TOG array regulator of axonemal microtubules 1

Overview
NameTOG array regulator of axonemal microtubules 1
Smed IDSMED30035139
Length (bp)5760
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TOG array regulator of axonemal microtubules 1 (SMED30035139) t-SNE clustered cells

Violin plots show distribution of expression levels for TOG array regulator of axonemal microtubules 1 (SMED30035139) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TOG array regulator of axonemal microtubules 1 (SMED30035139) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TOG array regulator of axonemal microtubules 1 (SMED30035139) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035139

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035139SMESG000016691.1 SmedASXL_015169SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30035139SMESG000016691.1 dd_Smed_v4_13421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035139SMESG000016691.1 dd_Smed_v4_13421_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035139SMESG000016691.1 dd_Smed_v6_13421_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035139SMESG000016691.1 dd_Smed_v4_13421_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035139SMESG000016691.1 dd_Smed_v4_13421_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Human
Match: TOGARAM1 (TOG array regulator of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:19959])

HSP 1 Score: 222.246 bits (565), Expect = 2.189e-57
Identity = 152/534 (28.46%), Postives = 279/534 (52.25%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYF---KTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPII---CSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEI---GLLLGKS---RTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILN 5294
            P + PE  + E L L+ +EDWE KI  +  ++ L  FH+++L  +   +H    A+ +E KNLRS V++ A+     LF YL+K++D  L+  V  LL KAGE +N+F+R+D++ +L  M+ NV+P RA  +L+  G  + ++A+RR   C    L D L +    + +S  K+  E+IL    KFA D +QETRYYG++ML  +    +FEK++ K++ +KDL  +KD + N++ KG+G+ P     + G +          + ++      S+  +    R +TR      S +  ++L  I   L++ DFRDR NG+  +++   +  +L   +I KI      RL+D+N+KV + AL+   K+IP++    S       P  ++    N  SK+  +  +A+N++       D  LL+QP        N K K  + + +  +++ +   K  +  + + +++ H++  +   G L G     RT   ++++ L       +  +G  +++ AA +  H +K+++ ++L+
Sbjct: 1251 PFSKPEIALTEALRLLADEDWEKKIEGLNFIRCLAAFHSEILNTK---LHETNFAVVQEVKNLRSGVSRAAVVCLSDLFTYLKKSMDQELDTTVKVLLHKAGE-SNTFIREDVDKALRAMVNNVTPARAVVSLINGGQSHLHIAVRR---CTAQHLSDVLEFMEPERILSAAKDMAERILPAAAKFAQDSSQETRYYGRKMLFFMMCHPNFEKMLEKYVPSKDLPYIKDSVRNLQQKGLGEIPLDTPSAKGRRSHTGSVGNTRSSSVSRDAFNSAERAVTEVREVTRKSVPRNSLESAEYLKLITGLLNAKDFRDRINGIKQLLSDTENNQDLVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDHLSPIINMLIPAIVDN---NLNSKNPGIYAAATNVVQALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTNSGSLPGAGGNIRTATAKLSKAL-------FAQMGQNLLNQAASQPPH-IKKSLEELLD 1766          

HSP 2 Score: 103.605 bits (257), Expect = 2.949e-21
Identity = 115/483 (23.81%), Postives = 220/483 (45.55%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV 1667
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++LT+       + TE+ I +  +L     E+  ET   S L+ I + +G+ R+  +    P  +   +NR    ++SQ  +  P    L  +G      FP    P     + +N  +  G IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   +++L +L +    +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKT+ L K V+ V   D  N   + +AV  RL++  LP + + G V Y 
Sbjct:  136 LYRALGRVLVEGGSDEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREENPALRKDALQILHICLKRSPG--EVLRTLIQQGLEST-DARLRASTALLLPILLTTEDLLLGLDLTEVIISLARKLGDQETEEESET-AFSALQQIGERLGQDRFQSYISRLPSALRRHYNR---RLESQFGSQVPYYLELEASG------FPEDPLPCAV--TLSNSNLKFGIIPQEL-----HSRLLDQ-EDYKNRTQAVEELKQVLGKFNPSSTPHSSLVGFISLLYNLLDDSNFKVVHGTLEVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQQVLCLLLEH---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYA 590          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Human
Match: TOGARAM2 (TOG array regulator of axonemal microtubules 2 [Source:HGNC Symbol;Acc:HGNC:33715])

HSP 1 Score: 167.548 bits (423), Expect = 5.357e-41
Identity = 135/535 (25.23%), Postives = 256/535 (47.85%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLG---KSRTLPTQVNEQLQNLVVLSYGI---VGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 5318
            P +NPE  + + L  + + DW+ K   ++++Q L   H+++L  +   +H +C+ +  E  NLRS+V+  AI T G LF  L+KN+D   E I   LL K  + TN F+++    SL  M+ENV+  R+   L  +G  ++N  IR+ AA ++  + +++G  K +S  +++ + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + D   L+ ++  IK +GI D  +   + G +    L       N + +    S          + L G     +    LT++   L + DFR R  G+  ++   +    L    + ++     PRL D+N KV   AL+   K+IP++  +         I TVA N  SK+  +  +A  ++D    S D   L+      +   + +    + D +  L++++       + R    + RHV+P +   L    ++ TLP         +  LS  +   +G+ ++D AA +  H LK  + ++L+ ++L  ++
Sbjct:  484 PFSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGK---LHDVCLVVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQEAEEIARCLLQKMAD-TNEFIQRAAGQSLRAMVENVTLARSLVVLTSAGVYHRNPLIRKYAAEHLSAVLEQIGAEKLLSGTRDSTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANTKFDAFLKQSLPSYD---LQKVMAAIKQQGIEDNDELPSAKGRK---VLRSLVVCENGLPIKEGLSCNGPRLVGLRSTLQGRGEMVEQLRELTRL---LEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMIPLLRESLHPMLL-SIIITVADNLNSKNSGIYAAAVAVLDAMVESLDNLCLLPALAGRVRFLSGRAVLDVTDRLAVLVASV-------YPRKPQAVERHVLPILWHFLNTATRNGTLPGPSGNIRGVVCRLSRSLQEHMGSRLLDFAASQPKHVLK-TLQELLDSESLGGSR 996          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Human
Match: TOGARAM1 (TOG array regulator of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:19959])

HSP 1 Score: 157.532 bits (397), Expect = 1.154e-37
Identity = 131/531 (24.67%), Postives = 247/531 (46.52%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPII---CSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEI---GLLLGKS---RTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILN 5294
            P + PE  + E L L+ +EDWE KI  +  ++ L  FH+++L  +   +H    A+ +E KNLRS V++ A+     LF YL+K++D  L+  V  LL KAGE +N+F+R+D++ +L  M+ NV+P RA  +L+  G        +R     M+           M C                                      +FEK++ K++ +KDL  +KD + N++ KG+G+ P     + G +          + ++      S+  +    R +TR      S +  ++L  I   L++ DFRDR NG+  +++   +  +L   +I KI      RL+D+N+KV + AL+   K+IP++    S       P  ++    N  SK+  +  +A+N++       D  LL+QP        N K K  + + +  +++ +   K  +  + + +++ H++  +   G L G     RT   ++++ L       +  +G  +++ AA +  H +K+++ ++L+
Sbjct: 1251 PFSKPEIALTEALRLLADEDWEKKIEGLNFIRCLAAFHSEILNTK---LHETNFAVVQEVKNLRSGVSRAAVVCLSDLFTYLKKSMDQELDTTVKVLLHKAGE-SNTFIREDVDKALRAMVNNVTPARAVVSLINGG--------QRYYGRKMLFF---------MMC------------------------------------HPNFEKMLEKYVPSKDLPYIKDSVRNLQQKGLGEIPLDTPSAKGRRSHTGSVGNTRSSSVSRDAFNSAERAVTEVREVTRKSVPRNSLESAEYLKLITGLLNAKDFRDRINGIKQLLSDTENNQDLVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDHLSPIINMLIPAIVDN---NLNSKNPGIYAAATNVVQALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTNSGSLPGAGGNIRTATAKLSKAL-------FAQMGQNLLNQAASQPPH-IKKSLEELLD 1713          

HSP 2 Score: 103.99 bits (258), Expect = 2.704e-21
Identity = 115/483 (23.81%), Postives = 220/483 (45.55%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV 1667
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++LT+       + TE+ I +  +L     E+  ET   S L+ I + +G+ R+  +    P  +   +NR    ++SQ  +  P    L  +G      FP    P     + +N  +  G IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   +++L +L +    +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKT+ L K V+ V   D  N   + +AV  RL++  LP + + G V Y 
Sbjct:  136 LYRALGRVLVEGGSDEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREENPALRKDALQILHICLKRSPG--EVLRTLIQQGLEST-DARLRASTALLLPILLTTEDLLLGLDLTEVIISLARKLGDQETEEESET-AFSALQQIGERLGQDRFQSYISRLPSALRRHYNR---RLESQFGSQVPYYLELEASG------FPEDPLPCAV--TLSNSNLKFGIIPQEL-----HSRLLDQ-EDYKNRTQAVEELKQVLGKFNPSSTPHSSLVGFISLLYNLLDDSNFKVVHGTLEVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQQVLCLLLEH---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYA 590          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Human
Match: TOGARAM1 (TOG array regulator of axonemal microtubules 1 [Source:HGNC Symbol;Acc:HGNC:19959])

HSP 1 Score: 103.99 bits (258), Expect = 1.755e-21
Identity = 115/483 (23.81%), Postives = 220/483 (45.55%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV 1667
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++LT+       + TE+ I +  +L     E+  ET   S L+ I + +G+ R+  +    P  +   +NR    ++SQ  +  P    L  +G      FP    P     + +N  +  G IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   +++L +L +    +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKT+ L K V+ V   D  N   + +AV  RL++  LP + + G V Y 
Sbjct:  136 LYRALGRVLVEGGSDEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREENPALRKDALQILHICLKRSPG--EVLRTLIQQGLEST-DARLRASTALLLPILLTTEDLLLGLDLTEVIISLARKLGDQETEEESET-AFSALQQIGERLGQDRFQSYISRLPSALRRHYNR---RLESQFGSQVPYYLELEASG------FPEDPLPCAV--TLSNSNLKFGIIPQEL-----HSRLLDQ-EDYKNRTQAVEELKQVLGKFNPSSTPHSSLVGFISLLYNLLDDSNFKVVHGTLEVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQQVLCLLLEH---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYA 590          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Human
Match: TOGARAM2 (TOG array regulator of axonemal microtubules 2 [Source:HGNC Symbol;Acc:HGNC:33715])

HSP 1 Score: 77.7962 bits (190), Expect = 1.165e-15
Identity = 46/162 (28.40%), Postives = 89/162 (54.94%), Query Frame = 3
Query: 3990 LDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAG 4475
            +D   E I   LL K  + TN F+++    SL  M+ENV+  R+   L  +G  ++N  IR+ AA ++  + +++G  K +S  +++ + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + D   L+ ++  IK +GI D  +   + G
Sbjct:    1 MDQEAEEIARCLLQKMAD-TNEFIQRAAGQSLRAMVENVTLARSLVVLTSAGVYHRNPLIRKYAAEHLSAVLEQIGAEKLLSGTRDSTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANTKFDAFLKQSLPSYD---LQKVMAAIKQQGIEDNDELPSAKG 158          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Celegans
Match: che-12 (Crescerin-like protein che-12 [Source:UniProtKB/Swiss-Prot;Acc:Q17423])

HSP 1 Score: 109.383 bits (272), Expect = 9.409e-24
Identity = 98/437 (22.43%), Postives = 198/437 (45.31%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE-----FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILI 5033
            L+     +N+ L  + +++W +K+  +  + +L +    ++ +   ++  + IA+  ECKNLRS V++ AI T G +   L   +DS +E I + LLSK+G+ +N+F+R D   SL  +++  +  +A   ++ +G  +KN  IR   A  +  +    G    ++  +     +L  +++F+ D + + R  GK+ L  LSK  +F++L+ K+    +++ +KD+L N++ +G  D      +A +  S S                            TR     + D  +  L +I ++L +  +  R  GL          +    S +++++  + RL D N KV   A++     +  +   + TE        +  + +  + +SKS E ++ A   +     S +   L+     A  KSN K +P ++
Sbjct:  204 LDTSNMSVNQALKKMSSDEWADKVDGLNMISTLSETQPRMVAD---NLKEVIIAILNECKNLRSSVSRVAIVTIGTVAQNLNSKIDSEMEKICAVLLSKSGDVSNAFIRDDATDSLNKLVKAATAGKALQGIILAGAKSKNNTIRSSCANFVYDIITIQGSSAILNN-QNALSNVLPVLLQFSRDQSPQVRNPGKQSLCFLSKDPNFDRLMRKNALESEIKAVKDVLANVEKRGGVD--SLESTANLSGSLSRIGS------------------------TRRVQKKLPDSLQLDLDEIRTELLAAGWERRLTGLQRFEEMCGHASKAVASDTRLIEAFISRLGDTNGKVASCAMETYISTMGSMAKLYSTESNLKAVMNQLAHALTAHLSSKSEEHKHLARTCIQHTIRSIEPVSLLPAMTSATKKSNVKQRPFIL 610          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Celegans
Match: che-12 (Crescerin-like protein che-12 [Source:UniProtKB/Swiss-Prot;Acc:Q17423])

HSP 1 Score: 107.071 bits (266), Expect = 3.227e-23
Identity = 98/437 (22.43%), Postives = 198/437 (45.31%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE-----FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILI 5033
            L+     +N+ L  + +++W +K+  +  + +L +    ++ +   ++  + IA+  ECKNLRS V++ AI T G +   L   +DS +E I + LLSK+G+ +N+F+R D   SL  +++  +  +A   ++ +G  +KN  IR   A  +  +    G    ++  +     +L  +++F+ D + + R  GK+ L  LSK  +F++L+ K+    +++ +KD+L N++ +G  D      +A +  S S                            TR     + D  +  L +I ++L +  +  R  GL          +    S +++++  + RL D N KV   A++     +  +   + TE        +  + +  + +SKS E ++ A   +     S +   L+     A  KSN K +P ++
Sbjct:  115 LDTSNMSVNQALKKMSSDEWADKVDGLNMISTLSETQPRMVAD---NLKEVIIAILNECKNLRSSVSRVAIVTIGTVAQNLNSKIDSEMEKICAVLLSKSGDVSNAFIRDDATDSLNKLVKAATAGKALQGIILAGAKSKNNTIRSSCANFVYDIITIQGSSAILNN-QNALSNVLPVLLQFSRDQSPQVRNPGKQSLCFLSKDPNFDRLMRKNALESEIKAVKDVLANVEKRGGVD--SLESTANLSGSLSRIGS------------------------TRRVQKKLPDSLQLDLDEIRTELLAAGWERRLTGLQRFEEMCGHASKAVASDTRLIEAFISRLGDTNGKVASCAMETYISTMGSMAKLYSTESNLKAVMNQLAHALTAHLSSKSEEHKHLARTCIQHTIRSIEPVSLLPAMTSATKKSNVKQRPFIL 521          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Celegans
Match: che-12 (Crescerin-like protein che-12 [Source:UniProtKB/Swiss-Prot;Acc:Q17423])

HSP 1 Score: 106.686 bits (265), Expect = 3.908e-23
Identity = 99/437 (22.65%), Postives = 198/437 (45.31%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE-----FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILI 5033
            L+     +N+ L  + +++W +K+  +  + +L +    ++ +   ++  + IA+  ECKNLRS V++ AI T G +   L   +DS +E I + LLSK+G+ +N+F+R D   SL  +++  +  +A   ++ +G  +KN  IR   A  +  +    G    ++  +     +L  +++F+ D + + R  GK+ L  LSK  +F++L+ K+    +++ +KD+L N++ +G  D      +A +  S S                             +LP S   D     L +I ++L +  +  R  GL          +    S +++++  + RL D N KV   A++     +  +   + TE        +  + +  + +SKS E ++ A   +     S +   L+     A  KSN K +P ++
Sbjct:  113 LDTSNMSVNQALKKMSSDEWADKVDGLNMISTLSETQPRMVAD---NLKEVIIAILNECKNLRSSVSRVAIVTIGTVAQNLNSKIDSEMEKICAVLLSKSGDVSNAFIRDDATDSLNKLVKAATAGKALQGIILAGAKSKNNTIRSSCANFVYDIITIQGSSAILNN-QNALSNVLPVLLQFSRDQSPQVRNPGKQSLCFLSKDPNFDRLMRKNALESEIKAVKDVLANVEKRGGVD--SLESTANLSGSLSRIGSTRRVQ-------------------KKLPDSLQLD-----LDEIRTELLAAGWERRLTGLQRFEEMCGHASKAVASDTRLIEAFISRLGDTNGKVASCAMETYISTMGSMAKLYSTESNLKAVMNQLAHALTAHLSSKSEEHKHLARTCIQHTIRSIEPVSLLPAMTSATKKSNVKQRPFIL 519          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Celegans
Match: che-12 (Crescerin-like protein che-12 [Source:UniProtKB/Swiss-Prot;Acc:Q17423])

HSP 1 Score: 107.071 bits (266), Expect = 9.441e-23
Identity = 98/437 (22.43%), Postives = 198/437 (45.31%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE-----FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILI 5033
            L+     +N+ L  + +++W +K+  +  + +L +    ++ +   ++  + IA+  ECKNLRS V++ AI T G +   L   +DS +E I + LLSK+G+ +N+F+R D   SL  +++  +  +A   ++ +G  +KN  IR   A  +  +    G    ++  +     +L  +++F+ D + + R  GK+ L  LSK  +F++L+ K+    +++ +KD+L N++ +G  D      +A +  S S                            TR     + D  +  L +I ++L +  +  R  GL          +    S +++++  + RL D N KV   A++     +  +   + TE        +  + +  + +SKS E ++ A   +     S +   L+     A  KSN K +P ++
Sbjct:  796 LDTSNMSVNQALKKMSSDEWADKVDGLNMISTLSETQPRMVAD---NLKEVIIAILNECKNLRSSVSRVAIVTIGTVAQNLNSKIDSEMEKICAVLLSKSGDVSNAFIRDDATDSLNKLVKAATAGKALQGIILAGAKSKNNTIRSSCANFVYDIITIQGSSAILNN-QNALSNVLPVLLQFSRDQSPQVRNPGKQSLCFLSKDPNFDRLMRKNALESEIKAVKDVLANVEKRGGVD--SLESTANLSGSLSRIGS------------------------TRRVQKKLPDSLQLDLDEIRTELLAAGWERRLTGLQRFEEMCGHASKAVASDTRLIEAFISRLGDTNGKVASCAMETYISTMGSMAKLYSTESNLKAVMNQLAHALTAHLSSKSEEHKHLARTCIQHTIRSIEPVSLLPAMTSATKKSNVKQRPFIL 1202          

HSP 2 Score: 75.8702 bits (185), Expect = 2.909e-13
Identity = 106/488 (21.72%), Postives = 201/488 (41.19%), Query Frame = 3
Query:  237 KLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSF-----PEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSV----MNDLKHERKLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXD-NYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVT 1670
            K  ELF  I +++CD  W ++    + L+  +         +  M  V+ +LI  L  + +TVRK   Q +  +L       + +Q F++   N   + N + +    L  +L     + N+T L    +   T +S  +  E     ++K +   +G    NEF +       PE   +L    +N +  +   +   S  L  + K               P S     +  G +P  V      D    +++  +E +          E+  + PHL   L ++  ++ED N+ V +    L +D+V +    +       + Q + +   H     ++ ++  M   M LFQ  + K +   L   +  +++K   +R+  I+I T++L+    +KF+L  +   +     D K +V+ AA E +SV+ Y   NGKT  ++K V    +    N+  + +AV  R+ +  LP I   G++ Y T
Sbjct:   60 KKGELFKCIDKIICDDRWELQHQCIKFLVEAMP--TFGSATEYCMCFVMPNLIPKLVSNKVTVRKITHQAIATFLRLKP---EALQSFLKMLSNFMPNCNSKSELITELHHILIPELVKSNWTCL----VENFTTESNIQGCEDQAGVLMKKLHYFIG----NEFWQKIITNLSPEKREVLEQITAN-VQVEHTESKAGSGVLRASAK---------------PQSGGERRLRFGIVPSLVCALIAEDTDANQRISGLEKMKQVVDQITPEEIARLVPHLHSYLLMLSNVLEDLNFKVVV----LALDIVRATGHHLKGHMEAHIQQFVNLVAKHFGNQKSVIKQIIMMTFMELFQNINPKTVGGCL---RVFLENKNSRVREEVINIYTASLMTISPSKFNLQPLVNILVPMFHDVKKRVRLAAFEQLSVLAY-LLNGKTEIIMKPVRDFEQDQ--NSRGLTEAVTARIRRQVLPRIRYDGLIEYST 508          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Fly
Match: CG42399 (gene:FBgn0259818 transcript:FBtr0301929)

HSP 1 Score: 115.161 bits (287), Expect = 4.157e-25
Identity = 62/230 (26.96%), Postives = 121/230 (52.61%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENI 4427
             + P + + +  + + + +WE  +S + +M  L+++H + L N+   +H  CI L +  +NLRSQVA+ + Q   +LF     +L    +++V  LL +  + TN FLR D   +L  M+++  PQ+  N L   G  ++N  +R  +A  +  L +RLG  +  +  +E+ +K         ++G+ ETR Y K +   LS+  ++++L+ + I  +  R ++  L +I
Sbjct: 1428 FDRPREALLKTFDQLDSSNWEVNVSGLKSMVRLIRYHAETLDNQ---MHMTCIQLTRSVRNLRSQVARASCQAAAELFSLKSTSLQQECDDLVCALLHRTAD-TNRFLRADANRALESMVDHAQPQKILNILATKGAQHQNALVRTTSAKLLFRLVERLGSDRIYAMGRESRDKFFVVGANLLLEGSLETRSYAKSLFRALSENHNYQRLLLEVIPPRTYRNVEKTLRSI 1653          

HSP 2 Score: 56.6102 bits (135), Expect = 3.206e-7
Identity = 50/189 (26.46%), Postives = 89/189 (47.09%), Query Frame = 3
Query: 1116 KLLIDVVSSIPAD-IVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVL----TRLSKHRLPNIDDHGIVVYV 1667
            +LL++++S +P D +  +   +L  L R        G+A   +   A    L Q+     ++  L   +F+  +K    R  ++ +   AL+ FP T FD+  + T+    LL++K +V+QAALE ++V+           +L IV + T G       +G  VL     RLS+ +LP +     V++V
Sbjct:  715 ELLVNLISRLPLDNLEERTPQILSGLCR-------QGNAGANRVCKA----LMQRLPAGTIVAKLTSPEFL-HAKSSKFRDHALQMSIFALMTFPGTCFDISLLTTQAVYSLLNRKRRVRQAALEVLAVLA---DISSIKEVLTIVSETTDG-----VELGPMVLEATSVRLSRLQLPIVTPDSGVLFV 883          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Fly
Match: CG42399 (gene:FBgn0259818 transcript:FBtr0330643)

HSP 1 Score: 115.161 bits (287), Expect = 4.262e-25
Identity = 62/230 (26.96%), Postives = 121/230 (52.61%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENI 4427
             + P + + +  + + + +WE  +S + +M  L+++H + L N+   +H  CI L +  +NLRSQVA+ + Q   +LF     +L    +++V  LL +  + TN FLR D   +L  M+++  PQ+  N L   G  ++N  +R  +A  +  L +RLG  +  +  +E+ +K         ++G+ ETR Y K +   LS+  ++++L+ + I  +  R ++  L +I
Sbjct: 1426 FDRPREALLKTFDQLDSSNWEVNVSGLKSMVRLIRYHAETLDNQ---MHMTCIQLTRSVRNLRSQVARASCQAAAELFSLKSTSLQQECDDLVCALLHRTAD-TNRFLRADANRALESMVDHAQPQKILNILATKGAQHQNALVRTTSAKLLFRLVERLGSDRIYAMGRESRDKFFVVGANLLLEGSLETRSYAKSLFRALSENHNYQRLLLEVIPPRTYRNVEKTLRSI 1651          

HSP 2 Score: 56.6102 bits (135), Expect = 2.947e-7
Identity = 50/189 (26.46%), Postives = 89/189 (47.09%), Query Frame = 3
Query: 1116 KLLIDVVSSIPAD-IVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVL----TRLSKHRLPNIDDHGIVVYV 1667
            +LL++++S +P D +  +   +L  L R        G+A   +   A    L Q+     ++  L   +F+  +K    R  ++ +   AL+ FP T FD+  + T+    LL++K +V+QAALE ++V+           +L IV + T G       +G  VL     RLS+ +LP +     V++V
Sbjct:  715 ELLVNLISRLPLDNLEERTPQILSGLCR-------QGNAGANRVCKA----LMQRLPAGTIVAKLTSPEFL-HAKSSKFRDHALQMSIFALMTFPGTCFDISLLTTQAVYSLLNRKRRVRQAALEVLAVLA---DISSIKEVLTIVSETTDG-----VELGPMVLEATSVRLSRLQLPIVTPDSGVLFV 883          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Xenopus
Match: ENSXETT00000051497.1 (TOG array regulator of axonemal microtubules 1 [Source:NCBI gene;Acc:100495084])

HSP 1 Score: 200.675 bits (509), Expect = 3.290e-51
Identity = 95/237 (40.08%), Postives = 157/237 (66.24%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD 4448
            L  PE  + E   L+ ++DWE KI  +  ++SL  FH+DLL  R   +H + IA+ +E KNLRS V++ AI   G +F  L+KN+D  L+N V  LL KAGE +N F+R+D++ +L  M++NV+P RA  AL+  G  + N A+++ AA +M  L +++G  + +S +++  ++ L+ I KFA DG+QETR++G++ML  L    DF++++ K+I  +DL  +KD+++NI+ KG+G+
Sbjct:  888 LPRPENSVAEAFRLLADDDWEKKIEGLGLVRSLSVFHSDLLTER---LHDLKIAVIQEVKNLRSSVSRAAIVCLGDMFSSLKKNMDHELDNCVRMLLHKAGE-SNVFIREDVDRTLDAMVQNVTPARALAALINGGQSHLNNAVKKCAAQHMSDLVEKMGPGRILSGVRDITDRALAAIAKFAQDGSQETRFFGRKMLHFLMSHADFDRMLEKYIPDRDLPYIKDLIKNIQQKGVGE 1120          

HSP 2 Score: 80.4925 bits (197), Expect = 2.628e-14
Identity = 70/243 (28.81%), Postives = 115/243 (47.33%), Query Frame = 3
Query: 1197 VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV-----TESEKLSTHRQQSIFDL-------------EXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVN----FIGN 1850
            +A T  + GD   A+ Q+Y   Y M L +     ++L +L D    +  K   +R+  ++I   +LL +PS  F+L ++  +++  L+D K KV+ AALE  +V+    G GK N L K V++V   +  N   + +AV  RL++  LP I   G+V Y      +  ++ + H   +  D                 SS  S +   +P+ +R  SAGK  G+ KFPW+         F+GN
Sbjct:  170 IASTVKLLGDSKIAVKQEYMKIY-MRLMKVVGPHKILNILLDH---LKHKNSRVREEVVNICIISLLTYPSEDFNLAYLACEIAPCLIDSKRKVRHAALEAFAVLAATMGTGKCN-LFKAVDEVELQE--NGEGLMNAVQARLARKSLPKITSQGLVEYALPFPSSARQRATPHLPGADTDWLLTGTRIHSGQYKSGDSSGRSTVPHIDPVVRRMLSAGK--GKNKFPWENQHPGGSDIFLGN 403          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Xenopus
Match: ENSXETT00000051492.1 (TOG array regulator of axonemal microtubules 1 [Source:NCBI gene;Acc:100495084])

HSP 1 Score: 200.29 bits (508), Expect = 4.634e-51
Identity = 95/237 (40.08%), Postives = 157/237 (66.24%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD 4448
            L  PE  + E   L+ ++DWE KI  +  ++SL  FH+DLL  R   +H + IA+ +E KNLRS V++ AI   G +F  L+KN+D  L+N V  LL KAGE +N F+R+D++ +L  M++NV+P RA  AL+  G  + N A+++ AA +M  L +++G  + +S +++  ++ L+ I KFA DG+QETR++G++ML  L    DF++++ K+I  +DL  +KD+++NI+ KG+G+
Sbjct:  888 LPRPENSVAEAFRLLADDDWEKKIEGLGLVRSLSVFHSDLLTER---LHDLKIAVIQEVKNLRSSVSRAAIVCLGDMFSSLKKNMDHELDNCVRMLLHKAGE-SNVFIREDVDRTLDAMVQNVTPARALAALINGGQSHLNNAVKKCAAQHMSDLVEKMGPGRILSGVRDITDRALAAIAKFAQDGSQETRFFGRKMLHFLMSHADFDRMLEKYIPDRDLPYIKDLIKNIQQKGVGE 1120          

HSP 2 Score: 80.8777 bits (198), Expect = 2.085e-14
Identity = 70/243 (28.81%), Postives = 115/243 (47.33%), Query Frame = 3
Query: 1197 VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV-----TESEKLSTHRQQSIFDL-------------EXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVN----FIGN 1850
            +A T  + GD   A+ Q+Y   Y M L +     ++L +L D    +  K   +R+  ++I   +LL +PS  F+L ++  +++  L+D K KV+ AALE  +V+    G GK N L K V++V   +  N   + +AV  RL++  LP I   G+V Y      +  ++ + H   +  D                 SS  S +   +P+ +R  SAGK  G+ KFPW+         F+GN
Sbjct:  170 IASTVKLLGDSKIAVKQEYMKIY-MRLMKVVGPHKILNILLDH---LKHKNSRVREEVVNICIISLLTYPSEDFNLAYLACEIAPCLIDSKRKVRHAALEAFAVLAATMGTGKCN-LFKAVDEVELQE--NGEGLMNAVQARLARKSLPKITSQGLVEYALPFPSSARQRATPHLPGADTDWLLTGTRIHSGQYKSGDSSGRSTVPHIDPVVRRMLSAGK--GKNKFPWENQHPGGSDIFLGN 403          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Xenopus
Match: TOGARAM2 (TOG array regulator of axonemal microtubules 2 [Source:NCBI gene;Acc:100495375])

HSP 1 Score: 173.711 bits (439), Expect = 5.240e-43
Identity = 121/449 (26.95%), Postives = 227/449 (50.56%), Query Frame = 3
Query: 3732 APLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMT--RLP--GSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAI 5063
             P+++PE+ + E L  + ++DWE+K   + +++ L   H D+L +R   +H +  A+ +E  NLRS+V++ AI+T G LF +L++ +D  +E I   LL K G+ TN F+R++ + SL  M+EN SP +A  AL+  G  ++N ++R+  A  ++ + ++LG  + +S  +E+ + +L  +V+   DG Q+TR+YG+RM   L     FE  + + I + DLR   D++  IK K   D    + SA  QR    S         +   +          S    R P   +++++     L  +   L++ DF+ + +G+  ++   R+       +I++I     PRL D N KV   AL+  + +IP++  +      P  +  V  N  SK   +  +A  ++D    + D   L+QP    I   + +    + + ++ L++++
Sbjct:  481 GPMSHPEQGMIEALRQLNSKDWEHKEKGLGSVRCLSACHPDVLYSR---LHDVSTAVTREANNLRSKVSRHAIRTLGDLFKHLKRAMDPEVEEISRVLLHKIGD-TNEFIREESDKSLGSMVENASPSKALPALISGGISHRNSSVRKCTAKYLLSVIEQLGAERLLSGTRESTDVLLRTVVRLNQDGQQDTRFYGRRMFCLLMGNPKFESQMERLIPSHDLR---DLIATIKQKEATDTLSQAPSAKYQRPLQKSINVFPQESPTPEQRPKEAEPEPQESPVPRRQPVRAAEVTEQ----LKHLSKLLTAKDFQSKMDGVALVLEYSRNNPKFVTANITQIFDSFNPRLQDANKKVNQFALESARLMIPLLKESLHHVLVP-MVTVVTDNLNSKHSGIYAAAVTVVDTLIANIDNLWLLQPFASRIRFISGRAMSDITERLSGLVTSV 917          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Xenopus
Match: TOGARAM2 (TOG array regulator of axonemal microtubules 2 [Source:NCBI gene;Acc:100495375])

HSP 1 Score: 108.612 bits (270), Expect = 4.609e-24
Identity = 86/341 (25.22%), Postives = 154/341 (45.16%), Query Frame = 3
Query: 3990 LDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGI----GDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAI 4997
            +D  +E I   LL K G+ TN F+R++ + SL  M+EN SP +A  AL+  G  ++N ++R+  A  ++ + ++LG  + +S  +E+ + +L  +V+   DG Q+TR+YG+RM   L     FE  + + I + DLR   D++  IK K      G+ + FS     +      +   A  +                               + L  +   L++ DF+ + +G+  ++   R+       +I++I     PRL D N KV   AL+  + +IP++  +      P  +  V  N  SK   +  +A  ++D    + D   L+QP    I
Sbjct:    1 MDPEVEEISRVLLHKIGD-TNEFIREESDKSLGSMVENASPSKALPALISGGISHRNSSVRKCTAKYLLSVIEQLGAERLLSGTRESTDVLLRTVVRLNQDGQQDTRFYGRRMFCLLMGNPKFESQMERLIPSHDLR---DLIATIKQKVCDHLSGNNTHFSEPEPQESPVPRRQPVRAAEVT------------------------------EQLKHLSKLLTAKDFQSKMDGVALVLEYSRNNPKFVTANITQIFDSFNPRLQDANKKVNQFALESARLMIPLLKESLHHVLVP-MVTVVTDNLNSKHSGIYAAAVTVVDTLIANIDNLWLLQPFASRI 306          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Xenopus
Match: ENSXETT00000051506.1 (TOG array regulator of axonemal microtubules 1 [Source:NCBI gene;Acc:100495084])

HSP 1 Score: 80.8777 bits (198), Expect = 1.863e-14
Identity = 70/243 (28.81%), Postives = 115/243 (47.33%), Query Frame = 3
Query: 1197 VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV-----TESEKLSTHRQQSIFDL-------------EXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVN----FIGN 1850
            +A T  + GD   A+ Q+Y   Y M L +     ++L +L D    +  K   +R+  ++I   +LL +PS  F+L ++  +++  L+D K KV+ AALE  +V+    G GK N L K V++V   +  N   + +AV  RL++  LP I   G+V Y      +  ++ + H   +  D                 SS  S +   +P+ +R  SAGK  G+ KFPW+         F+GN
Sbjct:  170 IASTVKLLGDSKIAVKQEYMKIY-MRLMKVVGPHKILNILLDH---LKHKNSRVREEVVNICIISLLTYPSEDFNLAYLACEIAPCLIDSKRKVRHAALEAFAVLAATMGTGKCN-LFKAVDEVELQE--NGEGLMNAVQARLARKSLPKITSQGLVEYALPFPSSARQRATPHLPGADTDWLLTGTRIHSGQYKSGDSSGRSTVPHIDPVVRRMLSAGK--GKNKFPWENQHPGGSDIFLGN 403          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Mouse
Match: Togaram1 (TOG array regulator of axonemal microtubules 1 [Source:MGI Symbol;Acc:MGI:2684313])

HSP 1 Score: 224.557 bits (571), Expect = 2.806e-58
Identity = 150/533 (28.14%), Postives = 282/533 (52.91%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHN---LPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFP---TEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEI---GLLLGKS---RTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILN 5294
            P + P+  + E L L+ +EDWE K+  +  ++ L  FH+DLL  +   +H    A+ +E KNLRS V++ A+   G LF YL+K++D  L++ V  LL KAGE +N+F+R+D++ +L  M+ NV+P RA  +L+  G  + ++A+RR  A ++  + + +   +  S  K+  +++L    KFA D +QETRYYG++ML  +    +FEKL+ K+I +KDL  +K+ ++N+++KG+G+ P   + + G +          + ++      SS       R + R      S +  +++  I   L++ DFRDR NG+  +++  D  N   L   +I KI      RL+D+N+KV + AL+   K+IP++  N         P  ++    N  SK+  +  +A+N++       D  LL+QP        N K K  + + +  +++ +   K  +  + + +++ H++  +   G L G     RT   ++++ L       +  +G  +++ AA +  H +K+++ ++L+
Sbjct: 1254 PFSKPDIALTEALRLLADEDWEKKMEGLNFVRCLAAFHSDLLNTK---LHETTFAVVQEVKNLRSGVSRAAVVCLGDLFTYLKKSMDQELDSAVRALLHKAGE-SNTFIREDVDKALKAMVNNVTPARAVTSLINGGQSHLHIAVRRCTAQHLADVVECMDPERISSGTKDMADRLLPAAAKFAQDSSQETRYYGRKMLFLMMGHPNFEKLLEKYIPSKDLPYIKESVKNLRLKGLGEIPLDTASAKGRRSHPGSVGNTRSSSVSRDAFSSSEREVTEVREVPRKSAPRNSLESAEYIKVITGLLNAKDFRDRINGIKQLLS--DTENNQELVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDNLSPIINMLIPAIVDN---NLNSKNPGIYAAATNVVHALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTHSGSLPGAGGNIRTATAKLSKAL-------FTQMGQNLLNQAASQPPH-IKKSLEELLD 1769          

HSP 2 Score: 94.7449 bits (234), Expect = 1.246e-18
Identity = 138/598 (23.08%), Postives = 262/598 (43.81%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV----TESEKLSTH--------------RQQSIF----DLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNN-----QIHPSEAM 1931
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++ T        + TE+ I +  +L     E+  ET   S L+ I + +G+ R++ +    P  +   +NR    ++SQ  +  P    L  +G FS  + P      +   S++N  +    IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   + +L +L ++   +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKTN L K V+ V   D  N   + +AV  RL++  LP + + G V Y     + ++  S+H              R QS      D    S       S     +R  SAGK  G+ K PW+  +   +G +    S  +     F++++     ++ PS+ M
Sbjct:  136 LYRALGRVLVEGGSEEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREDNPALRKDALQILHICLRRSSG--QVLRTLIQ-GLESP-DARLRASTALLLPILFTPEDLLQGLDLTEVIISLARKLGDQEMEEESET-AFSSLQQIGERLGQERFHSYISRLPSALRRHYNR---RLESQYGSQVPYYLELEASG-FSEDAAPC-----VVNLSSSN--LKFEIIPQEL-----HARLLDQ-EDYKNRTQAVEELKQLLGKFNPSSTPHASLVGFISLLYNLLDDSNFKVVHGTLQVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQRVLSLLLEN---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTNVLFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYAILMPSSAQGRSSHLAHGADTDWLMSGNRTQSAHCYCGDHTRDSMQLYGSYSPTICTRRVLSAGK--GKNKLPWENEQPGVMGENQTSNSKDIKDTEQFSAHDLIPSPKLKPSQGM 702          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Mouse
Match: Togaram1 (TOG array regulator of axonemal microtubules 1 [Source:MGI Symbol;Acc:MGI:2684313])

HSP 1 Score: 224.557 bits (571), Expect = 2.863e-58
Identity = 150/533 (28.14%), Postives = 282/533 (52.91%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHN---LPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFP---TEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEI---GLLLGKS---RTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILN 5294
            P + P+  + E L L+ +EDWE K+  +  ++ L  FH+DLL  +   +H    A+ +E KNLRS V++ A+   G LF YL+K++D  L++ V  LL KAGE +N+F+R+D++ +L  M+ NV+P RA  +L+  G  + ++A+RR  A ++  + + +   +  S  K+  +++L    KFA D +QETRYYG++ML  +    +FEKL+ K+I +KDL  +K+ ++N+++KG+G+ P   + + G +          + ++      SS       R + R      S +  +++  I   L++ DFRDR NG+  +++  D  N   L   +I KI      RL+D+N+KV + AL+   K+IP++  N         P  ++    N  SK+  +  +A+N++       D  LL+QP        N K K  + + +  +++ +   K  +  + + +++ H++  +   G L G     RT   ++++ L       +  +G  +++ AA +  H +K+++ ++L+
Sbjct: 1304 PFSKPDIALTEALRLLADEDWEKKMEGLNFVRCLAAFHSDLLNTK---LHETTFAVVQEVKNLRSGVSRAAVVCLGDLFTYLKKSMDQELDSAVRALLHKAGE-SNTFIREDVDKALKAMVNNVTPARAVTSLINGGQSHLHIAVRRCTAQHLADVVECMDPERISSGTKDMADRLLPAAAKFAQDSSQETRYYGRKMLFLMMGHPNFEKLLEKYIPSKDLPYIKESVKNLRLKGLGEIPLDTASAKGRRSHPGSVGNTRSSSVSRDAFSSSEREVTEVREVPRKSAPRNSLESAEYIKVITGLLNAKDFRDRINGIKQLLS--DTENNQELVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDNLSPIINMLIPAIVDN---NLNSKNPGIYAAATNVVHALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTHSGSLPGAGGNIRTATAKLSKAL-------FTQMGQNLLNQAASQPPH-IKKSLEELLD 1819          

HSP 2 Score: 94.3597 bits (233), Expect = 1.355e-18
Identity = 138/598 (23.08%), Postives = 262/598 (43.81%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV----TESEKLSTH--------------RQQSIF----DLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNN-----QIHPSEAM 1931
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++ T        + TE+ I +  +L     E+  ET   S L+ I + +G+ R++ +    P  +   +NR    ++SQ  +  P    L  +G FS  + P      +   S++N  +    IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   + +L +L ++   +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKTN L K V+ V   D  N   + +AV  RL++  LP + + G V Y     + ++  S+H              R QS      D    S       S     +R  SAGK  G+ K PW+  +   +G +    S  +     F++++     ++ PS+ M
Sbjct:  136 LYRALGRVLVEGGSEEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREDNPALRKDALQILHICLRRSSG--QVLRTLIQ-GLESP-DARLRASTALLLPILFTPEDLLQGLDLTEVIISLARKLGDQEMEEESET-AFSSLQQIGERLGQERFHSYISRLPSALRRHYNR---RLESQYGSQVPYYLELEASG-FSEDAAPC-----VVNLSSSN--LKFEIIPQEL-----HARLLDQ-EDYKNRTQAVEELKQLLGKFNPSSTPHASLVGFISLLYNLLDDSNFKVVHGTLQVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQRVLSLLLEN---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTNVLFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYAILMPSSAQGRSSHLAHGADTDWLMSGNRTQSAHCYCGDHTRDSMQLYGSYSPTICTRRVLSAGK--GKNKLPWENEQPGVMGENQTSNSKDIKDTEQFSAHDLIPSPKLKPSQGM 702          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Mouse
Match: Togaram2 (TOG array regulator of axonemal microtubules 2 [Source:MGI Symbol;Acc:MGI:2443498])

HSP 1 Score: 166.007 bits (419), Expect = 1.106e-40
Identity = 116/416 (27.88%), Postives = 211/416 (50.72%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQ 4979
            P +NPE  + + L  + + DW+ K   ++ +Q L   H+++L  R   +H + +A+  E  NLRS+V++ AI T G LF  L+KN+D   E IV  LL K G  T+ F+++    +L  M+ENV+P RA  AL  +G  ++N  +R+  A ++  + +++G  K +S  ++  + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + DLR    ++  IK +GI D  +   + G +   S S       L S     S+  R      + + GS  + +    LT++   L + +F+ R  G+  ++   +    L   ++ ++     PRL+D+N KV   AL+   +++PI+  +         I   A N  SK+  +  +AS ++D    S D   L+Q
Sbjct:  486 PFSNPELGLTDALQCLNSNDWQMKEKGLVNIQRLAACHSEVLGTR---LHDVSLAVTAEVTNLRSKVSRLAISTLGDLFRVLKKNMDQEAEEIVRCLLQKMGN-TSEFIQRAANRALGAMVENVTPARALVALTSAGVYHRNPLVRKCTAKHLSAVLEQIGAEKLLSGSRDNTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANAKFDAFLKQSLPSHDLR---KVMAAIKQRGIQDNHELQSAKGRK--VSKSLVVCENGLPSHEGLGSNGPRLMGLRSSSVRGSVETSEQLRELTRL---LEAKEFQARMEGVGKLLEYCKAKPELVAANLVQVFDVFTPRLHDSNKKVNQWALESLAQMLPILKESIHPMLL-SLIIAAADNLNSKNSGISTAASTVLDAMMGSLDHLCLLQ 888          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Mouse
Match: Togaram2 (TOG array regulator of axonemal microtubules 2 [Source:MGI Symbol;Acc:MGI:2443498])

HSP 1 Score: 165.236 bits (417), Expect = 1.801e-40
Identity = 111/416 (26.68%), Postives = 207/416 (49.76%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQ 4979
            P +NPE  + + L  + + DW+ K   ++ +Q L   H+++L  R   +H + +A+  E  NLRS+V++ AI T G LF  L+KN+D   E IV  LL K G  T+ F+++    +L  M+ENV+P RA  AL  +G  ++N  +R+  A ++  + +++G  K +S  ++  + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + DLR    ++  IK +GI D  +   + G +          + +LV   +               LP  +   +  + L ++   L + +F+ R  G+  ++   +    L   ++ ++     PRL+D+N KV   AL+   +++PI+  +         I   A N  SK+  +  +AS ++D    S D   L+Q
Sbjct:  485 PFSNPELGLTDALQCLNSNDWQMKEKGLVNIQRLAACHSEVLGTR---LHDVSLAVTAEVTNLRSKVSRLAISTLGDLFRVLKKNMDQEAEEIVRCLLQKMGN-TSEFIQRAANRALGAMVENVTPARALVALTSAGVYHRNPLVRKCTAKHLSAVLEQIGAEKLLSGSRDNTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANAKFDAFLKQSLPSHDLR---KVMAAIKQRGIQDNHELQSAKGRK---------VSKSLVVCENG--------------LPSHE-GVETSEQLRELTRLLEAKEFQARMEGVGKLLEYCKAKPELVAANLVQVFDVFTPRLHDSNKKVNQWALESLAQMLPILKESIHPMLL-SLIIAAADNLNSKNSGISTAASTVLDAMMGSLDHLCLLQ 868          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Mouse
Match: Togaram2 (TOG array regulator of axonemal microtubules 2 [Source:MGI Symbol;Acc:MGI:2443498])

HSP 1 Score: 165.236 bits (417), Expect = 1.801e-40
Identity = 111/416 (26.68%), Postives = 207/416 (49.76%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQ 4979
            P +NPE  + + L  + + DW+ K   ++ +Q L   H+++L  R   +H + +A+  E  NLRS+V++ AI T G LF  L+KN+D   E IV  LL K G  T+ F+++    +L  M+ENV+P RA  AL  +G  ++N  +R+  A ++  + +++G  K +S  ++  + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + DLR    ++  IK +GI D  +   + G +          + +LV   +               LP  +   +  + L ++   L + +F+ R  G+  ++   +    L   ++ ++     PRL+D+N KV   AL+   +++PI+  +         I   A N  SK+  +  +AS ++D    S D   L+Q
Sbjct:  485 PFSNPELGLTDALQCLNSNDWQMKEKGLVNIQRLAACHSEVLGTR---LHDVSLAVTAEVTNLRSKVSRLAISTLGDLFRVLKKNMDQEAEEIVRCLLQKMGN-TSEFIQRAANRALGAMVENVTPARALVALTSAGVYHRNPLVRKCTAKHLSAVLEQIGAEKLLSGSRDNTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANAKFDAFLKQSLPSHDLR---KVMAAIKQRGIQDNHELQSAKGRK---------VSKSLVVCENG--------------LPSHE-GVETSEQLRELTRLLEAKEFQARMEGVGKLLEYCKAKPELVAANLVQVFDVFTPRLHDSNKKVNQWALESLAQMLPILKESIHPMLL-SLIIAAADNLNSKNSGISTAASTVLDAMMGSLDHLCLLQ 868          
BLAST of TOG array regulator of axonemal microtubules 1 vs. UniProt/SwissProt
Match: sp|Q6A070|TGRM1_MOUSE (TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3)

HSP 1 Score: 224.557 bits (571), Expect = 1.963e-57
Identity = 150/533 (28.14%), Postives = 282/533 (52.91%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHN---LPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFP---TEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEI---GLLLGKS---RTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILN 5294
            P + P+  + E L L+ +EDWE K+  +  ++ L  FH+DLL  +   +H    A+ +E KNLRS V++ A+   G LF YL+K++D  L++ V  LL KAGE +N+F+R+D++ +L  M+ NV+P RA  +L+  G  + ++A+RR  A ++  + + +   +  S  K+  +++L    KFA D +QETRYYG++ML  +    +FEKL+ K+I +KDL  +K+ ++N+++KG+G+ P   + + G +          + ++      SS       R + R      S +  +++  I   L++ DFRDR NG+  +++  D  N   L   +I KI      RL+D+N+KV + AL+   K+IP++  N         P  ++    N  SK+  +  +A+N++       D  LL+QP        N K K  + + +  +++ +   K  +  + + +++ H++  +   G L G     RT   ++++ L       +  +G  +++ AA +  H +K+++ ++L+
Sbjct: 1254 PFSKPDIALTEALRLLADEDWEKKMEGLNFVRCLAAFHSDLLNTK---LHETTFAVVQEVKNLRSGVSRAAVVCLGDLFTYLKKSMDQELDSAVRALLHKAGE-SNTFIREDVDKALKAMVNNVTPARAVTSLINGGQSHLHIAVRRCTAQHLADVVECMDPERISSGTKDMADRLLPAAAKFAQDSSQETRYYGRKMLFLMMGHPNFEKLLEKYIPSKDLPYIKESVKNLRLKGLGEIPLDTASAKGRRSHPGSVGNTRSSSVSRDAFSSSEREVTEVREVPRKSAPRNSLESAEYIKVITGLLNAKDFRDRINGIKQLLS--DTENNQELVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDNLSPIINMLIPAIVDN---NLNSKNPGIYAAATNVVHALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTHSGSLPGAGGNIRTATAKLSKAL-------FTQMGQNLLNQAASQPPH-IKKSLEELLD 1769          

HSP 2 Score: 94.7449 bits (234), Expect = 8.713e-18
Identity = 138/598 (23.08%), Postives = 262/598 (43.81%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV----TESEKLSTH--------------RQQSIF----DLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNN-----QIHPSEAM 1931
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++ T        + TE+ I +  +L     E+  ET   S L+ I + +G+ R++ +    P  +   +NR    ++SQ  +  P    L  +G FS  + P      +   S++N  +    IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   + +L +L ++   +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKTN L K V+ V   D  N   + +AV  RL++  LP + + G V Y     + ++  S+H              R QS      D    S       S     +R  SAGK  G+ K PW+  +   +G +    S  +     F++++     ++ PS+ M
Sbjct:  136 LYRALGRVLVEGGSEEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREDNPALRKDALQILHICLRRSSG--QVLRTLIQ-GLESP-DARLRASTALLLPILFTPEDLLQGLDLTEVIISLARKLGDQEMEEESET-AFSSLQQIGERLGQERFHSYISRLPSALRRHYNR---RLESQYGSQVPYYLELEASG-FSEDAAPC-----VVNLSSSN--LKFEIIPQEL-----HARLLDQ-EDYKNRTQAVEELKQLLGKFNPSSTPHASLVGFISLLYNLLDDSNFKVVHGTLQVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQRVLSLLLEN---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTNVLFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYAILMPSSAQGRSSHLAHGADTDWLMSGNRTQSAHCYCGDHTRDSMQLYGSYSPTICTRRVLSAGK--GKNKLPWENEQPGVMGENQTSNSKDIKDTEQFSAHDLIPSPKLKPSQGM 702          
BLAST of TOG array regulator of axonemal microtubules 1 vs. UniProt/SwissProt
Match: sp|Q3TYG6|TGRM2_MOUSE (TOG array regulator of axonemal microtubules protein 2 OS=Mus musculus OX=10090 GN=Togaram2 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 1.260e-39
Identity = 111/416 (26.68%), Postives = 207/416 (49.76%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQ 4979
            P +NPE  + + L  + + DW+ K   ++ +Q L   H+++L  R   +H + +A+  E  NLRS+V++ AI T G LF  L+KN+D   E IV  LL K G  T+ F+++    +L  M+ENV+P RA  AL  +G  ++N  +R+  A ++  + +++G  K +S  ++  + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + DLR    ++  IK +GI D  +   + G +          + +LV   +               LP  +   +  + L ++   L + +F+ R  G+  ++   +    L   ++ ++     PRL+D+N KV   AL+   +++PI+  +         I   A N  SK+  +  +AS ++D    S D   L+Q
Sbjct:  485 PFSNPELGLTDALQCLNSNDWQMKEKGLVNIQRLAACHSEVLGTR---LHDVSLAVTAEVTNLRSKVSRLAISTLGDLFRVLKKNMDQEAEEIVRCLLQKMGN-TSEFIQRAANRALGAMVENVTPARALVALTSAGVYHRNPLVRKCTAKHLSAVLEQIGAEKLLSGSRDNTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANAKFDAFLKQSLPSHDLR---KVMAAIKQRGIQDNHELQSAKGRK---------VSKSLVVCENG--------------LPSHE-GVETSEQLRELTRLLEAKEFQARMEGVGKLLEYCKAKPELVAANLVQVFDVFTPRLHDSNKKVNQWALESLAQMLPILKESIHPMLL-SLIIAAADNLNSKNSGISTAASTVLDAMMGSLDHLCLLQ 868          
BLAST of TOG array regulator of axonemal microtubules 1 vs. UniProt/SwissProt
Match: sp|Q6ZUX3|TGRM2_HUMAN (TOG array regulator of axonemal microtubules protein 2 OS=Homo sapiens OX=9606 GN=TOGARAM2 PE=2 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 8.751e-38
Identity = 112/410 (27.32%), Postives = 202/410 (49.27%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFD 4961
            P +NPE  + + L  + + DW+ K   ++++Q L   H+++L  +   +H +C+ +  E  NLRS+V+  AI T G LF  L+KN+D   E I   LL K  + TN F+++    SL  M+ENV+  R+   L  +G  ++N  IR+ AA ++  + +++G  K +S  +++ + ++  +V+ A D NQ+TR+YG++M+  L     F+  + + + + D   L+ ++  IK +GI D  +   + G +    L       N + +    S          + L G     +    LT++   L + DFR R  G+  ++   +    L    + ++     PRL D+N KV   AL+   K+IP++  +         I TVA N  SK+  +  +A  ++D    S D
Sbjct:  484 PFSNPELGLRDALQCLNSSDWQMKEKGLVSIQRLAACHSEVLTGK---LHDVCLVVTGEVTNLRSKVSHLAISTLGDLFQALKKNMDQEAEEIARCLLQKMAD-TNEFIQRAAGQSLRAMVENVTLARSLVVLTSAGVYHRNPLIRKYAAEHLSAVLEQIGAEKLLSGTRDSTDMLVHNLVRLAQDSNQDTRFYGRKMVNILMANTKFDAFLKQSLPSYD---LQKVMAAIKQQGIEDNDELPSAKGRK---VLRSLVVCENGLPIKEGLSCNGPRLVGLRSTLQGRGEMVEQLRELTRL---LEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMIPLLRESLHPMLL-SIIITVADNLNSKNSGIYAAAVAVLDAMVESLD 879          
BLAST of TOG array regulator of axonemal microtubules 1 vs. UniProt/SwissProt
Match: sp|Q9Y4F4|TGRM1_HUMAN (TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4)

HSP 1 Score: 157.532 bits (397), Expect = 5.541e-37
Identity = 131/531 (24.67%), Postives = 247/531 (46.52%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPII---CSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEI---GLLLGKS---RTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILN 5294
            P + PE  + E L L+ +EDWE KI  +  ++ L  FH+++L  +   +H    A+ +E KNLRS V++ A+     LF YL+K++D  L+  V  LL KAGE +N+F+R+D++ +L  M+ NV+P RA  +L+  G        +R     M+           M C                                      +FEK++ K++ +KDL  +KD + N++ KG+G+ P     + G +          + ++      S+  +    R +TR      S +  ++L  I   L++ DFRDR NG+  +++   +  +L   +I KI      RL+D+N+KV + AL+   K+IP++    S       P  ++    N  SK+  +  +A+N++       D  LL+QP        N K K  + + +  +++ +   K  +  + + +++ H++  +   G L G     RT   ++++ L       +  +G  +++ AA +  H +K+++ ++L+
Sbjct: 1251 PFSKPEIALTEALRLLADEDWEKKIEGLNFIRCLAAFHSEILNTK---LHETNFAVVQEVKNLRSGVSRAAVVCLSDLFTYLKKSMDQELDTTVKVLLHKAGE-SNTFIREDVDKALRAMVNNVTPARAVVSLINGG--------QRYYGRKMLFF---------MMC------------------------------------HPNFEKMLEKYVPSKDLPYIKDSVRNLQQKGLGEIPLDTPSAKGRRSHTGSVGNTRSSSVSRDAFNSAERAVTEVREVTRKSVPRNSLESAEYLKLITGLLNAKDFRDRINGIKQLLSDTENNQDLVVGNIVKIFDAFKSRLHDSNSKVNLVALETMHKMIPLLRDHLSPIINMLIPAIVDN---NLNSKNPGIYAAATNVVQALSQHVDNYLLLQPFCTKAQFLNGKAKQDMTEKLADIVTELYQRKPHATEQKVLVVLWHLLGNMTNSGSLPGAGGNIRTATAKLSKAL-------FAQMGQNLLNQAASQPPH-IKKSLEELLD 1713          

HSP 2 Score: 103.99 bits (258), Expect = 1.299e-20
Identity = 115/483 (23.81%), Postives = 220/483 (45.55%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSI-VLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSN--FSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKV--NIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLR--VALTHNVTGD---AITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYV 1667
            L+  + R+L +     ++   ++L +++        ++   S+ +L  L+  L +    +RK A Q LH  L ++    + ++  ++ GL S  D   R      L ++LT+       + TE+ I +  +L     E+  ET   S L+ I + +G+ R+  +    P  +   +NR    ++SQ  +  P    L  +G      FP    P     + +N  +  G IPQ +     H R L+  ED  NR +    +++ +   +P       L+  +     L+  ++FK++   +  +   +V +  + + Q L   +A +  V  D    I Q+Y M   + L ++   +++L +L +    +  K   +R+  ++I   +LL +PS  FDL  +   ++  L+D K +V+QAALE  +V+  + G+GKT+ L K V+ V   D  N   + +AV  RL++  LP + + G V Y 
Sbjct:  136 LYRALGRVLVEGGSDEKRLCLQLLSDVLRGQGEAGQLEEAFSLALLPQLVVSLREENPALRKDALQILHICLKRSPG--EVLRTLIQQGLEST-DARLRASTALLLPILLTTEDLLLGLDLTEVIISLARKLGDQETEEESET-AFSALQQIGERLGQDRFQSYISRLPSALRRHYNR---RLESQFGSQVPYYLELEASG------FPEDPLPCAV--TLSNSNLKFGIIPQEL-----HSRLLDQ-EDYKNRTQAVEELKQVLGKFNPSSTPHSSLVGFISLLYNLLDDSNFKVVHGTLEVLHL-LVIRLGEQVQQFLGPVIAASVKVLADNKLVIKQEY-MKIFLKLMKEVGPQQVLCLLLEH---LKHKHSRVREEVVNICICSLLTYPSEDFDLPKLSFDLAPALVDSKRRVRQAALEAFAVLASSMGSGKTSILFKAVDTVELQD--NGDGVMNAVQARLARKTLPRLTEQGFVEYA 590          
BLAST of TOG array regulator of axonemal microtubules 1 vs. UniProt/SwissProt
Match: sp|Q17423|CREC_CAEEL (Crescerin-like protein che-12 OS=Caenorhabditis elegans OX=6239 GN=che-12 PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 1.201e-21
Identity = 98/437 (22.43%), Postives = 198/437 (45.31%), Query Frame = 3
Query: 3738 LNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE-----FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILI 5033
            L+     +N+ L  + +++W +K+  +  + +L +    ++ +   ++  + IA+  ECKNLRS V++ AI T G +   L   +DS +E I + LLSK+G+ +N+F+R D   SL  +++  +  +A   ++ +G  +KN  IR   A  +  +    G    ++  +     +L  +++F+ D + + R  GK+ L  LSK  +F++L+ K+    +++ +KD+L N++ +G  D      +A +  S S                            TR     + D  +  L +I ++L +  +  R  GL          +    S +++++  + RL D N KV   A++     +  +   + TE        +  + +  + +SKS E ++ A   +     S +   L+     A  KSN K +P ++
Sbjct:  796 LDTSNMSVNQALKKMSSDEWADKVDGLNMISTLSETQPRMVAD---NLKEVIIAILNECKNLRSSVSRVAIVTIGTVAQNLNSKIDSEMEKICAVLLSKSGDVSNAFIRDDATDSLNKLVKAATAGKALQGIILAGAKSKNNTIRSSCANFVYDIITIQGSSAILNN-QNALSNVLPVLLQFSRDQSPQVRNPGKQSLCFLSKDPNFDRLMRKNALESEIKAVKDVLANVEKRGGVD--SLESTANLSGSLSRIGS------------------------TRRVQKKLPDSLQLDLDEIRTELLAAGWERRLTGLQRFEEMCGHASKAVASDTRLIEAFISRLGDTNGKVASCAMETYISTMGSMAKLYSTESNLKAVMNQLAHALTAHLSSKSEEHKHLARTCIQHTIRSIEPVSLLPAMTSATKKSNVKQRPFIL 1202          

HSP 2 Score: 75.8702 bits (185), Expect = 3.701e-12
Identity = 106/488 (21.72%), Postives = 201/488 (41.19%), Query Frame = 3
Query:  237 KLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSF-----PEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSV----MNDLKHERKLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXD-NYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVT 1670
            K  ELF  I +++CD  W ++    + L+  +         +  M  V+ +LI  L  + +TVRK   Q +  +L       + +Q F++   N   + N + +    L  +L     + N+T L    +   T +S  +  E     ++K +   +G    NEF +       PE   +L    +N +  +   +   S  L  + K               P S     +  G +P  V      D    +++  +E +          E+  + PHL   L ++  ++ED N+ V +    L +D+V +    +       + Q + +   H     ++ ++  M   M LFQ  + K +   L   +  +++K   +R+  I+I T++L+    +KF+L  +   +     D K +V+ AA E +SV+ Y   NGKT  ++K V    +    N+  + +AV  R+ +  LP I   G++ Y T
Sbjct:   60 KKGELFKCIDKIICDDRWELQHQCIKFLVEAMP--TFGSATEYCMCFVMPNLIPKLVSNKVTVRKITHQAIATFLRLKP---EALQSFLKMLSNFMPNCNSKSELITELHHILIPELVKSNWTCL----VENFTTESNIQGCEDQAGVLMKKLHYFIG----NEFWQKIITNLSPEKREVLEQITAN-VQVEHTESKAGSGVLRASAK---------------PQSGGERRLRFGIVPSLVCALIAEDTDANQRISGLEKMKQVVDQITPEEIARLVPHLHSYLLMLSNVLEDLNFKVVV----LALDIVRATGHHLKGHMEAHIQQFVNLVAKHFGNQKSVIKQIIMMTFMELFQNINPKTVGGCL---RVFLENKNSRVREEVINIYTASLMTISPSKFNLQPLVNILVPMFHDVKKRVRLAAFEQLSVLAY-LLNGKTEIIMKPVRDFEQDQ--NSRGLTEAVTARIRRQVLPRIRYDGLIEYST 508          
BLAST of TOG array regulator of axonemal microtubules 1 vs. TrEMBL
Match: A0A1I8G8X0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.016e-68
Identity = 152/483 (31.47%), Postives = 260/483 (53.83%), Query Frame = 3
Query: 3732 APLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXX-XXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPG---SDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLP 5165
             PL NP++ + E L  +Q  DW+ K   +  +Q L   H ++      ++H + +A+  E KNLRSQV++ A+ T G L  +L K +D+ LE     LL K  E TN F+++D E++L+ M+E+ +  RA  A++Q G  +K+  +R L A  +  LCDR+G  + +S +K+  +K+L+    F +DG+QETRY+G+ +L  L   QDF+ LI+KH+    +R LKD+LEN+++KG+GD    + SAG +      +    + +L    + +S+  + +     R      S +SD   D +   C +L++ D+++R +G+D +    ++  +L  + I K +    PRL D+N+KV   AL+   +++  + +  PT      +   A   +SKS EL + A  L+DI     D   L QP ++A+   NP++KP L+D +  L   +   K P  ++       H+ PE+  LLG   + P
Sbjct:  121 GPLANPDRSLQEALTRVQASDWQAKCEGLQLVQRLAANHPEVAAR---EMHPLTLAVIGEVKNLRSQVSRLAMSTLGCLLQHLGKRMDAELEQCAKILLQKGSE-TNKFIQEDAESALMSMVEHCNQGRALGAIIQGGASHKSSQVRSLCAQILSELCDRMGPGRVLSGVKDVTDKLLATAANFCLDGSQETRYWGRTILYPLLGHQDFDALISKHVSPAVMRNLKDVLENLRLKGVGDQPPSTFSAGTKSRRGNSAGSADSASLAGSYASTSTTGQSAPLGRQRGAAGSNSRLSDAAADLVKTACQRLNAPDWKERLSGIDQLAELSQERTDLVGQCIVKFMDAFAPRLGDSNSKVQQHALETALQLVHPLRNYLPT-VANTLVQHAAPVLSSKSAELASLAGQLLDIFILEVDSEKLAQPFVQAVATGNPRSKPELVDKLAALAERLAPRK-PRLSQ------LHLEPELFRLLGGLASAP 591          
BLAST of TOG array regulator of axonemal microtubules 1 vs. TrEMBL
Match: A0A1I8GCX0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.971e-67
Identity = 149/480 (31.04%), Postives = 257/480 (53.54%), Query Frame = 3
Query: 3732 APLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXX-XXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLP 5165
             PL NP++ + E L  +Q  DW+ K   +  +Q L   H ++      ++H + +A+  E KNLRSQV++ A+ T G L  +L K +D+ LE     LL K  E TN F+++D E++L+ M+E+ +  RA  A++Q G  +K+  +R L A  +  LCDR+G  + +S +K+  +K+L+    F +DG+QETRY+G+ +L  L   QDF+ LI+KH+    +R LKD+LEN+++KG+GD    + SAG +      +    + +L    + +S+  + +     R      +    D +   C +L++ D+++R +G+D +    ++  +L  + I K +    PRL D+N+KV   AL+   +++  + +  PT      +   A   +SKS EL + A  L+DI     D   L QP ++A+   NP++KP L+D +  L   +   K P  ++       H+ PE+  LLG   + P
Sbjct:  121 GPLANPDRSLQEALTRVQASDWQAKCEGLQLVQRLAANHPEVAAR---EMHPLILAVIGEVKNLRSQVSRLAMSTLGCLLQHLGKRMDAELEQCAKILLQKGSE-TNKFIQEDAESALMSMVEHCNQGRALGAIIQGGASHKSSQVRSLCAQILSELCDRMGPGRVLSGVKDVTDKLLATAANFCLDGSQETRYWGRTILYPLLGHQDFDALISKHVSPAVMRNLKDVLENLRLKGVGDQPPSTFSAGTKSRRGNSAGSADSASLAGSYASTSTTGQSAPLGRQRGAAGSNTTPAADLVKTACQRLNAPDWKERLSGIDQLAELSQERTDLVGQCIVKFMDAFAPRLGDSNSKVQQHALETALQLVHPLRNYLPT-VANTLVQHAAPVLSSKSAELASLAGQLLDIFILEVDSEKLAQPFVQAVATGNPRSKPELVDKLAALAERLAPRK-PRLSQ------LHLEPELFRLLGGLASAP 588          
BLAST of TOG array regulator of axonemal microtubules 1 vs. TrEMBL
Match: A0A267F9A3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001542g5 PE=4 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.582e-66
Identity = 152/483 (31.47%), Postives = 260/483 (53.83%), Query Frame = 3
Query: 3732 APLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXX-XXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPG---SDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLP 5165
             PL NP++ + E L  +Q  DW+ K   +  +Q L   H ++      ++H + +A+  E KNLRSQV++ A+ T G L  +L K +D+ LE     LL K  E TN F+++D E++L+ M+E+ +  RA  A++Q G  +K+  +R L A  +  LCDR+G  + +S +K+  +K+L+    F +DG+QETRY+G+ +L  L   QDF+ LI+KH+    +R LKD+LEN+++KG+GD    + SAG +      +    + +L    + +S+  + +     R      S +SD   D +   C +L++ D+++R +G+D +    ++  +L  + I K +    PRL D+N+KV   AL+   +++  + +  PT      +   A   +SKS EL + A  L+DI     D   L QP ++A+   NP++KP L+D +  L   +   K P  ++       H+ PE+  LLG   + P
Sbjct:  481 GPLANPDRSLQEALTRVQASDWQAKCEGLQLVQRLAANHPEVAAR---EMHPLTLAVIGEVKNLRSQVSRLAMSTLGCLLQHLGKRMDAELEQCAKILLQKGSE-TNKFIQEDAESALMSMVEHCNQGRALGAIIQGGASHKSSQVRSLCAQILSELCDRMGPGRVLSGVKDVTDKLLATAANFCLDGSQETRYWGRTILYPLLGHQDFDALISKHVSPAVMRNLKDVLENLRLKGVGDQPPSTFSAGTKSRRGNSAGSADSASLAGSYASTSTTGQSAPLGRQRGAAGSNSRLSDAAADLVKTACQRLNAPDWKERLSGIDQLAELSQERTDLVGQCIVKFMDAFAPRLGDSNSKVQQHALETALQLVHPLRNYLPT-VANTLVQHAAPVLSSKSAELASLAGQLLDIFILEVDSEKLAQPFVQAVATGNPRSKPELVDKLAALAERLAPRK-PRLSQ------LHLEPELFRLLGGLASAP 951          
BLAST of TOG array regulator of axonemal microtubules 1 vs. TrEMBL
Match: A0A267GBT4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001595g3 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.112e-66
Identity = 155/485 (31.96%), Postives = 262/485 (54.02%), Query Frame = 3
Query: 3732 APLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD--PSQFSHSAGMQXXXX-XXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPG---SDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLP 5165
             PL NP++ + E L  +Q  DW+ K   +  +Q L   H ++      ++H + +A+  E KNLRSQV++ A+ T G L  +L K +D+ LE     LL K  E TN F+++D E++L+ M+E+ +  RA  A++Q G  +K+  +R L A  +  LCDR+G  + +S +K+  +K+L+    F +DG+QETRY+G+ +L  L   QDF+ LI+KH+    +R LKD+LEN+++KG+GD  PS F  SAG +      +    + +L    + +S+  + +     R      S +SD   D +   C +L++ D+++R +G+D +    ++  +L  + I K +    PRL D+N+KV   AL+   +++  + +  PT      +   A   +SKS EL + A  L+DI     D   L QP ++A+   NP++KP L+D +  L   +   K P  ++       H+ PE+  LLG   + P
Sbjct:  481 GPLANPDRSLQEALTRVQASDWQAKCEGLQLVQRLAANHPEVAAR---EMHPLILAVIGEVKNLRSQVSRLAMSTLGCLLQHLGKRMDAELEQCAKILLQKGSE-TNKFIQEDAESALMSMVEHCNQGRALGAIIQGGASHKSSQVRSLCAQILSELCDRMGPGRVLSGVKDVTDKLLATAANFCLDGSQETRYWGRTILYPLLGHQDFDALISKHVSPAVMRNLKDVLENLRLKGVGDQPPSTF--SAGTKSRRGNSAGSADSASLAGSYASTSATGQSAPLGRQRGAAGSNSRLSDAAADLVKTACQRLNAPDWKERLSGIDQLAELSQERTDLVGQCIVKFMDAFAPRLGDSNSKVQQHALETALQLVHPLRNYLPT-VANTLVQHAAPVLSSKSAELASLAGQLLDIFILEVDSEKLAQPFVQAVATGNPRSKPELVDKLAALAERLAPRK-PRLSQ------LHLEPELFRLLGGLASAP 951          
BLAST of TOG array regulator of axonemal microtubules 1 vs. TrEMBL
Match: A0A267FA51 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001542g1 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 4.634e-65
Identity = 152/483 (31.47%), Postives = 260/483 (53.83%), Query Frame = 3
Query: 3732 APLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXX-XXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPG---SDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVT-KRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLP 5165
             PL NP++ + E L  +Q  DW+ K   +  +Q L   H ++      ++H + +A+  E KNLRSQV++ A+ T G L  +L K +D+ LE     LL K  E TN F+++D E++L+ M+E+ +  RA  A++Q G  +K+  +R L A  +  LCDR+G  + +S +K+  +K+L+    F +DG+QETRY+G+ +L  L   QDF+ LI+KH+    +R LKD+LEN+++KG+GD    + SAG +      +    + +L    + +S+  + +     R      S +SD   D +   C +L++ D+++R +G+D +    ++  +L  + I K +    PRL D+N+KV   AL+   +++  + +  PT      +   A   +SKS EL + A  L+DI     D   L QP ++A+   NP++KP L+D +  L   +   K P  ++       H+ PE+  LLG   + P
Sbjct: 1279 GPLANPDRSLQEALTRVQASDWQAKCEGLQLVQRLAANHPEVAAR---EMHPLTLAVIGEVKNLRSQVSRLAMSTLGCLLQHLGKRMDAELEQCAKILLQKGSE-TNKFIQEDAESALMSMVEHCNQGRALGAIIQGGASHKSSQVRSLCAQILSELCDRMGPGRVLSGVKDVTDKLLATAANFCLDGSQETRYWGRTILYPLLGHQDFDALISKHVSPAVMRNLKDVLENLRLKGVGDQPPSTFSAGTKSRRGNSAGSADSASLAGSYASTSTTGQSAPLGRQRGAAGSNSRLSDAAADLVKTACQRLNAPDWKERLSGIDQLAELSQERTDLVGQCIVKFMDAFAPRLGDSNSKVQQHALETALQLVHPLRNYLPT-VANTLVQHAAPVLSSKSAELASLAGQLLDIFILEVDSEKLAQPFVQAVATGNPRSKPELVDKLAALAERLAPRK-PRLSQ------LHLEPELFRLLGGLASAP 1749          

HSP 2 Score: 139.428 bits (350), Expect = 5.882e-29
Identity = 125/539 (23.19%), Postives = 243/539 (45.08%), Query Frame = 3
Query:  249 LFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLN--KTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLT----PG-------------------------------STTNETVFVGFIPQSVMNDLKHERKL----EAIEDINNRFKVNIEREMKTIS---PHXXXXXXXXXXXXXDNYLVFITS------FKLLI---DVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTL-LKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQ 1703
            LF  +   L DPDW +R     +L+ +  +    + +   M+ VL  L+ CL+D  +  R++ TQCLH Y+    + N E  +   + YGL++     QR +   ++ V+LT + +  NF++L   +   LT  S+++ +    +  L++I+  +G+  +N + +     +   + + S  +D       PS   L+     +  +  + + P +     PG                               ST +   F G +P+++++ L    ++    +AIED+         R++ T+    PHL            + +L F+ S      F++ I   D++  +   + S+    L  LL         G  + +   M  +++L      + +L +L ++   ++ +   +RQ ++++  SAL+ FPS+ FDL  +C  ++  LLD K +V+ AALE ++++    G+G+   L L + EQ T+ D   AT + +AV++RL+K +LP +   G+V Y       +T R Q
Sbjct:   81 LFQPVSLALRDPDWEVRNKAINLLVEVTPR--FGQQLSEGMAEVLPGLVACLADIKVANRRATTQCLHTYMKTMGSANTEPVLGAIIRYGLDAADPEIQR-NVCVSVPVLLTPDLAGGNFSQLVAALAKCLT--SKDEAMANAALHALEAIRSTLGDQLFNGYLQQLNPPLRRYYFQVSGHVD-------PS---LISMATAAVDAAALSRSPNMQRRPIPGISDSTVTQQYYPSQQQQQQQQQQQYYQPAKQSTASNDAF-GCVPRNLVDQLDDREEISLRAQAIEDLRTHL-----RQLDTLEAAVPHL------------EKFLAFLHSLLDDVNFRIAIVTLDILYLLANRLGSRLQPHLRSLLAGITKRMSDGKNVVRTALMKLAILLMHNHRPQIVLDLLLNN---LEHRNSRVRQETLNMTISALVTFPSSDFDLPRLCNCIAPALLDPKRQVRHAALEVMALLAQGLGSGRLQPLQLAVREQETRPD---ATGLFEAVMSRLAKRQLPRLSAEGLVEYAIPVPSSATRRPQ 580          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035739.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:4667717:4673582:-1 gene:ENSAMXG00000039483.1 transcript:ENSAMXT00000035739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 7.777e-38
Identity = 109/391 (27.88%), Postives = 199/391 (50.90%), Query Frame = 3
Query: 3990 LDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISK---ILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKS 5153
            +D  L+     LL KAGE +++F+R D++A+L  M++N +P R+ +ALL  G  + N  +R+  + ++ +L +++G  + +S  K+  ++IL  + K A D +QETRY+G++MLL LS  +DF+K++ K+I  KDL  ++D +  +K KG+G+    + SA  + S S        +L      + S  +    S+          D  +++ ++ + + S DFR+R  G+  +VT  D  + P   I     +      RL ++N+KV + AL+  QKII ++  +     F      V  +  SK+  +  +A    +   ++ D +LL+QP        + K K +L+D + K L          + R   ++ + V+P +  LLG S
Sbjct:    1 MDQELDATAKALLHKAGE-SSAFIRLDVDAALDSMVQNCTPTRSMSALLTGGLGHLNAGVRKCTSQHLAVLVEKIGAARLLSGTKDLTDRILPAVCKLAQDSSQETRYHGRKMLLLLSSHRDFDKMLIKYIPDKDLATIRDTVLTLKTKGLGEMHHDTPSARGRHSLSGGGLEHVSSLTRDSQHAHSKDKAQIHSIA---------DKTEYIKQLKALMGSKDFRERIKGISQLVT--DCEDNPYLVIGNMFPVFDAFKSRLLESNSKVNLYALEALQKIIKLLNDHLSQVVFILVPAIVDNHLNSKNDAIYMAAIGATEALISNLDSTLLLQPFCTKAQFLSGKAKVVLVDKLAKEL----------YPRKPQLVEQKVLPLLWHLLGTS 369          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000160.1 (pep scaffold:Pmarinus_7.0:GL476617:577683:601538:1 gene:ENSPMAG00000000139.1 transcript:ENSPMAT00000000160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.46 bits (537), Expect = 4.604e-55
Identity = 136/468 (29.06%), Postives = 240/468 (51.28%), Query Frame = 3
Query: 3735 PLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGD-PSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXX-XXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILK---DLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVI 5123
            P +NPE  I++ L L+  +DWE K+  +   Q L  FH +LL  R   +H +  A+ KE KNLRS VA+ A+     +F++L+K +D  L+ +   LL K+GE TN+F+R+DI  +L  M+ NV+  RA  AL+  G  ++N+ +R+  A +++ + +RLG  + ++ IK+  +++L     FA D + ETRYYGK+ML  +    DF+K+I+K++  KDL  ++D +  ++ KG+G+ P + S + G +       G      V  G+ + +       R     P +    D  + L  +   L+S DFR+R  G++ +V     H  P    S ++K      PRL ++N+KV  +AL+    IIP +  N            V  N  SK   +  +A++++D      D   L+Q      +  + + K  + + +  L+  + + K  +  R++  +  H++
Sbjct: 1076 PSSNPEADIDQLLVLLSKDDWEKKMLGISYAQRLATFHPELLATR---LHEVSFAVTKEAKNLRSTVARAAVSCISDMFVHLKKGMDQELDTVTQVLLHKSGE-TNNFMREDIVKALETMVANVTATRALTALINGGFAHRNIYVRKCTAQHLIPVVERLGAARLLAGIKDVTDRVLLAATAFAQDASPETRYYGKKMLFIMMGHPDFDKMIDKYVLPKDLHYVRDTVTTLRNKGLGESPPEISSAHGRRSLPGSGLGTRPAQDVRDGTNTRAREEVMPPREAPYRPLARSQSDYSERLKAVTGLLASKDFRERIKGIEMLV--ETCHANPDCVASNVVKFFDVFTPRLQESNSKVNQAALESLLLIIPALKDNLVQVVQSVVPAVVDNNLNSKLSGIYTAATSVIDTLMQHIDNIHLLQLFSNKAHFGSGRVKLDMTERLADLVETLYTKKPQAVERNVLPVFWHLL 1537          

HSP 2 Score: 68.5514 bits (166), Expect = 1.432e-11
Identity = 45/160 (28.12%), Postives = 82/160 (51.25%), Query Frame = 3
Query: 1197 VALTHNVTGDA--ITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVT 1670
            VA    V GD   +T++  +   + L +    + +L +L  +  +  S+   +R+  ++ V +A+L FP ++F+L  +C  ++  L D K KV+ AALE  +V+    G GK   L+  V+ V     ++   +  AV  RL++ +LP +   G+V Y T
Sbjct:  246 VAALVKVLGDGKEVTKQECLRIFLRLMETVPPQRVLDILLGA--LGSSRNARVREDILNTVIAAVLSFPRSRFNLPELCRVLAPSLADPKRKVRHAALETFAVLAALMGPGKLPPLVDAVDAVELS--ADVDGLMAAVQARLARRQLPKLGASGLVEYAT 401          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Nematostella
Match: EDO28071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7I0])

HSP 1 Score: 141.354 bits (355), Expect = 4.285e-38
Identity = 75/197 (38.07%), Postives = 121/197 (61.42%), Query Frame = 3
Query: 3798 ENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQA 4388
            E K   +  ++ L + H D L+   P +H + +A+  E KNLRSQV++ AI     +F+ L +N+D+ LE     LL+K+GE T+ F+R ++E  LL MI NV+  RA  A+  +G  ++N+AIR+ AA  + +L +R+G  + MS  K+  ++IL    +FA DG  ETRYYG+++L  +    +F+KL+ KH+ A
Sbjct:    1 EVKCEGLQCVRRLAKPHPDTLV---PQLHTLLLAVGPEAKNLRSQVSRAAICCLTDMFVCLGRNMDTDLEYTSKILLTKSGE-TSGFIRDEVEKCLLAMISNVTATRALLAVTSTGCGHRNVAIRKTAAQFLSILAERIGANRLMSGAKDVTDRILPAAAQFATDGGSETRYYGRKILYGIYDHPEFDKLLTKHVPA 193          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Nematostella
Match: EDO48446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIR6])

HSP 1 Score: 134.035 bits (336), Expect = 3.835e-32
Identity = 147/565 (26.02%), Postives = 258/565 (45.66%), Query Frame = 3
Query:  126 DRKNGINK--FLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVE----------------------NGKFSNA----SFPVKK-FPPLTPGSTTNETVFVGFIPQSVMNDLKHER----KLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXDNYL-VFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVL----TRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQS 1706
            D+ NG  +   +EE++      +  N     +LLF ++   + LF   +  LCD D  +R    E + +II +     ++D  MS+VL  L+  L +  +TV+KS+ Q LH Y+  + N        +E+GL S+ D   R ++  AL +++T N +  +   LT  ++ +L   S   R E +V+S L  I+ +VG+ R++++    P         C +A+  Q  TA   S  + E                      NG+  N     +  V K +        ++E V  GF+P++V+  L+ +     + + IE++  +  ++   +  T+ PHL  L  L+L  ++D    + +TS +++  +V+ +    V  +L  L+  L   L  N     + ++  M   M L Q    K +L +L  S   +   +  +R+ ++++V  ALL FP + FDL  +   V+  L D K KV+QAALE  +VI    G G    ++  V+ V        T  GD V+     RL++ +LP ++  G+V Y        T R QS
Sbjct:   12 DKANGTRRAAIIEELR----ASVRRNGG---RLLFEDR---HGLFHVFQGALCDSDPNVRLRCIEFISDIIPE--FGSDLDNCMSLVLPQLVSNLGNHNVTVKKSSIQTLHVYMKSSSNVGAVFNAIIEHGLESE-DKRTRAESVVALPILITPNLAHEDLFVLTKALVARLESSS---RPEPMVLS-LDRIRNVVGQDRFDDYIHRLPSQQQKF---CFDAV-QQYGTAIDRSIEMPELRKAKSAGHINSNGVIEYEGDKNGEHKNLDRGHTIAVSKGYATRESLHLSDEGVEFGFVPRNVVTKLRDQSNWRIRAQGIEEL--KMVMSHLTDTSTLLPHLASLFGLLLDFLDDLNFKITVTSLQIIGLLVAKLGV-AVGPFLKPLVCALANKLGDN---KIVIRQENMKVLMQLMQILSAKSVLNVLTSS---LQHPKSKVREETLNVVIGALLTFPRSDFDLPELTNAVAPALADNKRKVRQAALEAFAVIAQAMGPGHLQPVVSAVDSV------ELTRSGDGVMAAVQARLARRQLPRLNSDGLVEYAIPVPSSGTVRGQS 540          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Nematostella
Match: EDO48447 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIR8])

HSP 1 Score: 116.316 bits (290), Expect = 1.069e-29
Identity = 65/171 (38.01%), Postives = 102/171 (59.65%), Query Frame = 3
Query: 3798 ENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETR 4310
            E K   +  ++ L + H D L+   P +H + +A+  E KNLRSQV++ AI     +F+ L +N+D+ LE     LL+K+GE T+ F+R ++E  LL MI NV+  RA  A+  +G  ++N+AIR+ AA  + +L +R+G  + MS  K+  + IL    +FA DG  ETR
Sbjct:    1 EVKCEGLQCVRRLAKHHPDTLV---PQLHTLLLAVGPEAKNLRSQVSRAAICCLTDMFVCLGRNMDTDLEYTSKILLTKSGE-TSGFIRDEVEKCLLAMISNVTATRALLAVTSTGCGHRNVAIRKTAAQFLSILAERIGANRLMSGAKDVTDHILPAAAQFATDGGSETR 167          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Medaka
Match: TOGARAM1 (TOG array regulator of axonemal microtubules 1 [Source:NCBI gene;Acc:101155478])

HSP 1 Score: 227.254 bits (578), Expect = 2.290e-59
Identity = 154/501 (30.74%), Postives = 271/501 (54.09%), Query Frame = 3
Query: 3726 NPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE---FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGI 5216
            N  P + PE  + +  NL+ +EDW+ KI  ++ ++SL  +H D L +   ++H +C+ + +E KNLRS V++ A+ T G+LF +L++ +D  LE  V  LL KAGE +N+F+RQD++A+L  M+++ +P R+ +ALL  G  + +  +R+ AA ++  L  ++G  + +S  K   E+IL  + K A D +Q+ RYYG+++LL LS   DF+ L+ K+I +KDL+ ++D +  +K +G+G+  Q + SA  +RS   S    A +L +      S     S    R     I+ D  +++ +I   L+S DF+DR  G+D +V   +D  N+   S+  +   L  RL ++N+KV + AL+  QKII ++  N         P  ++    +  SK+  + ++A   ++   ++ D  LL+QP        + K K  LI+ +  L++ +       + R    + + V+P +  LLG S T     N +  NL   + G+
Sbjct:  915 NMGPFSKPELVLTQSFNLLSSEDWDKKIEGLMLLRSLALYHPDTLHS---NLHEVCLCVIQEVKNLRSGVSRVALCTLGELFTHLQRTMDLELEGTVKALLQKAGE-SNAFIRQDVDAALDCMVQHCTPTRSISALLSGGLSHLSPVVRKCAAQHLANLVKKVGAARLLSGGKNLTERILPAVTKLAQDSSQDARYYGRQILLFLSSHPDFDTLLEKYIPSKDLQTVRDSVFALKTRGLGETPQDTQSARGRRSLPGSGTARASSL-NREPLHQSNRESRSHPSCRTQAKSIA-DKTEYIQQISGLLASKDFKDRIKGIDQLVADCQDNPNMVINSMFPVFDALKARLQESNSKVNLYALESLQKIIHLLKDNLSQVVNILVPAIVDN---HLNSKNNAIYSAAVGAINALISNLDNMLLLQPFCTKAQFLSGKAKVDLIEKVADLVTEL-------YPRKPQTVEQKVLPLLWHLLGTS-THSGTTNSRGSNLRGATVGL 1398          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Medaka
Match: TOGARAM1 (TOG array regulator of axonemal microtubules 1 [Source:NCBI gene;Acc:101155478])

HSP 1 Score: 227.254 bits (578), Expect = 2.512e-59
Identity = 154/501 (30.74%), Postives = 271/501 (54.09%), Query Frame = 3
Query: 3726 NPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTK-RDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTE---FFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGI 5216
            N  P + PE  + +  NL+ +EDW+ KI  ++ ++SL  +H D L +   ++H +C+ + +E KNLRS V++ A+ T G+LF +L++ +D  LE  V  LL KAGE +N+F+RQD++A+L  M+++ +P R+ +ALL  G  + +  +R+ AA ++  L  ++G  + +S  K   E+IL  + K A D +Q+ RYYG+++LL LS   DF+ L+ K+I +KDL+ ++D +  +K +G+G+  Q + SA  +RS   S    A +L +      S     S    R     I+ D  +++ +I   L+S DF+DR  G+D +V   +D  N+   S+  +   L  RL ++N+KV + AL+  QKII ++  N         P  ++    +  SK+  + ++A   ++   ++ D  LL+QP        + K K  LI+ +  L++ +       + R    + + V+P +  LLG S T     N +  NL   + G+
Sbjct:  938 NMGPFSKPELVLTQSFNLLSSEDWDKKIEGLMLLRSLALYHPDTLHS---NLHEVCLCVIQEVKNLRSGVSRVALCTLGELFTHLQRTMDLELEGTVKALLQKAGE-SNAFIRQDVDAALDCMVQHCTPTRSISALLSGGLSHLSPVVRKCAAQHLANLVKKVGAARLLSGGKNLTERILPAVTKLAQDSSQDARYYGRQILLFLSSHPDFDTLLEKYIPSKDLQTVRDSVFALKTRGLGETPQDTQSARGRRSLPGSGTARASSL-NREPLHQSNRESRSHPSCRTQAKSIA-DKTEYIQQISGLLASKDFKDRIKGIDQLVADCQDNPNMVINSMFPVFDALKARLQESNSKVNLYALESLQKIIHLLKDNLSQVVNILVPAIVDN---HLNSKNNAIYSAAVGAINALISNLDNMLLLQPFCTKAQFLSGKAKVDLIEKVADLVTEL-------YPRKPQTVEQKVLPLLWHLLGTS-THSGTTNSRGSNLRGATVGL 1421          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000016691.1 (SMESG000016691.1)

HSP 1 Score: 3339.28 bits (8657), Expect = 0.000e+0
Identity = 1745/1749 (99.77%), Postives = 1745/1749 (99.77%), Query Frame = 3
Query:   72 MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTXXXXXXXXXXXXXXXXLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFVSHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRISPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLSSRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTXXXXXXXXXXXXHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPXXXXXXXXXXXXXXXXXINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 5318
            MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE    GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFVSHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRISPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLSSRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ
Sbjct:    1 MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE----GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFVSHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRISPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLSSRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 1745          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000016691.1 (SMESG000016691.1)

HSP 1 Score: 3324.64 bits (8619), Expect = 0.000e+0
Identity = 1738/1742 (99.77%), Postives = 1738/1742 (99.77%), Query Frame = 3
Query:   93 MLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTXXXXXXXXXXXXXXXXLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFVSHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRISPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLSSRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTXXXXXXXXXXXXHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPXXXXXXXXXXXXXXXXXINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 5318
            MLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE    GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFVSHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRISPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLSSRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ
Sbjct:    1 MLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE----GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFVSHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRISPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLSSRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 1738          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000016691.1 (SMESG000016691.1)

HSP 1 Score: 1697.18 bits (4394), Expect = 0.000e+0
Identity = 882/887 (99.44%), Postives = 883/887 (99.55%), Query Frame = 3
Query:   72 MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTXXXXXXXXXXXXXXXXLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGI 2732
            MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE    GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKG+
Sbjct:    1 MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE----GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGM 883          

HSP 2 Score: 1387.09 bits (3589), Expect = 0.000e+0
Identity = 739/740 (99.86%), Postives = 739/740 (99.86%), Query Frame = 3
Query: 3099 KSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTXXXXXXXXXXXXHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPXXXXXXXXXXXXXXXXXINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 5318
            K MLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ
Sbjct:  881 KGMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 1620          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000016691.1 (SMESG000016691.1)

HSP 1 Score: 1684.46 bits (4361), Expect = 0.000e+0
Identity = 875/880 (99.43%), Postives = 876/880 (99.55%), Query Frame = 3
Query:   93 MLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHXXXXXXXXXXXXXDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLEXXXXXXXXXXXXXPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTXXXXXXXXXXXXXXXXLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGI 2732
            MLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE    GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKG+
Sbjct:    1 MLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLLFSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHMSIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNSKLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETIVISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSSWNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERKLEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKLLIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLFQKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDFICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGDPSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLENSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNE----GNSNNHKSIPLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLSSNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKHNKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAIDSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKIFKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTFKPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGM 876          

HSP 2 Score: 1387.86 bits (3591), Expect = 0.000e+0
Identity = 739/740 (99.86%), Postives = 739/740 (99.86%), Query Frame = 3
Query: 3099 KSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTXXXXXXXXXXXXHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPXXXXXXXXXXXXXXXXXINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQXXXXXXXXXXXXNLVXXXXXXXXXXXXXXXXMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 5318
            K MLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ
Sbjct:  874 KGMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSHSETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGIMSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRKPPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKPASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILENIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSRSMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLPQRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFINTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTKPILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQVNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ 1613          
BLAST of TOG array regulator of axonemal microtubules 1 vs. Planmine SMEST
Match: SMESG000017831.1 (SMESG000017831.1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.518e-12
Identity = 63/202 (31.19%), Postives = 104/202 (51.49%), Query Frame = 3
Query: 3780 IQNEDWENKISAMITMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLFIYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRAFNALLQSGTDNKNMAIRRLAACNM-MLLCDRLGYFKTMSCIKETPEKILSGIVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHI 4382
            + + DW      +  +Q L++     LL+ S  I  I   +    K+LRSQV++  IQT  Q+   L   LDS  + I + ++ KAGE  N F+R D+  ++   + ++S +++  AL +    ++N  +R++ A N+  LL + L    + + IK    KI+    K A D N+ETRYY K +L    KQ   E L ++HI
Sbjct:   52 LADSDWNKICEGLSGIQQLMRSDQVGLLD-SNQIRWILSLISDTTKSLRSQVSRLGIQTLTQVIQCLGLGLDSDADLIAAIIIGKAGE-INKFIRDDLNKTIKCFLISLSLEKSLIALNKLALHHRNGNVRKIFAENVNWLLTENLQNLNSNNKIK---NKIIEISRKMAKDSNEETRYYAKAIL----KQIPEEWLEDEHI 244          
The following BLAST results are available for this feature:
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOGARAM12.189e-5728.46TOG array regulator of axonemal microtubules 1 [So... [more]
TOGARAM25.357e-4125.23TOG array regulator of axonemal microtubules 2 [So... [more]
TOGARAM11.154e-3724.67TOG array regulator of axonemal microtubules 1 [So... [more]
TOGARAM11.755e-2123.81TOG array regulator of axonemal microtubules 1 [So... [more]
TOGARAM21.165e-1528.40TOG array regulator of axonemal microtubules 2 [So... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
che-129.409e-2422.43Crescerin-like protein che-12 [Source:UniProtKB/S... [more]
che-123.227e-2322.43Crescerin-like protein che-12 [Source:UniProtKB/S... [more]
che-123.908e-2322.65Crescerin-like protein che-12 [Source:UniProtKB/S... [more]
che-129.441e-2322.43Crescerin-like protein che-12 [Source:UniProtKB/S... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG423994.157e-2526.96gene:FBgn0259818 transcript:FBtr0301929[more]
CG423994.262e-2526.96gene:FBgn0259818 transcript:FBtr0330643[more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000051497.13.290e-5140.08TOG array regulator of axonemal microtubules 1 [So... [more]
ENSXETT00000051492.14.634e-5140.08TOG array regulator of axonemal microtubules 1 [So... [more]
TOGARAM25.240e-4326.95TOG array regulator of axonemal microtubules 2 [So... [more]
TOGARAM24.609e-2425.22TOG array regulator of axonemal microtubules 2 [So... [more]
ENSXETT00000051506.11.863e-1428.81TOG array regulator of axonemal microtubules 1 [So... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Togaram12.806e-5828.14TOG array regulator of axonemal microtubules 1 [So... [more]
Togaram12.863e-5828.14TOG array regulator of axonemal microtubules 1 [So... [more]
Togaram21.106e-4027.88TOG array regulator of axonemal microtubules 2 [So... [more]
Togaram21.801e-4026.68TOG array regulator of axonemal microtubules 2 [So... [more]
Togaram21.801e-4026.68TOG array regulator of axonemal microtubules 2 [So... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6A070|TGRM1_MOUSE1.963e-5728.14TOG array regulator of axonemal microtubules prote... [more]
sp|Q3TYG6|TGRM2_MOUSE1.260e-3926.68TOG array regulator of axonemal microtubules prote... [more]
sp|Q6ZUX3|TGRM2_HUMAN8.751e-3827.32TOG array regulator of axonemal microtubules prote... [more]
sp|Q9Y4F4|TGRM1_HUMAN5.541e-3724.67TOG array regulator of axonemal microtubules prote... [more]
sp|Q17423|CREC_CAEEL1.201e-2122.43Crescerin-like protein che-12 OS=Caenorhabditis el... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G8X04.016e-6831.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GCX01.971e-6731.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F9A31.582e-6631.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GBT42.112e-6631.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FA514.634e-6531.47Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000035739.17.777e-3827.88pep primary_assembly:Astyanax_mexicanus-2.0:9:4667... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000160.14.604e-5529.06pep scaffold:Pmarinus_7.0:GL476617:577683:601538:1... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO280714.285e-3838.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484463.835e-3226.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484471.069e-2938.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TOGARAM12.290e-5930.74TOG array regulator of axonemal microtubules 1 [So... [more]
TOGARAM12.512e-5930.74TOG array regulator of axonemal microtubules 1 [So... [more]
back to top
BLAST of TOG array regulator of axonemal microtubules 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016691.10.000e+099.77SMESG000016691.1[more]
SMESG000016691.10.000e+099.77SMESG000016691.1[more]
SMESG000016691.10.000e+099.44SMESG000016691.1[more]
SMESG000016691.10.000e+099.43SMESG000016691.1[more]
SMESG000017831.12.518e-1231.19SMESG000017831.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035139 ID=SMED30035139|Name=TOG array regulator of axonemal microtubules 1|organism=Schmidtea mediterranea sexual|type=transcript|length=5760bp
ATAAAATTGAATGTTACTTAAGATTTTTATGAAAAATATATAATTAGAAA
TGGATTTTTGATAATAAATAAATGGAGTTAAATTTAGACTTGATGTTACA
AAATCTAAATGCTACTGCTACAGATGATCGTAAAAATGGCATCAATAAAT
TTCTCGAAGAAATAAAAAATTATTATCAATACGATATCAATGAAAATAAT
TCTAATATCATTAAACTTTTGTTTTCAAATCAATTAAAGCTCAATGAACT
ATTTGCAACAATTAGACGATTATTGTGCGATCCAGACTGGCGAATCAGAA
AAGATACTTTTGAAATATTAATTAATATTATTACGAAAGATGTTTTGAAA
GAAAATATTGATATCCACATGTCTATTGTTCTTAAACATTTAATCAAATG
TCTTAGTGATTCAATGATGACTGTGAGAAAAAGCGCTACACAGTGTTTAC
ATGAATACTTAAACAAAACAAAAAACTTCGAAAAATGCATGCAAGAATTT
GTTGAATATGGTTTAAACAGTAAACTAGACATCAATCAAAGATTGGATAA
CAATCAAGCCTTACAAGTTGTTTTAACATCGAATTTCTCTGAACACAATT
TCACCGAATTAACAATTGGAATATTGAATCAATTAACCATGGACTCCGAA
GAAAAGAGAATCGAAACAATCGTTATTAGTGTTTTAAAATCAATTAAAAA
GCTTGTTGGAGAAATTCGCTACAATGAATTCAGCAAATCTTTTCCCGAGG
ATATTTTAATTCTATTCAATCGTTGCTCAAATGCCATAGACTCTCAATCA
AACACCGCCACTCCATCTTCGTGGAATCTCGTTGAAAACGGCAAGTTTTC
CAATGCATCTTTTCCGGTGAAAAAATTCCCTCCTCTCACGCCGGGATCGA
CTACAAACGAGACGGTTTTTGTTGGATTTATTCCCCAATCGGTGATGAAT
GATTTGAAACACGAGAGAAAACTCGAAGCAATTGAAGATATCAATAACCG
GTTTAAAGTGAACATTGAAAGGGAAATGAAAACAATTTCCCCACATTTGG
AGGAGCTGTTGAAATTGATTTTGGGATTAATGGAGGATAATTATCTCGTG
TTTATTACCTCATTCAAACTACTGATAGATGTTGTGAGTAGTATTCCTGC
GGATATTGTCAGTAAATATTTGGATTTATTAATGCAATTGCTGCGAGTAG
CCTTGACCCATAATGTGACCGGTGATGCTATCACTCAGAAATACACAATG
GCATACTCGATGGTTCTCTTTCAGAAGTCCGATACAAAGGAACTGTTGAA
AATGCTCTGTGATTCGCAGTTCATGATGGACAGCAAGCAGCCGTCGATTC
GGCAGACATCAATCGATATTGTTACGAGTGCCCTTTTGAAATTTCCTAGC
ACAAAATTCGATTTGGATTTTATATGCACAAAGGTTTCTCAGAGGTTGTT
GGATAAGAAATCGAAGGTAAAGCAGGCAGCTCTTGAATGCATATCAGTCA
TTGGTTATAATTATGGAAACGGCAAAACTAACACCTTACTAAAGATAGTT
GAACAAGTGACAAAAGGTGATCCGTCAAACGCAACAAATATCGGTGACGC
AGTACTAACCAGGTTGTCAAAGCACCGTTTGCCAAATATCGATGATCACG
GAATCGTGGTGTATGTTACGGAAAGTGAAAAACTATCCACTCATCGGCAA
CAATCCATATTCGACTTGGAAAACAGCAGTTCGGACAATTCGCCGATTTC
CTCGGCAAATCCAATGGAAAAACGTCGTCCAAGTGCAGGAAAAGTCAGAG
GACGAGCAAAGTTTCCTTGGGATCTCAATGAAGTAAATTTTATAGGTAAC
TCAAACAATCATAAATCTATTCCTTTGTCCAAGGCTCCTGGATTTAATTC
CAATAATCAAATTCATCCGTCAGAGGCTATGCATATCCTTTACAGTCAAG
GTCCATTGTCTGTGTCAAGCAAAGAACTATTGAATGAAGGAAGACCAATC
CGAAAACTCAATGATTTATCATCGAATAATGCCATGAACATCGAGAGAAA
CTTAAACCAACCGGTTTCAGGAAGATCTTATTCATCAGAAAATAATTTAA
TGACTCACACTTCCGGATATTCAAGTGGTTCCAATTCTTATAGAAATAAT
TACGAATCTTTATACAAACATAATAAAGAGAGTTCAACTGCAACAAATTC
AAACAGCGTCACACCGAGAAATCCATCGACAAGTCGTCAAGAAGATTCTG
CCATTGAAGCGAGCCCCATTCCAACTAAACCAGCATTAGGAAGAAGTGCA
GGTACTCGTCGAAAAGCTATAGATTCAACAGGTATGAATTTATCACAAGA
TAACAATGAAAAACTACCAAACGATATTTTACCGGAAAACGATATTCAAA
ATGATATGGTCAATGCTAATTTACTCCAAGGAGTCAGAAATTCTGCATCC
AAAAAGAAAGCAATGAAGATATTTAAAGCGTCAAATTTAACTTCAAATCC
AAATAGTTTTTCTGATCAAGACCTTCCGAATTTGGAAAGTTCTCCAACAG
TCAATAGAAAAGTTCCACAGGAAAATGGGAATTCACAAAATATTTCCAAC
CCTTACAAAGGACCTACCTTTAAACCAAACCCTCAGTATTCGGCTGTAAT
TGTTGGTAAAGGTGTAGCCGGTCCTCCAATAGAATCGTATGACACTCCAT
CATTCAAAAGAAAACAGCCTATAAAAGGTATTCATCACTCTTTCTCACTG
GCCCCGGTTACTGATTTTGTTTCACATTATATTCATCAAAGTGATGAATC
CATCTTTTCAAATATTACAATAGAAAAACATACTGATGATGTAAGTTTGA
TAAAAGATCAGATATATGAGTTGAAAGATAATGCACAATTACCGTGGACT
GGATATGTGAATGATCGAATTTCTCCGGAAATAGAAATTGAAAAGAAACC
GGTCACTAGTAATACTGCAAATTCATTCCGTCAAAAGCTTGGATTTGAAA
CGTCGGCGTCATCCCTGTATTGTAGTGTCAACTATTTAATTAGCGAGGAT
AATAATCCCAATCAGCTCTCCAGTCGTCCTGAGTTCAATGTTATTGGCAA
AAGTATGCTAGAGACCTCCAGTGGAAATGTTACACAACGGATGGCGGTGA
ATAACAATCATAGCGATGTGAAGAAGAACGTTCGTGGTGAACTGCCGAAT
CCTCAAACTTCATTTAGTCATTCAGAAACACCTCCCAATAGTAAAAATGT
TTCCCGTAACTCAAATATCGGCCAACCTTTGCCTGATTTCAGTAATGGTA
TCATTGGAATCGGTCTTACAGATAAATTAAGTACCGAGGAAGATAGTGAT
GAGGAACCTAATAAAGGCATTATGTCAAATACGTTACGAGAAAGTTTATC
AATTAAACGACAGAAGGCAATTGAATTGCATTCATCAAAATCAGAAAGTA
ACATGATCCAAACAGCACCAGCATCCTATTCTGCTCCAGGAAGTGGGTCT
CATCAAGCGGTTCATAGAAAGCCTCCTGTTGGCAGTTATTATTATGCCAA
CAATTTGCCGTCAAGTGCAGGAAATGAAAGAGAAATTACGAATGGTTATG
AAACTGTTCCATTGAGTCGTAAGCCACTGCGTCCGGCATTGGGAAACAGT
ACTCCAAAGAAAATCAAACCAGCCTCTCAGATCTCTAATGCTCAATCAAA
CAGTGCTGCTGAGTCAGTATCTATTAATCCAGCACCCCTGAATAATCCCG
AAAAATGTATCAATGAATGTTTAAATTTAATTCAAAACGAAGACTGGGAA
AACAAAATTTCAGCCATGATTACTATGCAGAGTTTAGTTCAATTTCATAC
AGACCTTTTGTTGAACCGGTCACCTGACATTCATGCTATTTGCATAGCTC
TTTGTAAAGAATGTAAAAATCTTCGATCCCAAGTTGCTAAATGCGCTATT
CAAACTTTCGGGCAACTGTTTATTTATCTTCGGAAAAACCTGGATTCGGT
GCTAGAAAATATTGTTTCAAATTTACTGTCGAAAGCTGGTGAAGGAACAA
ATAGTTTCTTGCGACAGGATATTGAAGCTAGTTTGTTACTGATGATTGAA
AATGTTTCCCCGCAAAGAGCATTTAACGCTCTACTACAAAGCGGAACTGA
CAATAAAAACATGGCAATACGAAGATTAGCAGCATGTAATATGATGTTAT
TGTGCGACAGATTGGGATATTTCAAAACAATGTCATGTATCAAAGAAACT
CCAGAGAAAATTCTTTCTGGCATCGTTAAGTTTGCCATGGATGGTAACCA
GGAAACAAGATATTATGGTAAAAGAATGTTGTTAGAATTAAGTAAACAAC
AAGATTTTGAAAAGTTGATAAATAAGCATATTCAAGCAAAGGATTTGAGA
GTTTTGAAGGACATTTTAGAAAATATTAAAATGAAAGGCATCGGAGATCC
CTCACAATTTTCACACTCAGCTGGAATGCAAAGATCAGGATCGCTTTCTC
GTGGGGGTAGTGCTGGAAATTTGGTGTCATTGGGTTCTAAATCTTCTTCT
CTTTCAAGAGGAAGCAGTCGATCAATGACACGTCTTCCGGGATCAGATAT
TTCCGATGATGACAAAGATTGGCTGACTAAAATTTGCTCTCAGCTTTCAT
CAAATGATTTTCGTGATCGCCAAAACGGATTAGACTCGATTGTGACAAAA
CGCGATTTGCACAATTTGCCTCAGAGAAGTATTTCAAAAATCCTTAAAGA
TTTAGTTCCCCGTCTTAATGACAACAACACAAAAGTCACAGTTTCTGCCT
TAGATGTTTGCCAGAAAATTATACCAATCATTTGCTCAAATTTTCCAACA
GAGTTCTTTCCTGAATTTATTAACACTGTTGCATTGAATTTTGCATCTAA
ATCTGTGGAACTTCGAAATTCTGCCTCAAATCTAATGGATATCTGCTTCA
ATTCGTTTGATCAAAGTCTCTTGATTCAGCCGTGTATTGAAGCTATAAAT
AAATCCAATCCTAAAACAAAACCCATTCTAATTGATAATATGAATAAACT
GTTATCAGCAATAGATTCATCTAAAGGTCCCTCATTTAACCGATCAATCG
GGATGATAATTCGTCATGTTATCCCGGAAATTGGGCTTTTATTGGGAAAA
AGTCGCACATTGCCAACACAGGTCAACGAACAATTACAAAATCTAGTCGT
CTTATCGTATGGAATAGTTGGAACAGAAATGATCGATTCTGCCGCTCAAA
GAGGTGATCATACACTTAAACAAGCTATCATAGACATTCTCAACAAGAAA
AATTTACACAACACTCAATGAAATATTATCAGCTGTACAGATTTTCTAGC
GAAATGTATAAATTATTATAATGTCACAATCAAAAACATATCAAGAACTT
TCTCAATCGGTTTCAAAACACACAAAAATCTCGTTTCCGTCCTCATTTGA
CCGTGTGATCGGTAACTCGCCAATCTCATTGACAAATCAAATCCAATGTG
TAACATAATAATTACAAATAAATATAGACAGAAAAAATACCAAAAAAAAA
ACACATCCGTACAAATATAATATCAACCAGAAATACCAATGAAAATCTTT
TCAGATCAATTATTATTTTTCAGCAGATTGTTATTGGGAATTGTTTAAGT
ATTTATTGTAGGTGTTTTTATTCTCCACTGACAATTATTGTGTTGTTTTT
CTTTTTGGAAATCGCAGTTACCAAGATATCAATATCTCTATCTATCTATC
TATATATATA
back to top

protein sequence of SMED30035139-orf-1

>SMED30035139-orf-1 ID=SMED30035139-orf-1|Name=SMED30035139-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1750bp
MELNLDLMLQNLNATATDDRKNGINKFLEEIKNYYQYDINENNSNIIKLL
FSNQLKLNELFATIRRLLCDPDWRIRKDTFEILINIITKDVLKENIDIHM
SIVLKHLIKCLSDSMMTVRKSATQCLHEYLNKTKNFEKCMQEFVEYGLNS
KLDINQRLDNNQALQVVLTSNFSEHNFTELTIGILNQLTMDSEEKRIETI
VISVLKSIKKLVGEIRYNEFSKSFPEDILILFNRCSNAIDSQSNTATPSS
WNLVENGKFSNASFPVKKFPPLTPGSTTNETVFVGFIPQSVMNDLKHERK
LEAIEDINNRFKVNIEREMKTISPHLEELLKLILGLMEDNYLVFITSFKL
LIDVVSSIPADIVSKYLDLLMQLLRVALTHNVTGDAITQKYTMAYSMVLF
QKSDTKELLKMLCDSQFMMDSKQPSIRQTSIDIVTSALLKFPSTKFDLDF
ICTKVSQRLLDKKSKVKQAALECISVIGYNYGNGKTNTLLKIVEQVTKGD
PSNATNIGDAVLTRLSKHRLPNIDDHGIVVYVTESEKLSTHRQQSIFDLE
NSSSDNSPISSANPMEKRRPSAGKVRGRAKFPWDLNEVNFIGNSNNHKSI
PLSKAPGFNSNNQIHPSEAMHILYSQGPLSVSSKELLNEGRPIRKLNDLS
SNNAMNIERNLNQPVSGRSYSSENNLMTHTSGYSSGSNSYRNNYESLYKH
NKESSTATNSNSVTPRNPSTSRQEDSAIEASPIPTKPALGRSAGTRRKAI
DSTGMNLSQDNNEKLPNDILPENDIQNDMVNANLLQGVRNSASKKKAMKI
FKASNLTSNPNSFSDQDLPNLESSPTVNRKVPQENGNSQNISNPYKGPTF
KPNPQYSAVIVGKGVAGPPIESYDTPSFKRKQPIKGIHHSFSLAPVTDFV
SHYIHQSDESIFSNITIEKHTDDVSLIKDQIYELKDNAQLPWTGYVNDRI
SPEIEIEKKPVTSNTANSFRQKLGFETSASSLYCSVNYLISEDNNPNQLS
SRPEFNVIGKSMLETSSGNVTQRMAVNNNHSDVKKNVRGELPNPQTSFSH
SETPPNSKNVSRNSNIGQPLPDFSNGIIGIGLTDKLSTEEDSDEEPNKGI
MSNTLRESLSIKRQKAIELHSSKSESNMIQTAPASYSAPGSGSHQAVHRK
PPVGSYYYANNLPSSAGNEREITNGYETVPLSRKPLRPALGNSTPKKIKP
ASQISNAQSNSAAESVSINPAPLNNPEKCINECLNLIQNEDWENKISAMI
TMQSLVQFHTDLLLNRSPDIHAICIALCKECKNLRSQVAKCAIQTFGQLF
IYLRKNLDSVLENIVSNLLSKAGEGTNSFLRQDIEASLLLMIENVSPQRA
FNALLQSGTDNKNMAIRRLAACNMMLLCDRLGYFKTMSCIKETPEKILSG
IVKFAMDGNQETRYYGKRMLLELSKQQDFEKLINKHIQAKDLRVLKDILE
NIKMKGIGDPSQFSHSAGMQRSGSLSRGGSAGNLVSLGSKSSSLSRGSSR
SMTRLPGSDISDDDKDWLTKICSQLSSNDFRDRQNGLDSIVTKRDLHNLP
QRSISKILKDLVPRLNDNNTKVTVSALDVCQKIIPIICSNFPTEFFPEFI
NTVALNFASKSVELRNSASNLMDICFNSFDQSLLIQPCIEAINKSNPKTK
PILIDNMNKLLSAIDSSKGPSFNRSIGMIIRHVIPEIGLLLGKSRTLPTQ
VNEQLQNLVVLSYGIVGTEMIDSAAQRGDHTLKQAIIDILNKKNLHNTQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0036064ciliary basal body
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR024395CLASP_N_dom
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0031116positive regulation of microtubule polymerization
GO:0035082axoneme assembly
GO:1905515non-motile cilium assembly