGASIPVTAANRIEYIHLMADYRLNKQIRTQCLAFKRGLAEVLQAEWLSLFSARELQTLISGAHT 927          
BLAST of Ubiquitin-ligase E3C vs. TrEMBL
Match: A0A1B6EYS1 (HECT domain-containing protein OS=Cuerna arida OX=1464854 GN=g.19446 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.495e-23
Identity = 115/511 (22.50%), Postives = 221/511 (43.25%), Query Frame = 3
Query: 1728 RTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKE--IQSILRLLRIFYVHIDKLNVDYCS-----IDEILMDFDFEN-----------LRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYF--DQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPV-LNYSTEFWICKNEIILNNETLP---------IPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +TS F   + +  VIS G  ++ ++  R + +L+T     +  + TL+ AE               V +       L  MT +L  +S+GL+++A          I ++  + ++     +H  TI+     ++ + LLR  Y     L   YC        ++ M    +            LR+ +     E  F   EL        E       E+  L +LK +P     + ++ + ++    D++      +  +  P   AI+I+ +++ + +D    + L    E  +     ++N   L            +F+S++L    DP    F    + LLYPNP+V   + +F  ++ + G++    +     ++   + FF+ K++  +  V +++ L ++D  + +NLL L   + ++      F +  +  G+    E+  NGA IPVT  N+ EYIH V ++ L+KQIK+QC  FK+G+ +V+S   L + S+ +   LIS
Sbjct:  445 QTSLFGSPTPLLNVISRGIAMTEQETERIVPLLATFCSLFSLLVATLHDAEFYNDDDVMV----RGVATMPFPLSTLVAMTMKLKEVSLGLVELAFPDSR----PIVKDQYRSAVCVDETTHANTIMWSHLFKACVSLLRQLYGR--DLRRSYCPDGHWISQQVTMSLAMDRPSDATLRRRSRLRQHYRPFHFEPAFTREELE-------EGPPPSTKEVRTLTILKEIPFVVAFQERVIVFQSLVLKDKVNHHSTARTFLHGP---AISIVVRRNYLYEDAFDKLSLENEPELQLAMRVQLVNTMGLDEAGVDGGGVFREFLSELLKTAFDPNRGFFRLTKDNLLYPNPHVHLLHPNFLKHFYFIGRMLGKALYENLLVELPLAEFFMSKVIGRHSDV-DMHHLASLDPVMYRNLLYLKNYEGDVTELGLDFTVVHDELGETKVDELKPNGANIPVTSANRIEYIHLVADYKLNKQIKMQCSTFKQGLANVVSLEWLQMFSSKEFQVLIS 934          
BLAST of Ubiquitin-ligase E3C vs. TrEMBL
Match: A0A553PCF9 (HECT domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_11245 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.364e-22
Identity = 60/191 (31.41%), Postives = 103/191 (53.93%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L    DP    F    +QLLYPNP VE    DF  +Y + G+     +   + ++   + FFL KL+  +    +I+ L+++D E+ KNLL L   + ++      F +     GK   +E+   GA  PV  +N+ EYIH V ++ L++QI+ QC  F++G+  V++ + L + S  +L  LIS
Sbjct:  769 EFMTELLKTAFDPNRGFFRLTKDQLLYPNPTVEQIEPDFTPHYYFIGRALGKALYENHLVELPLASFFLSKLLGQHSVNVDIDHLSSLDPELYKNLLYLKTYEGDVLDLGLDFTMVSEEVGKTSVHELRPGGADTPVNNENRIEYIHLVADYKLNRQIRAQCNAFRQGLSDVINLDWLRMFSYRELQTLIS 959          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Cavefish
Match: ube3c (ubiquitin protein ligase E3C [Source:NCBI gene;Acc:103025647])

HSP 1 Score: 101.293 bits (251), Expect = 3.009e-21
Identity = 55/195 (28.21%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDY 3179
            +F+S++L +G +P    F      LL+P+P  E    + F  +Y + G+I    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL +   + +++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    ++  LIS  +
Sbjct:  724 EFLSELLKSGFNPNQGFFRTTNEGLLFPSPTAEMLIGESFTRHYYFLGRILGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFMKSYEGDVEDLGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRAHCLAFRQGLANVVNLEWLRMFDQQEIQVLISGAH 917          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Cavefish
Match: ube3c (ubiquitin protein ligase E3C [Source:NCBI gene;Acc:103025647])

HSP 1 Score: 101.293 bits (251), Expect = 3.134e-21
Identity = 55/195 (28.21%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDY 3179
            +F+S++L +G +P    F      LL+P+P  E    + F  +Y + G+I    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL +   + +++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+KQI+  C  F++G+ +V++   L +    ++  LIS  +
Sbjct:  773 EFLSELLKSGFNPNQGFFRTTNEGLLFPSPTAEMLIGESFTRHYYFLGRILGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFMKSYEGDVEDLGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKQIRAHCLAFRQGLANVVNLEWLRMFDQQEIQVLISGAH 966          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Cavefish
Match: ube3b (ubiquitin protein ligase E3B [Source:NCBI gene;Acc:111196222])

HSP 1 Score: 95.9005 bits (237), Expect = 1.516e-19
Identity = 56/196 (28.57%), Postives = 105/196 (53.57%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    +P  +LF +  GN+ LYP+P   N + +    +E+ GK+    +  G  +   F+ FFL +++  + S +  +I++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  +PVT +NK  YIH +  F +  QIK Q   F +G  S+++   L + ST ++ +LIS D
Sbjct:  734 EFLEEIIKKVFNPALNLFKTTSGNERLYPSP-TSNIHENHLQLFEFVGKMLGKALYEGIVVDVPFASFFLSQVLGHHHSSFYSSIDELPSLDSEFYKNLTSIKRYDGDVSDLGLTLSYDEDVMGQLVCHELIPGGKTMPVTNENKISYIHLMAHFRMHTQIKEQTGAFIRGFRSIINPEWLHMFSTPEVQRLISGD 928          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Cavefish
Match: ube3b (ubiquitin protein ligase E3B [Source:NCBI gene;Acc:111196222])

HSP 1 Score: 95.9005 bits (237), Expect = 1.516e-19
Identity = 56/196 (28.57%), Postives = 105/196 (53.57%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    +P  +LF +  GN+ LYP+P   N + +    +E+ GK+    +  G  +   F+ FFL +++  + S +  +I++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  +PVT +NK  YIH +  F +  QIK Q   F +G  S+++   L + ST ++ +LIS D
Sbjct:  734 EFLEEIIKKVFNPALNLFKTTSGNERLYPSP-TSNIHENHLQLFEFVGKMLGKALYEGIVVDVPFASFFLSQVLGHHHSSFYSSIDELPSLDSEFYKNLTSIKRYDGDVSDLGLTLSYDEDVMGQLVCHELIPGGKTMPVTNENKISYIHLMAHFRMHTQIKEQTGAFIRGFRSIINPEWLHMFSTPEVQRLISGD 928          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Cavefish
Match: ube3b (ubiquitin protein ligase E3B [Source:NCBI gene;Acc:111196222])

HSP 1 Score: 95.5153 bits (236), Expect = 1.607e-19
Identity = 56/196 (28.57%), Postives = 105/196 (53.57%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    +P  +LF +  GN+ LYP+P   N + +    +E+ GK+    +  G  +   F+ FFL +++  + S +  +I++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  +PVT +NK  YIH +  F +  QIK Q   F +G  S+++   L + ST ++ +LIS D
Sbjct:  629 EFLEEIIKKVFNPALNLFKTTSGNERLYPSP-TSNIHENHLQLFEFVGKMLGKALYEGIVVDVPFASFFLSQVLGHHHSSFYSSIDELPSLDSEFYKNLTSIKRYDGDVSDLGLTLSYDEDVMGQLVCHELIPGGKTMPVTNENKISYIHLMAHFRMHTQIKEQTGAFIRGFRSIINPEWLHMFSTPEVQRLISGD 823          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Sea Lamprey
Match: ube3c (ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-GENE-040426-1211])

HSP 1 Score: 99.7525 bits (247), Expect = 1.662e-21
Identity = 56/192 (29.17%), Postives = 97/192 (50.52%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F++++L  G +P    F      LLYPNP       D F  +Y + G++    +     ++  F+ FFL KL+     V +I+ L ++D EV +NLL L     +++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L++QI+  C  F++G+ +V++   L +    +L  L+S
Sbjct:  783 EFLNELLKTGFNPHQGFFRTTNQGLLYPNPEARLLVGDGFTRHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTTGDV-DIHHLASLDPEVYRNLLFLKSYQGDVEELGLNFTVVNNELGEAQVVELKAGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLATVINLEWLRMFDEQELQVLLS 973          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Sea Lamprey
Match: ube3b (ubiquitin protein ligase E3B [Source:ZFIN;Acc:ZDB-GENE-060526-231])

HSP 1 Score: 84.7297 bits (208), Expect = 8.334e-17
Identity = 55/196 (28.06%), Postives = 100/196 (51.02%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCD-GNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESV--YNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    DP  +LF    G++ LYP+P     + +     E+ GK+    +  G  +   F+PFFL ++  ++ S+   +I++L ++D E  KNL  + + D ++      F   ++  GKL  YE+   G    VT +NK  YIH +    +  +IK Q   F  G +S++S   + + ST ++ +LI+ D
Sbjct:  745 EFLEEIIKKVFDPELNLFKITIGDERLYPSP-TSYVHENHLQLMEFVGKMLGKAVYEGIVVDVPFAPFFLSQVRGVHTSMPYSSIDELPSLDAEFYKNLTSIKRYDGDVSELGLTFSYEEDIMGKLVCYELCPGGKTTLVTNENKISYIHMLAHHRMYVKIKKQTGAFIHGFKSLISPEWMGMFSTPEMQRLIAGD 939          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Sea Lamprey
Match: nedd4a (NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;Acc:ZDB-GENE-051005-2])

HSP 1 Score: 64.3142 bits (155), Expect = 9.823e-11
Identity = 43/152 (28.29%), Postives = 82/152 (53.95%), Query Frame = 3
Query: 2721 YYEYFGKIFALNILHGNGLKRRF-SPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDD-ELDCFNFKFVLTQNTFGK-LHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            Y+ + G++  + + HG  L   F  PF+  K+M   +    +ND+ +VD E   +L+ + + D  +LD    +F + +  FG+  H  E+  NG++I VT +NK EYI  VI++   ++++ Q   F +G   ++  +++ I   N+L  L+
Sbjct:  227 YFTFIGRVAGMAVFHGKLLDGFFIRPFY--KMML--QKPITLNDMESVDSEYYNSLMWILENDPADLD---LRFCIDEEMFGQQTHLVELKPNGSEILVTNENKKEYIELVIQWRFVERVQKQINAFMEGFSELIPMDLIKIFDENELELLM 371          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Sea Lamprey
Match: wwp2 (WW domain containing E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-000607-82])

HSP 1 Score: 56.6102 bits (135), Expect = 3.028e-8
Identity = 49/171 (28.65%), Postives = 83/171 (48.54%), Query Frame = 3
Query: 2628 LDPVNHLFSCDG--NQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFS-PFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNIL 3131
            L+P+  LF   G  N  L  NP   +   D   Y+ + G+  A+ + HG  +   FS PF+  K M LN+ +  I DL ++D E   +L+ L   + E       F +     GK+ ++++  +G+ I VT++NK EYI  + E+   + ++ Q + F  G   V+    L
Sbjct:  634 LNPMYCLFEYAGKNNYCLQINP-ASSINPDHLAYFRFIGRFIAMALYHGKFIDTGFSLPFY--KRM-LNKKL-TIKDLESIDPEFYNSLIWLRDNNIEECGLEMFFSVDMELLGKVSSHDLKPDGSDILVTEENKEEYIGLMTEWRFSRGVEEQTKAFLDGFSEVVPLQWL 799          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Sea Lamprey
Match: AREL1 (apoptosis resistant E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:20363])

HSP 1 Score: 55.8398 bits (133), Expect = 3.877e-8
Identity = 61/257 (23.74%), Postives = 119/257 (46.30%), Query Frame = 3
Query: 2472 ITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETL-----PIPKFISQILDAGLDPVNHLFS--CDGNQ-LLYPNPYVENFYSDFKVYYEYFGKIFA-------LNILHGNGLKRRFSPFFLEKLMFLN-ESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTF---GKL-HTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKK-----GMESVMSTNILSILSTNDLHKLI 3167
            I++   +  ++   +  V N+S+  W    E+   NE       P  ++   +  A  +P N LF+   D NQ L++PNP+  + +   ++Y E  G++         L   +   ++ RF+  FL +L+ L+   +Y   + +  +    K   +L+    E+D       L++  +   GKL    ++V  G+ I VT  NK  Y++ + ++ L  Q++ + EHF K     G+  ++  N+L+I   N+L  L+
Sbjct:  244 ISLRVSRQCLLDSSVKAVRNFSSNDWFRSFEVTFENEEALDRGGPRREWFELMCKALFEPANKLFTHFVDDNQALVHPNPHRPH-HMRLRLY-ELAGRLVGKCLFETSLGDTYRQLVRARFTRSFLAQLIGLHVRFLYFYFETDDPEFYKTKVSFVLNNDVSEMD-----LTLSEEVYDEQGKLSQLVDLVPGGSGIGVTNANKLAYLNVLAQYRLATQVRTEVEHFLKVLSIKGLNEMVPENLLAIFDENELEMLM 493          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Yeast
Match: HUL5 (Multiubiquitin chain assembly factor (E4); proteasome processivity factor that elongates polyUb chains on substrates, opposing Ubp6p, a branched polyubiquitin protease; required for retrograde transport of misfolded proteins during ERAD; required for ubiquitination of a subset of cytosolic misfolded proteins upon heat shock [Source:SGD;Acc:S000003109])

HSP 1 Score: 59.3066 bits (142), Expect = 2.832e-9
Identity = 52/197 (26.40%), Postives = 99/197 (50.25%), Query Frame = 3
Query: 2598 KFISQILDAGL-DPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYF-GKIFALNILHGNGLKRRFSPFFLEKLM-FLNESVYNINDLNTVDMEVAKNLL-LLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F++ + D G  DP + LF  +    LYP+      Y   K+ Y +F GK+    +     +   F+ FFL+KL+ + N  + + +DL + D  +  NL+ LL+ T DE+   +  F + +         +++ NG+K  VTKDN   Y+  V ++ L+K+       F  G+  +++ + + + ++ +L  LIS +
Sbjct:  604 EFLTTVSDEGFKDPKHELFRTNDRYELYPSV----VYDATKLKYIWFLGKVVGKCLYEHVLIDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDEPE-SSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWMEMFNSIELQMLISGE 795          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Yeast
Match: RSP5 (NEDD4 family E3 ubiquitin ligase; regulates processes including: MVB sorting, the heat shock response, transcription, endocytosis and ribosome stability; ubiquitinates Sec23p, Sna3p, Ste4p, Nfi1p, Rpo21p and Sem1p; autoubiquitinates; deubiquitinated by Ubp2p; regulated by SUMO ligase Siz1p, in turn regulates Siz1p SUMO ligase activity; required for efficient Golgi-to-ER trafficking in COPI mutants; mutant tolerates aneuploidy; human homolog implicated in Liddle syndrome [Source:SGD;Acc:S000000927])

HSP 1 Score: 54.6842 bits (130), Expect = 7.812e-8
Identity = 44/168 (26.19%), Postives = 80/168 (47.62%), Query Frame = 3
Query: 2721 YYEYFGKIFALNILHGNGLKRRF-SPFFLEKL--MFLNESVYNINDLNTVDMEV--AKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS-------KDYSKH 3188
            Y+++ G++  L + H     RRF   FF+  L  M L + V  + D+  VD EV  + N +L +  D  LD     F      FG++ T ++  +G  I VT  NK EY+    ++ +  +++ Q + F  G   ++  +++++    +L  LI        +D+ KH
Sbjct:  544 YFKFIGRVVGLGVFH-----RRFLDAFFVGALYKMMLRKKVV-LQDMEGVDAEVYNSLNWMLENSIDGVLD---LTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKH 702          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Yeast
Match: HUL4 (Protein with similarity to hect domain E3 ubiquitin-protein ligases; not essential for viability; found in association with Trf4 in TRAMP complex [Source:SGD;Acc:S000003797])

HSP 1 Score: 53.5286 bits (127), Expect = 1.648e-7
Identity = 46/170 (27.06%), Postives = 84/170 (49.41%), Query Frame = 3
Query: 2706 SDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLL-LLSKTDDEL-DCFNFKF---------VLTQNTFGKLH-TYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMS-TNILSILSTNDLHKLISKD 3176
            S  ++YY  FG +  L I +   L  +F     +KL        +  D + +  E ++NL+ +L+ T+D   D F+  F         +L  +   K + T E+ ENG  +P+T+ NK+E++   +EF L+K I+ Q   F  G + V +  N + + ++ +L +L+  D
Sbjct:  610 SQLELYY-LFGVVMGLAIFNSTILDLQFPKALYKKLC---SEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDSKSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLFNSEELERLVCGD 775          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Yeast
Match: TOM1 (E3 ubiquitin ligase of the hect-domain class; has a role in mRNA export from the nucleus and may regulate transcriptional coactivators; involved in degradation of excess histones; interacts with Dia2p and is required for Dia2p degradation; required to target Cdc6p for ubiquitin-mediated destruction during G1 phase [Source:SGD;Acc:S000002865])

HSP 1 Score: 49.2914 bits (116), Expect = 4.410e-6
Identity = 29/111 (26.13%), Postives = 62/111 (55.86%), Query Frame = 3
Query: 2838 NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            ++ D+ ++D +  K+L+ + + +D  D     F +  + +G+     ++E G  I VT+ NK +Y+  V+E+ L   +K Q ++F  G  +++S ++++I    +L  LIS
Sbjct: 3037 SLKDMESLDPDYYKSLVWILE-NDITDIIEETFSVETDDYGEHKVINLIEGGKDIIVTEANKQDYVKKVVEYKLQTSVKEQMDNFLVGFYALISKDLITIFDEQELELLIS 3146          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Nematostella
Match: EDO47399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLV6])

HSP 1 Score: 80.4925 bits (197), Expect = 2.280e-15
Identity = 51/197 (25.89%), Postives = 101/197 (51.27%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF--SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNES--VYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ + +    DP  +LF  +    Q LYP+P     + +  + YE+ GK+    +  G  ++  F+ FFL  ++    S    +I++L ++D E+ K+L  +   D ++   +  F   ++  GK+ T+++   G  I V+ +NK  Y+H +  + +  QI+ Q   F +G +S++  + L + S  +L +LIS D
Sbjct:  635 EFLEETIKHAFDPAFNLFKVTTGEEQRLYPSP-TSFIHDNHLLLYEFVGKMLGKAVYEGIVVEVPFAFFFLNHVLGNQHSNLYSSIDELPSLDQELYKSLTFIKHYDGDIRDLDLTFSFDEDVLGKVVTHQLKPGGTAIVVSDENKISYVHLMAHYRMCIQIREQTRAFIRGFKSIVHNDWLRMFSAPELQRLISGD 830          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Nematostella
Match: EDO34592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX9])

HSP 1 Score: 75.485 bits (184), Expect = 9.185e-14
Identity = 65/259 (25.10%), Postives = 113/259 (43.63%), Query Frame = 3
Query: 2442 YTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAG--------------LDPVNHLFS-CDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNL-LLLSKTDDEL-DCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            +  VNP    + I  ++DSI++D L  +   S        ++I  NE         + +DAG              LDP   +F+  + +Q ++ N    +   +    +   G I  L I +      RF P   +KL+       N++D       VA+NL  LL  +DD+L D F   F + +  +G L   ++V  G ++PVT+DN+ +Y+   I++ L K +  Q E F  G   V   ++L      +L +++
Sbjct:  696 FVPVNPVNPCLVIKVRRDSIVQDTLTQITTQSPYDLKKPLKVIFANE---------EAVDAGGVKKEFFLLLLTEILDPKYGMFTYLEDSQTIWFN----DLTFEESPMFLLIGVICGLAIYNSTIFDLRFPPVLYKKLL---RKKPNLDDFRGFQPSVARNLQYLLDYSDDDLEDTFGLNFQIMREKYGALEYIDLVPGGGEVPVTQDNREQYVELYIDYYLSKAVDKQFEAFFTGFHRVCGGHVLEFFHPQELMEMV 938          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Nematostella
Match: EDO49327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD5])

HSP 1 Score: 62.7734 bits (151), Expect = 2.888e-10
Identity = 38/136 (27.94%), Postives = 74/136 (54.41%), Query Frame = 3
Query: 2709 DFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVM 3116
            D  +Y+++ G+  A+ + HG  + R F+  F +++  LN+ +  + DL T+D E   +L+ + + + E       F +     GK+ ++++   G  I VT++NK EYI  + E+ L++ I+ Q   F +GM  V+
Sbjct:   94 DHLMYFKFIGRFIAMALYHGKFIDRGFTLPFYKRM--LNKKLL-MKDLETIDPEFYNSLVWVKENNIEECGLEMFFTVDMELLGKVTSHDLKPGGTDIAVTEENKEEYISLMTEWRLNRGIEEQTRAFLEGMHEVL 226          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Nematostella
Match: EDO49383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG94])

HSP 1 Score: 62.003 bits (149), Expect = 5.207e-10
Identity = 37/161 (22.98%), Postives = 86/161 (53.42%), Query Frame = 3
Query: 2688 YVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            YV+N +     ++ + G+I  L I+H + L   F+  F + L+    S+ +++D+  +D    +++  + + D E D  +  F +++  FG++   E++  G  I VT+ NK +Y+ +++++ +++ +  Q E   +G   V+   +++I    +L  +IS
Sbjct:   66 YVDNSHE----WFRFCGRIVGLVIIHQHLLDAFFTRTFYKALL---RSLCDLSDVEALDALFHQSMTWVIENDIE-DVLDLTFSVSEEIFGQVTERELIPGGKDIAVTEQNKGDYVAEMVKWRVERGVSEQMESIVRGFNEVIDPALVNIFDARELELVIS 218          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Nematostella
Match: EDO40302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7U7])

HSP 1 Score: 61.6178 bits (148), Expect = 1.395e-9
Identity = 41/149 (27.52%), Postives = 72/149 (48.32%), Query Frame = 3
Query: 2724 YEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNL-LLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            +E  G +  L I +G  L   F     +KL     S   + DL  V   +  +L  LL    D  D F + F ++  ++GK+   E++ NGA++PV  +N+ E++H  +++LL   +  Q + F  G   V   + L++   ++L  LI
Sbjct:  436 FELVGIVLGLAIYNGIILDIHFPQVIYKKLQGQTPS---LEDLIGVQPSLGNSLKQLLEYEGDVEDTFCYTFQVSAMSYGKVCDRELIPNGAEVPVNNENREEFVHRYVKYLLVDSVAKQFDAFSAGFHKVCGGSALTLFCADELELLI 581          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Medaka
Match: ube3c (ubiquitin protein ligase E3C [Source:NCBI gene;Acc:101155064])

HSP 1 Score: 104.76 bits (260), Expect = 2.352e-22
Identity = 57/195 (29.23%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDY 3179
            +F++++L +G +P    F      LLYPNP  E    + F  +Y + G+I    +     ++  F+ FFL KL+  +  V +I+ L ++D E+ +NLL L   +D+++     F +  N  G+    E+   G  IPVT  N+  YIH V ++ L+K ++  C  F++G+ +V++   L +    ++  LIS  Y
Sbjct:  773 EFLNELLKSGFNPNQGFFKTTNEGLLYPNPAAEMLVGESFTRHYYFLGRILGKALYENMLVELPFASFFLSKLLGTSADV-DIHHLASLDPEMYRNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKPGGKDIPVTTANRIAYIHLVADYRLNKHMRPHCLAFRQGLANVVNLEWLRMFDQQEIQVLISGAY 966          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Medaka
Match: ube3b (ubiquitin protein ligase E3B [Source:NCBI gene;Acc:101170594])

HSP 1 Score: 92.0485 bits (227), Expect = 2.259e-18
Identity = 54/196 (27.55%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    +P  +LF +  G++ LYP+P     + +  + +E+ GK+    I  G  +   F+ FFL +++  + S +  +I++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  IPVT +NK  YIH +  F +  QIK Q   F +G   +++   L + ST ++ +L+S D
Sbjct:  733 EFLEEIIKKVFNPALNLFKTTSGDERLYPSP-TSYIHENHLLLFEFVGKMLGKAIYEGIVVDVPFASFFLSQVLGHHHSSFYSSIDELPSLDSEFYKNLTSIKRYDGDVGDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKEQTAAFIRGFRCIINPEWLHMFSTPEVQRLVSGD 927          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Medaka
Match: ube3b (ubiquitin protein ligase E3B [Source:NCBI gene;Acc:101170594])

HSP 1 Score: 91.6633 bits (226), Expect = 2.334e-18
Identity = 54/196 (27.55%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLF-SCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY--NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ +I+    +P  +LF +  G++ LYP+P     + +  + +E+ GK+    I  G  +   F+ FFL +++  + S +  +I++L ++D E  KNL  + + D ++          ++  G+L  +E++  G  IPVT +NK  YIH +  F +  QIK Q   F +G   +++   L + ST ++ +L+S D
Sbjct:  672 EFLEEIIKKVFNPALNLFKTTSGDERLYPSP-TSYIHENHLLLFEFVGKMLGKAIYEGIVVDVPFASFFLSQVLGHHHSSFYSSIDELPSLDSEFYKNLTSIKRYDGDVGDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKEQTAAFIRGFRCIINPEWLHMFSTPEVQRLVSGD 866          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Medaka
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:101174746])

HSP 1 Score: 69.3218 bits (168), Expect = 1.797e-11
Identity = 49/182 (26.92%), Postives = 88/182 (48.35%), Query Frame = 3
Query: 2628 LDPVNHLFSCDG--NQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            L+P+  LF   G  N  L  NP   +   D   Y+ + G+  A+ + HG  +   FS  F +++  LN+ +  + DL ++D E   +L+ +   + E  C    F + +   G++ T+E+   G  I VT++NK EYI  V E+ L + ++ Q + F +G   V+    L      +L  ++
Sbjct:  489 LNPMYCLFEYAGKDNYCLQINP-ASSINPDHLKYFRFIGRFIAMALFHGKFINTGFSLPFYKRI--LNKPL-AVKDLESIDPEFYNSLMWIKDNNIEECCLEMFFSVDKEILGEITTHELKPGGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVML 666          
BLAST of Ubiquitin-ligase E3C vs. Ensembl Medaka
Match: itchb (E3 ubiquitin-protein ligase Itchy [Source:NCBI gene;Acc:101174746])

HSP 1 Score: 67.3958 bits (163), Expect = 6.262e-11
Identity = 49/182 (26.92%), Postives = 88/182 (48.35%), Query Frame = 3
Query: 2628 LDPVNHLFSCDG--NQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLI 3167
            L+P+  LF   G  N  L  NP   +   D   Y+ + G+  A+ + HG  +   FS  F +++  LN+ +  + DL ++D E   +L+ +   + E  C    F + +   G++ T+E+   G  I VT++NK EYI  V E+ L + ++ Q + F +G   V+    L      +L  ++
Sbjct:  579 LNPMYCLFEYAGKDNYCLQINP-ASSINPDHLKYFRFIGRFIAMALFHGKFINTGFSLPFYKRI--LNKPLA-VKDLESIDPEFYNSLMWIKDNNIEECCLEMFFSVDKEILGEITTHELKPGGGDIQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELEVML 756          
BLAST of Ubiquitin-ligase E3C vs. Planmine SMEST
Match: SMESG000068094.1 (SMESG000068094.1)

HSP 1 Score: 1990.31 bits (5155), Expect = 0.000e+0
Identity = 1009/1009 (100.00%), Postives = 1009/1009 (100.00%), Query Frame = 3
Query:  162 MNSKSMKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTVSDEEKLLTLXXXXXXXXXXXXDSERMFKAISYVLTREHSKIIMSWLKQKKADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDENFILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIETWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIMNMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHASITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKXXXXXXXXXXXXXXXXICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQIIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLKIAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH 3188
            MNSKSMKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTVSDEEKLLTLFKCFNNFFNKKFDSERMFKAISYVLTREHSKIIMSWLKQKKADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDENFILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIETWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIMNMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHASITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKLNSNPSLGLLSLLVSGICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQIIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLKIAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH
Sbjct:    1 MNSKSMKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTVSDEEKLLTLFKCFNNFFNKKFDSERMFKAISYVLTREHSKIIMSWLKQKKADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDENFILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIETWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIMNMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHASITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKLNSNPSLGLLSLLVSGICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQIIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLKIAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH 1009          
BLAST of Ubiquitin-ligase E3C vs. Planmine SMEST
Match: SMESG000068094.1 (SMESG000068094.1)

HSP 1 Score: 1980.3 bits (5129), Expect = 0.000e+0
Identity = 1004/1004 (100.00%), Postives = 1004/1004 (100.00%), Query Frame = 3
Query:  177 MKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTVSDEEKLLTLXXXXXXXXXXXXDSERMFKAISYVLTREHSKIIMSWLKQKKADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDENFILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIETWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIMNMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHASITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKXXXXXXXXXXXXXXXXICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQIIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLKIAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH 3188
            MKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTVSDEEKLLTLFKCFNNFFNKKFDSERMFKAISYVLTREHSKIIMSWLKQKKADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDENFILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIETWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIMNMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHASITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKLNSNPSLGLLSLLVSGICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQIIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLKIAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH
Sbjct:    1 MKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTVSDEEKLLTLFKCFNNFFNKKFDSERMFKAISYVLTREHSKIIMSWLKQKKADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDENFILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIETWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIMNMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHASITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKLNSNPSLGLLSLLVSGICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQIIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLKIAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYLWSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHRFISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELWNMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIKEIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESVFDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYFDQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKNEIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKDYSKH 1004          
BLAST of Ubiquitin-ligase E3C vs. Planmine SMEST
Match: SMESG000055056.1 (SMESG000055056.1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.195e-20
Identity = 61/195 (31.28%), Postives = 107/195 (54.87%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD-FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVY---NINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            +F+  I+    DP   LF    N L+YPNP +E  Y D ++ + ++FG++  L I  G  ++  F+PFF++KL F N S     +I++L  +D ++ +NLL L K+ D ++  N  F ++++ +G   T E+  NG  I VT  NK EYI+ V ++ L++QI  Q      G+  V+      +   +++  +I+
Sbjct:  780 EFLRNIIKEACDPKRGLFVSTKNNLIYPNPELETLYPDNWQEHLDFFGRMLGLMIFKGLLVEASFAPFFIQKL-FNNSSSREEIDIDNLQYLDEDLYRNLLSL-KSMDRVEEINLDFTVSRSCYGVSQTVELKPNGEHISVTNSNKIEYIYLVADYKLNRQISKQTSLIINGLNDVVPIECFQLFDLDEISFIIT 972          
BLAST of Ubiquitin-ligase E3C vs. Planmine SMEST
Match: SMESG000048038.1 (SMESG000048038.1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.277e-17
Identity = 54/195 (27.69%), Postives = 102/195 (52.31%), Query Frame = 3
Query: 2598 KFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSDFKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNES-VYN-INDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLISKD 3176
            +F+ + L   L+P  +LF    +  LYP+P    +  +  + ++Y G++ A  I     ++  F+ FFL +++   +S +Y+ I++LNT+D ++ K+L  +   D ++      F   ++  GK+ T+++   G  I VT D K  Y+H V  F + +QI+ Q   FK G  S++  +   + S  ++ KLI  D
Sbjct:  770 EFLEETLKTLLNPSLNLFCTTSDNRLYPSPLSGLYEQNHLLLFQYLGRMMAKAIYEEILIEAPFANFFLTQVLHKEQSNMYSFIDELNTLDKDLYKSLTYVKHYDGDVSDLELTFSYDEDRLGKIETHDLRPGGRYITVTNDTKISYVHIVARFRMFQQIRDQTRAFKMGFYSIIQRDWFDMFSVPEMLKLICGD 964          
BLAST of Ubiquitin-ligase E3C vs. Planmine SMEST
Match: SMESG000030063.1 (SMESG000030063.1)

HSP 1 Score: 63.929 bits (154), Expect = 5.246e-10
Identity = 39/150 (26.00%), Postives = 76/150 (50.67%), Query Frame = 3
Query: 2721 YYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTVDMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVTKDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHKLIS 3170
            Y+ + G++  + I HG  +   F   F + +  LN+    + D   +D  +  +L+ +   + +    N  F + Q  FG+L   ++ ENG  IPVT ++K++YI   +++ L ++   Q E  KKG+  V+   IL  L+ ++   L++
Sbjct:  531 YFHFIGRVIGMAIFHGYYIDADFCKIFYKSI--LNKQP-QLEDFEELDKSIYNSLVWMRDNNIDDADLNLTFSIEQEVFGQLELIDLCENGRFIPVTDNSKSQYIERYVDYNLSEKCAEQYEQIKKGIYEVLPQQILDNLNEDEFEVLLT 677          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-ligase E3C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE3C9.306e-2330.73ubiquitin protein ligase E3C [Source:HGNC Symbol;A... [more]
UBE3B1.496e-1928.57ubiquitin protein ligase E3B [Source:HGNC Symbol;A... [more]
UBE3B1.496e-1928.57ubiquitin protein ligase E3B [Source:HGNC Symbol;A... [more]
NEDD45.272e-1328.57NEDD4 E3 ubiquitin protein ligase [Source:HGNC Sym... [more]
NEDD46.149e-1328.57NEDD4 E3 ubiquitin protein ligase [Source:HGNC Sym... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxi-15.303e-1725.13OXidative stress Induced [Source:UniProtKB/TrEMBL... [more]
Y92H12A.23.358e-1532.18E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-16.266e-1229.19E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-16.266e-1229.19E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
wwp-16.289e-1229.19E3 ubiquitin-protein ligase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG33563.592e-2129.32gene:FBgn0034989 transcript:FBtr0072262[more]
CG50871.831e-1624.24gene:FBgn0035953 transcript:FBtr0333908[more]
CG50871.863e-1624.24gene:FBgn0035953 transcript:FBtr0076520[more]
Nedd42.159e-1129.33gene:FBgn0259174 transcript:FBtr0300520[more]
Nedd42.175e-1129.33gene:FBgn0259174 transcript:FBtr0299642[more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube3c1.388e-2128.28ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-... [more]
ube3c3.092e-2128.21ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-... [more]
ube3b6.310e-1928.06ubiquitin protein ligase E3B [Source:ZFIN;Acc:ZDB-... [more]
smurf11.090e-1027.74SMAD specific E3 ubiquitin protein ligase 1 [Sourc... [more]
nedd4a1.800e-1028.07NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;A... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpa18.873e-2330.21replication protein A1 [Source:Xenbase;Acc:XB-GENE... [more]
rpa19.467e-2330.21replication protein A1 [Source:Xenbase;Acc:XB-GENE... [more]
rpa11.032e-2230.21replication protein A1 [Source:Xenbase;Acc:XB-GENE... [more]
rpa14.112e-2129.83replication protein A1 [Source:Xenbase;Acc:XB-GENE... [more]
rpa12.249e-1930.18replication protein A1 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube3c2.377e-2230.21ubiquitin protein ligase E3C [Source:MGI Symbol;Ac... [more]
Ube3b1.251e-1928.57ubiquitin protein ligase E3B [Source:MGI Symbol;Ac... [more]
Hecw21.052e-1123.17HECT, C2 and WW domain containing E3 ubiquitin pro... [more]
Hecw21.052e-1123.17HECT, C2 and WW domain containing E3 ubiquitin pro... [more]
Nedd41.587e-1128.57neural precursor cell expressed, developmentally d... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15386|UBE3C_HUMAN4.469e-2230.73Ubiquitin-protein ligase E3C OS=Homo sapiens OX=96... [more]
sp|Q80U95|UBE3C_MOUSE1.662e-2130.21Ubiquitin-protein ligase E3C OS=Mus musculus OX=10... [more]
sp|Q7Z3V4|UBE3B_HUMAN7.184e-1928.57Ubiquitin-protein ligase E3B OS=Homo sapiens OX=96... [more]
sp|Q9ES34|UBE3B_MOUSE8.749e-1928.57Ubiquitin-protein ligase E3B OS=Mus musculus OX=10... [more]
sp|Q08CZ0|UBE3B_XENTR1.558e-1728.06Ubiquitin-protein ligase E3B OS=Xenopus tropicalis... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2A6Z22.226e-2522.55Ubiquitin-protein ligase E3C OS=Camponotus florida... [more]
A0A151IE764.128e-2423.19Ubiquitin-protein ligase E3C OS=Cyphomyrmex costat... [more]
A0A293L7M49.561e-2433.50HECT domain-containing protein (Fragment) OS=Ornit... [more]
A0A1B6EYS12.495e-2322.50HECT domain-containing protein OS=Cuerna arida OX=... [more]
A0A553PCF91.364e-2231.41HECT domain-containing protein OS=Tigriopus califo... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube3c3.009e-2128.21ubiquitin protein ligase E3C [Source:NCBI gene;Acc... [more]
ube3c3.134e-2128.21ubiquitin protein ligase E3C [Source:NCBI gene;Acc... [more]
ube3b1.516e-1928.57ubiquitin protein ligase E3B [Source:NCBI gene;Acc... [more]
ube3b1.516e-1928.57ubiquitin protein ligase E3B [Source:NCBI gene;Acc... [more]
ube3b1.607e-1928.57ubiquitin protein ligase E3B [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube3c1.662e-2129.17ubiquitin protein ligase E3C [Source:ZFIN;Acc:ZDB-... [more]
ube3b8.334e-1728.06ubiquitin protein ligase E3B [Source:ZFIN;Acc:ZDB-... [more]
nedd4a9.823e-1128.29NEDD4 E3 ubiquitin protein ligase a [Source:ZFIN;A... [more]
wwp23.028e-828.65WW domain containing E3 ubiquitin protein ligase 2... [more]
AREL13.877e-823.74apoptosis resistant E3 ubiquitin protein ligase 1 ... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HUL52.832e-926.40Multiubiquitin chain assembly factor (E4); proteas... [more]
RSP57.812e-826.19NEDD4 family E3 ubiquitin ligase; regulates proces... [more]
HUL41.648e-727.06Protein with similarity to hect domain E3 ubiquiti... [more]
TOM14.410e-626.13E3 ubiquitin ligase of the hect-domain class; has ... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473992.280e-1525.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345929.185e-1425.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493272.888e-1027.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493835.207e-1022.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403021.395e-927.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube3c2.352e-2229.23ubiquitin protein ligase E3C [Source:NCBI gene;Acc... [more]
ube3b2.259e-1827.55ubiquitin protein ligase E3B [Source:NCBI gene;Acc... [more]
ube3b2.334e-1827.55ubiquitin protein ligase E3B [Source:NCBI gene;Acc... [more]
itchb1.797e-1126.92E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
itchb6.262e-1126.92E3 ubiquitin-protein ligase Itchy [Source:NCBI gen... [more]
back to top
BLAST of Ubiquitin-ligase E3C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068094.10.000e+0100.00SMESG000068094.1[more]
SMESG000068094.10.000e+0100.00SMESG000068094.1[more]
SMESG000055056.12.195e-2031.28SMESG000055056.1[more]
SMESG000048038.16.277e-1727.69SMESG000048038.1[more]
SMESG000030063.15.246e-1026.00SMESG000030063.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035160 ID=SMED30035160|Name=Ubiquitin-ligase E3C|organism=Schmidtea mediterranea sexual|type=transcript|length=3239bp
GAAATTTGTTGTGAAGGTGTTTTGACAGAGGAATTGTGCTGTGTTTTAAA
TGTGCAGTGCTGGCAGTGCGAGCTTTTTGATTGGATGCCTGCAATTATAA
TTTATTGATTTTTTGATTATTTTATTATTAATCCACAAAAATACGTCACG
CAGTTTTTCAAATGAATTCGAAATCAATGAAAACATGTCCCAACTCAAGA
TTATGCACCGCAGGAAGAGGGAGTCTTGGAAGAATTGCAAAACGCAGATA
CACAAGGGACCTATTTGATGATATTGTCGATAGCTTGCAATCAAATTCGG
AAGGTACAGTGTCGGATGAAGAGAAACTGTTAACTTTGTTCAAATGCTTC
AATAACTTCTTCAACAAAAAATTCGATTCTGAAAGAATGTTTAAAGCTAT
TTCTTATGTACTGACAAGAGAGCACTCAAAAATAATAATGTCATGGTTAA
AACAAAAGAAAGCTGATAATATATATGTAATTGGAAGGTTTATTCTTCAT
GTAACCAGCTTCTTGGAAGATCAAATGGAAATCAAAGAAAATCAAATTAA
AGAATGTGGAAATCTACTCAATTTAATATTTTCGGAAAACAATGGAATTC
TTGACGAAAATTTTATTTTGATTTTTAGTTTTCTCAGTCGTAAAGGATAT
TTCCGATCGATAATTGGATTTATTCTGAAACATTTCAAAGAGATCTCTGT
GAAACCGAAATTATTCCAAGTCCAAGACAAACAGAAATCAATTGACATGA
CTGCCATCGAAACCTGGATTAAGTATTTGATGTTTCCGTTAATCTTCGCT
GTCAAATGGCGAATCAAAGTCGAAGAATGGATTAAATCTGAAGCGGAGAA
GCAGGAATTGTACGGATCAAATGAAAGCATTGACGATGACTATGCCAACA
CGTCAATTATGAACATGTCATTGATGTCTGTCAGCAGCGAGTATAGCACT
GAAGATCCGCATTCTCGTCAAACTAGATTATTTTTAAAACGCCTTATTTC
ATCTTGGTGCAATTCGGTTTATTTCAATGACTCTTTCTATCAATATTCTG
TCAGTCACGCTTCAATTACTTTTGCCAATAATGTTCTCATCAATTCCGTT
CCGATTTACCTAATACTTCTCGCTATTGTTGAGCCTTCTAAACAGAAGAG
AAAATATAGTATTGAGTCTATTCTGAGTTACAGCAAAACTTTATTAGTTT
TATACAAATTGAACTCAAATCCATCTTTGGGTCTCTTGAGTTTACTCGTA
AGTGGAATTTGTGGATATCAACAAATCCAAGCTTGGAAAAATGTTGGACA
GGAAGAGGCATATGGGATAATAGTTTGTATACATTTAACAATATTCGCTC
TTTTTGATCAAATAATCTACAAAGACAACATGGAAAAGAGTAAACTTGCT
CTAAACCAAATTTATGAATCCAAAGATGTTAATCGTTTCAATGAGAACTA
CAAATTTATTTTAGCAGAAATAAGAGAATGCATTTCACAAAATATCAATG
AAGTTTTAAAAATTGCATTTACGGGCCTTTTAGATCCAGATGTTGTTTTA
CCTTTGGCGTACTTATATCAAAATCTTACAAAAGATCTTAAACTTTCAAA
GAGCACTATTATAGGATGCCGAATGATTCTTAGCAAGAATGTCGCTTTTA
TGAGATATTTGTGGAGTTTATGTCAACAGGCGGTAACAAGTCGTGAAATT
AGTTTCTCATCTGGTTCTGTAGAACGTCGCACATCAGATTTTGTGGAAAA
ATCCATAATTTTCAAAGTAATATCCGATGGTCGACTGATATCGATTGAAG
ATTTGCACAGATTTATAAGCATCCTATCAACAATACTGGAATGCGTGACA
TTTCACTTGAATACACTCTATCAAGCCGAAACTCGAAGAAAATCGTCCTC
GTCGTACGGGCCTTCTCCTGCGGCAGTTTGCTCAAATTTCTTGCTTTGGC
CCGAACTATGGAACATGACAAGCGAACTAGCAACTCTTTCAATCGGTCTA
ATTAAAATCGCAGTTTCCTCAGTCAACTTGAAAGAAATTGATATCGCAGA
GAATCATTGTCAGTGCAGTATCAATACAAAATCAGCTTCTCATCAAGAAA
CGATCATTAAGGAAATTCAAAGTATTCTTCGTCTGTTGAGGATATTTTAC
GTACACATTGACAAACTCAATGTTGATTACTGTTCCATTGATGAGATTCT
AATGGATTTCGATTTCGAAAACTTAAGAAAACTTTTCTCCAAAGAACAAA
TTGAATCTGTCTTTGATGAAACTGAGTTAAATACAATTTTAAAAAAATGT
CTAGAGCAAAACCAAATGAAAGTTAATGAAATAATTCCATTATTACTTTT
GAAACATTTGCCTACATTTTTCCACAGCGAAACGAAACTAACGCTAATTG
AAACATATTTTGACCAACTCAAGCAATGTTACAAGACGAAATATACTGTG
GTGAATCCTGAAGAAAAGGCAATTACCATTATTCATCAAAAGGACTCAAT
TATAAAAGACATTCTAGCTCCAGTTCTAAACTATTCAACTGAATTCTGGA
TATGCAAAAATGAAATTATATTGAATAATGAAACTCTTCCGATTCCAAAA
TTCATTTCCCAAATTCTAGATGCAGGTTTAGATCCGGTAAATCACTTGTT
CAGCTGTGATGGGAATCAGTTACTTTATCCCAATCCCTACGTGGAAAATT
TCTATTCCGATTTTAAAGTTTATTATGAATATTTCGGCAAAATCTTTGCT
TTAAATATTCTACATGGAAACGGGTTAAAACGAAGATTTTCTCCATTTTT
CTTGGAAAAGTTAATGTTTCTTAATGAGTCTGTTTATAACATAAATGATT
TGAATACCGTTGACATGGAAGTAGCAAAAAATTTATTATTACTGTCTAAA
ACGGATGACGAATTAGACTGCTTCAATTTTAAATTTGTCCTTACACAAAA
TACGTTTGGCAAGCTCCACACCTATGAGATTGTTGAAAATGGAGCAAAGA
TTCCGGTTACAAAAGACAACAAAAATGAATATATTCATGATGTAATCGAA
TTCTTATTAGACAAACAAATAAAAATTCAATGTGAACACTTTAAAAAAGG
GATGGAATCTGTTATGTCCACGAATATCCTGTCAATTTTGTCAACAAATG
ATCTCCATAAGTTAATATCAAAAGATTATTCGAAACATTAGAGCGAATTG
AACATCAAATTTTTAATTTTAACGAAATAAATTTGATGA
back to top

protein sequence of SMED30035160-orf-1

>SMED30035160-orf-1 ID=SMED30035160-orf-1|Name=SMED30035160-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1010bp
MNSKSMKTCPNSRLCTAGRGSLGRIAKRRYTRDLFDDIVDSLQSNSEGTV
SDEEKLLTLFKCFNNFFNKKFDSERMFKAISYVLTREHSKIIMSWLKQKK
ADNIYVIGRFILHVTSFLEDQMEIKENQIKECGNLLNLIFSENNGILDEN
FILIFSFLSRKGYFRSIIGFILKHFKEISVKPKLFQVQDKQKSIDMTAIE
TWIKYLMFPLIFAVKWRIKVEEWIKSEAEKQELYGSNESIDDDYANTSIM
NMSLMSVSSEYSTEDPHSRQTRLFLKRLISSWCNSVYFNDSFYQYSVSHA
SITFANNVLINSVPIYLILLAIVEPSKQKRKYSIESILSYSKTLLVLYKL
NSNPSLGLLSLLVSGICGYQQIQAWKNVGQEEAYGIIVCIHLTIFALFDQ
IIYKDNMEKSKLALNQIYESKDVNRFNENYKFILAEIRECISQNINEVLK
IAFTGLLDPDVVLPLAYLYQNLTKDLKLSKSTIIGCRMILSKNVAFMRYL
WSLCQQAVTSREISFSSGSVERRTSDFVEKSIIFKVISDGRLISIEDLHR
FISILSTILECVTFHLNTLYQAETRRKSSSSYGPSPAAVCSNFLLWPELW
NMTSELATLSIGLIKIAVSSVNLKEIDIAENHCQCSINTKSASHQETIIK
EIQSILRLLRIFYVHIDKLNVDYCSIDEILMDFDFENLRKLFSKEQIESV
FDETELNTILKKCLEQNQMKVNEIIPLLLLKHLPTFFHSETKLTLIETYF
DQLKQCYKTKYTVVNPEEKAITIIHQKDSIIKDILAPVLNYSTEFWICKN
EIILNNETLPIPKFISQILDAGLDPVNHLFSCDGNQLLYPNPYVENFYSD
FKVYYEYFGKIFALNILHGNGLKRRFSPFFLEKLMFLNESVYNINDLNTV
DMEVAKNLLLLSKTDDELDCFNFKFVLTQNTFGKLHTYEIVENGAKIPVT
KDNKNEYIHDVIEFLLDKQIKIQCEHFKKGMESVMSTNILSILSTNDLHK
LISKDYSKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035983Hect_E3_ubiquitin_ligase
IPR000569HECT_dom
Vocabulary: molecular function
TermDefinition
GO:0004842ubiquitin-protein transferase activity
GO:0016740transferase activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000569HECT domainSMARTSM00119hect_3coord: 791..1007
e-value: 8.1E-5
score: -105.3
IPR000569HECT domainPFAMPF00632HECTcoord: 822..1003
e-value: 9.3E-32
score: 110.7
IPR000569HECT domainPROSITEPS50237HECTcoord: 813..1003
score: 25.349
NoneNo IPR availableGENE3DG3DSA:3.30.2160.10coord: 889..969
e-value: 2.7E-39
score: 136.9
NoneNo IPR availableGENE3DG3DSA:3.90.1750.10coord: 814..1003
e-value: 2.7E-39
score: 136.9
NoneNo IPR availablePANTHERPTHR45700FAMILY NOT NAMEDcoord: 31..1005
IPR035983HECT, E3 ligase catalytic domainSUPERFAMILYSSF56204Hect, E3 ligase catalytic domaincoord: 771..1003