Glutamate receptor, ionotropic kainate 2

Overview
NameGlutamate receptor, ionotropic kainate 2
Smed IDSMED30035131
Length (bp)2635
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor, ionotropic kainate 2 (SMED30035131) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor, ionotropic kainate 2 (SMED30035131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor, ionotropic kainate 2 (SMED30035131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor, ionotropic kainate 2 (SMED30035131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035131SMESG000047329.1 SMESG000047330.1 SmedASXL_010767SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30035131SMESG000047329.1 SMESG000047330.1 dd_Smed_v4_8728_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035131SMESG000047329.1 SMESG000047330.1 dd_Smed_v6_8728_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035131SMESG000047329.1 SMESG000047330.1 dd_Smed_v4_8728_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035131SMESG000047329.1 SMESG000047330.1 dd_Smed_v4_8728_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 75.485 bits (184), Expect = 3.595e-13
Identity = 71/364 (19.51%), Postives = 142/364 (39.01%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA-----------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
            F  N  Y G+ V+L + + K   I      +P    G   +    ++G++G +  G  +   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P ++                   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M    P+    T  + ++ +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  437 FEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 799          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 75.485 bits (184), Expect = 3.595e-13
Identity = 71/364 (19.51%), Postives = 142/364 (39.01%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA-----------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
            F  N  Y G+ V+L + + K   I      +P    G   +    ++G++G +  G  +   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P ++                   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M    P+    T  + ++ +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  437 FEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 799          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 75.0998 bits (183), Expect = 4.024e-13
Identity = 77/368 (20.92%), Postives = 145/368 (39.40%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSN---YSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-----------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            F  N  Y G+ VEL   + K    +     L I + G Y + +    +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                 D+   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T+       F + +     + ++  M    P+  V T E+ +  +  +      +L      Y +  K C TM   G      YG+  PK S     ++  + +   QG    L  K+W ++ + C   D
Sbjct:  439 FEGNDRYEGYCVELAAEIAKH---VGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGE-CGSKD 801          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 75.0998 bits (183), Expect = 4.653e-13
Identity = 76/368 (20.65%), Postives = 145/368 (39.40%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSN---YSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-----------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
             F  N  Y G+ VEL   + K    +     L I + G Y + +    +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                 D+   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T+       F + +     + ++  M    P+  V T E+ +  +  +      +L      Y +  K C TM   G      YG+  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  438 QFEGNDRYEGYCVELAAEIAKH---VGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 801          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 75.0998 bits (183), Expect = 4.870e-13
Identity = 77/368 (20.92%), Postives = 145/368 (39.40%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSN---YSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-----------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            F  N  Y G+ VEL   + K    +     L I + G Y + +    +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                 D+   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T+       F + +     + ++  M    P+  V T E+ +  +  +      +L      Y +  K C TM   G      YG+  PK S     ++  + +   QG    L  K+W ++ + C   D
Sbjct:  429 FEGNDRYEGYCVELAAEIAKH---VGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGE-CGSKD 791          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 102.449 bits (254), Expect = 6.193e-22
Identity = 100/404 (24.75%), Postives = 169/404 (41.83%), Query Frame = 2
Query: 1124 NLSASNLLATGFRIGYIEYPPFSFI--------SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGL----AITDYMY-----------PDKYARYK------LLMS--------VXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEE----TPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSC 2206
            N+  S+ L   FR+  I   P+  +        +N  + GF ++LL  + KD     T   +     GN    N S+ G++G +  G  +   AP+ +   R    DF    LS  I   YK       D  S+ +NP  W IW  +  S     +G+     +T Y +           P   A +       ++MS        V++  S++  G     PR V  R+L   WW++ L ++  + +N AA+L  +     + +  D+ NQ    Y T+       F + +       +++ M ++    T NG    +E A+SM   NY  L +  +L Y++ +NC LT  G  +    YG+ L K SE T  IS ++  Y  +G   +   K+W ++  +C
Sbjct:  428 NVQVSDELKPHFRVTTIMERPYVMLKKNHYELDANSKFEGFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPDLFSF-LNPLSWQIWTAIATSIITVTLGMYFVANVTPYEWNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFGPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDDLANQTTISYGTIRGGSTMQFFQESRIAAHVKMWQYMKDKDVFVTSNG--KGVERALSM---NYAYLMESTSLEYETQQNCNLTQIGGVLGSKGYGIALAKKSEWTDRISRQILLYAKRGIIEMKKTKWWRSKGAAC 825          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Celegans
Match: glr-6 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q8MXV8])

HSP 1 Score: 98.2117 bits (243), Expect = 1.070e-20
Identity = 78/346 (22.54%), Postives = 148/346 (42.77%), Query Frame = 2
Query: 1211 YTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN--YIILYDDRTLYYQSTKNC-LTMFGKFVYFD--YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSDVPNI 2230
            + GF V+LL+ + +  +   T   +     G   +    + G++G +  G  D   API +T  RL   DF    L   I    +        +L+ ++ P    +W     ++  TA+ + +   + P +  A +K+  SV++    L         +    R++   WW + L ++  + +N+AALL     +    SF ++ NQ +Y + ++       F K +     + ++  M    P+  V T  + ++ + LN  Y+ L +  TL YQ T+NC LT  G  V     Y + LPK S+    ++ ++     +G   +L   +W    Q C  S+  ++
Sbjct:  434 HEGFCVDLLDKLAEMLHFNYTLKIVKDNKYGERKNGTDEWDGMIGEILRGDADMAVAPITVTATRLEVIDFTDPFLQLGISMLMRQPNPKSSSSLTRFLWPLSASVWTFSAIATVITALLVTVAAVLSPKESTAEFKIQNSVWYLVCILLRAGSGYNCQAGATRLISAVWWSFTLVLIAQYTANFAALLTVDRKSMPFNSFEELGNQTEYNFGSILGGSTMQFFKYSRIETFRRLWERMQSAEPSAFVGTNHEGVNRV-LNEKYVFLMESATLDYQVTQNCNLTRVGNVVLGSNGYSIALPKGSKWREKLTRQILDLNEKGIILMLKNNWWKKSQQECQSSEPEDL 778          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 92.8189 bits (229), Expect = 5.165e-19
Identity = 85/366 (23.22%), Postives = 159/366 (43.44%), Query Frame = 2
Query: 1169 YIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIP-TYVPLPIK-NVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-DKYAR-------------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIP-LNYIILYDDRTLYYQSTKNC--LTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCN 2209
            Y+E P     SNGSY G+ ++LL+ +    NI+  TY    ++ N      SN  +SG++G +Q G  D   A + ++  R    DF    +   I   +K  +    D    +++P    +W     S    ++ + I   + P +++ R             + L  S +F+  SL        PR    R+L   WW + L ++  + +N AA+L      T + +  D+  Q   KY T+      SF   +     + ++++M+  +P   V + ++ I+ +   +Y  L +   L Y   ++C  + + G      YG+ LPK S    +IST + + + + + + L EK+W ++   C 
Sbjct:  408 YLEAPFVMITSNGSYEGYCIDLLHKIA---NILKFTYTIQKVRDNAYGSKESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFK-FMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTMSFFNESKIETYERMWQLMS-SSPGLFVQSSKEGIARVKSSDYAYLMESSMLEYAVERDCELMQIGGLIDQKGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWKDKSVVCE 768          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 80.1073 bits (196), Expect = 4.811e-15
Identity = 77/374 (20.59%), Postives = 156/374 (41.71%), Query Frame = 2
Query: 1169 YIEYPPFSFISNGSYTGFTVELLNSVLK--DFNIIPTYVPLPIKNVGNYISSNYS--FSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALS-GNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP------------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN-YIILYDDRTLYYQSTKNC--LTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQ--SC 2206
            Y+E P         Y GF ++LLN + +   FN    Y  + +++ G Y   + S  ++G++G +Q    D   + + +T +R    DF    +  G  +   ++S++    +L  ++ P    +W +LL S    +  + I     P                  ++  ++ +L S +F+  SL        PR    R++   WW++   ++  + +  AA L     +T + S  D+ NQ   +Y  +       F + +  P  + ++ +M   +P   VN+  + I+ +    Y  + +   L Y   ++C   ++ G      YG+ LPK S    ++S  + Q + +     L  K+W ++ +  SC
Sbjct:  415 YLEEPFVIKTGENQYEGFCIDLLNEMTQVLKFN----YTIIEVQD-GTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSC 783          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 78.9518 bits (193), Expect = 9.481e-15
Identity = 77/374 (20.59%), Postives = 156/374 (41.71%), Query Frame = 2
Query: 1169 YIEYPPFSFISNGSYTGFTVELLNSVLK--DFNIIPTYVPLPIKNVGNYISSNYS--FSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALS-GNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP------------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN-YIILYDDRTLYYQSTKNC--LTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQ--SC 2206
            Y+E P         Y GF ++LLN + +   FN    Y  + +++ G Y   + S  ++G++G +Q    D   + + +T +R    DF    +  G  +   ++S++    +L  ++ P    +W +LL S    +  + I     P                  ++  ++ +L S +F+  SL        PR    R++   WW++   ++  + +  AA L     +T + S  D+ NQ   +Y  +       F + +  P  + ++ +M   +P   VN+  + I+ +    Y  + +   L Y   ++C   ++ G      YG+ LPK S    ++S  + Q + +     L  K+W ++ +  SC
Sbjct:  415 YLEEPFVIKTGENQYEGFCIDLLNEMTQVLKFN----YTIIEVQD-GTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSC 783          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 77.7962 bits (190), Expect = 3.362e-14
Identity = 80/357 (22.41%), Postives = 144/357 (40.34%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI----TDYMYPDKYARYKLLMSVXXXXXX-----------LTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD-YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            N  + GF ++LL ++            +P    G YI    S++G++  +     D   A + +   R +  DF    ++  I   +K          S+ +NP    IW  +L +    +  L +    + Y + + +  YK    V   FS            L  G+  +P +    R++   W+ +CL ++  + +N AA L      + + S SD+  Q +  Y T+      +F +++     Q ++R M        V T ED I  ++  +Y  L +   L Y   ++C LT  G  +    YG+  PK S     IS  + + + +G   +L +K+W N    CN  D
Sbjct:  449 NLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSF-MNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNP-KATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDD 803          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 77.7962 bits (190), Expect = 3.362e-14
Identity = 80/357 (22.41%), Postives = 144/357 (40.34%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI----TDYMYPDKYARYKLLMSVXXXXXX-----------LTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD-YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            N  + GF ++LL ++            +P    G YI    S++G++  +     D   A + +   R +  DF    ++  I   +K          S+ +NP    IW  +L +    +  L +    + Y + + +  YK    V   FS            L  G+  +P +    R++   W+ +CL ++  + +N AA L      + + S SD+  Q +  Y T+      +F +++     Q ++R M        V T ED I  ++  +Y  L +   L Y   ++C LT  G  +    YG+  PK S     IS  + + + +G   +L +K+W N    CN  D
Sbjct:  449 NLRFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSF-MNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNP-KATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDD 803          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 75.485 bits (184), Expect = 1.596e-13
Identity = 72/356 (20.22%), Postives = 147/356 (41.29%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA--------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNC-LTMFGKFVYFD-YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSC 2206
            +F  N  + GF V++L ++ ++         +P +  G        ++G++  +     D     + +T  R +  DF    ++  I   +K          S+ +NP    IW  +L +    ++ + I   + P ++               ++ L  S +F+  +    +    PR +  R++   W  + L +V  + +N AA L        + +  D+ +Q +  Y T++     +F +++     + I+R M+ + P+    T ED I  +   NY  L +   L Y   ++C LT  G  +    YG+  PK S     IS  + + + +G   +L +K+W N  ++C
Sbjct:  423 NFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSF-MNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETC 777          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Fly
Match: GluRIIC (gene:FBgn0046113 transcript:FBtr0336969)

HSP 1 Score: 75.0998 bits (183), Expect = 1.887e-13
Identity = 87/389 (22.37%), Postives = 154/389 (39.59%), Query Frame = 2
Query: 1115 YSYNLSASNLLATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALS-GNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSS------AATAIGLAITDYMYPDKYARYKLLMSVX---------XXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRI----MNEETPNG-TVNTLE--DAISMIPLNYIILYDDRTLYYQSTKNC-LTMFG-KFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSC 2206
            +SYN +A  L  TG               N  Y G+ V+L++++ +       +VP+  +  G        ++G++G + N         + +T  R T  DF    +  G  + AYKS        L  Y+ PF   +W  +L S             ++  D+  P    R   ++               S +T G     PR    R+    WW++ + +   + +N AA L  +     + +  D+  Q   K+ T+      + L ++     +T+YR+    MN + P+  T + LE  D +     +Y+ L +  TL Y   +NC L   G KF    Y + +P  +E    +S  + +   +G+   L +K+W N   SC
Sbjct:  434 FSYNETARELNLTG---------------NALYQGYAVDLIDAIARHVGFEYVFVPVADQQYGKLDKETKQWNGIIGEIINNDAHMGICDLTITQARKTAVDFTVPFMQLGVSILAYKSPHV--EKTLDAYLAPFGGEVWIWILISVFVMTFLKTIVARISKMDWENPHPCNRDPEVLENQWRIHNTGWLTVASIMTAGCDI-LPRSPQVRMFEATWWIFAIIIANSYTANLAAFLTSSKMEGSIANLKDLSAQKKVKFGTIYGGSTYNLLADSN----ETVYRLAFNLMNNDDPSAYTKDNLEGVDRVRKNRGDYMFLMETTTLEYHREQNCDLRSVGEKFGEKHYAIAVPFGAEYRSNLSVAILKLSERGELYDLKQKWWKNPNASC 800          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 71.633 bits (174), Expect = 2.517e-12
Identity = 72/356 (20.22%), Postives = 147/356 (41.29%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA--------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNC-LTMFGKFVYFD-YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSC 2206
            +F  N  + GF V++L ++ ++         +P +  G        ++G++  +     D     + +T  R +  DF    ++  I   +K          S+ +NP    IW  +L +    ++ + I   + P ++               ++ L  S +F+  +    +    PR +  R++   W  + L +V  + +N AA L        + +  D+ +Q +  Y T++     +F +++     + I+R M+ + P+    T ED I  +   NY  L +   L Y   ++C LT  G  +    YG+  PK S     IS  + + + +G   +L +K+W N  ++C
Sbjct:  423 NFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYA-DLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSF-MNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETC 776          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Zebrafish
Match: si:dkey-183j2.10 (si:dkey-183j2.10 [Source:ZFIN;Acc:ZDB-GENE-130530-729])

HSP 1 Score: 78.9518 bits (193), Expect = 9.541e-15
Identity = 74/352 (21.02%), Postives = 148/352 (42.05%), Query Frame = 2
Query: 1172 IEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNY--ISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNCLTMFGKFV--YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN 2191
            I+  P++        G+ ++LL  + K       Y    +K+ G+Y     N +++G++G V  G  D   AP+ LT  R          +   I    +            +++PF    W  +L +   TA+ + I   + P ++++       + LL S++++  +L+       P+ V GRV+ C WWL+ + ++  + S+ ++          +  F D+ NQ+  +Y T+      +F KN+  P  + IY  M  E     V+++++ +      NY  + +  +L     ++C  +    V     Y +V P  S     +S  + Q    G+ + L  K+W +
Sbjct:   36 IKQDPYTMSKGSQLEGYCMDLLTELAKKLGF--KYKVHLVKD-GSYGRQDENGNWNGMIGEVVRGEADLAVAPLTLTAAREKAVGMTKPYMQTGISILLRKDIVSEEAGFFDFLSPFSGETWFGILIAYFVTAVCICIVGRLSPCEWSQPETEPNHFTLLHSLWYTAGALSLQGAGPHPKAVSGRVISCTWWLFAVVLLACYFSSLSSTQGSDSAPLMIKGFEDLANQDVIEYGTLAGSSTLAFFKNSNNPSYRRIYEHM--ERRKSFVSSMDEGVQKAKEGNYAFIGESVSLDLAVARHCELVRAHEVIGMRGYSIVTPLGSAMLKNLSVAILQLSEAGELAYLRTKWWAS 382          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Zebrafish
Match: CR933820.2 (si:dkey-183j2.10 [Source:NCBI gene;Acc:100151589])

HSP 1 Score: 78.5666 bits (192), Expect = 1.004e-14
Identity = 74/352 (21.02%), Postives = 148/352 (42.05%), Query Frame = 2
Query: 1172 IEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNY--ISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNCLTMFGKFV--YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN 2191
            I+  P++        G+ ++LL  + K       Y    +K+ G+Y     N +++G++G V  G  D   AP+ LT  R          +   I    +            +++PF    W  +L +   TA+ + I   + P ++++       + LL S++++  +L+       P+ V GRV+ C WWL+ + ++  + S+ ++          +  F D+ NQ+  +Y T+      +F KN+  P  + IY  M  E     V+++++ +      NY  + +  +L     ++C  +    V     Y +V P  S     +S  + Q    G+ + L  K+W +
Sbjct:   30 IKQDPYTMSKGSQLEGYCMDLLTELAKKLGF--KYKVHLVKD-GSYGRQDENGNWNGMIGEVVRGEADLAVAPLTLTAAREKAVGMTKPYMQTGISILLRKDIVSEEAGFFDFLSPFSGETWFGILIAYFVTAVCICIVGRLSPCEWSQPETEPNHFTLLHSLWYTAGALSLQGAGPHPKAVSGRVISCTWWLFAVVLLACYFSSLSSTQGSDSAPLMIKGFEDLANQDVIEYGTLAGSSTLAFFKNSNNPSYRRIYEHM--ERRKSFVSSMDEGVQKAKEGNYAFIGESVSLDLAVARHCELVRAHEVIGMRGYSIVTPLGSAMLKNLSVAILQLSEAGELAYLRTKWWAS 376          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Zebrafish
Match: LO018303.1 (glutamate receptor ionotropic, kainate 3 [Source:NCBI gene;Acc:100334689])

HSP 1 Score: 76.6406 bits (187), Expect = 1.076e-13
Identity = 76/349 (21.78%), Postives = 140/349 (40.11%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI----TDYMYPDKYA----------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            + + N  + GF ++LL  +            +P    G +      ++G++  +     D   AP+ +T  R    DF+   L+  I   Y+          S+ +NP    IW  +L +    +  L +    + Y + D +            + LL S +F   SL        P+ +  R++   WW + L ++  + +N AA L      + + S  D+  Q   +Y  V D    SF K +     + ++  M+       V ++ED I  ++  +Y +L +  T+ Y + +NC LT  G  +    YG+  PK S     I+  +      G+  +L EK+W
Sbjct:  448 ALVGNDRFEGFCIDLLKELASILGFSYEIHLVPDGKYG-FQDDKGQWNGMIRELMEHRADLAVAPLTITFMREKAIDFSKPFLNTGISILYRKPNSTNSGFFSF-LNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSRQSTSFVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKITIAILGILEDGRLHMLKEKWW 794          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Zebrafish
Match: gria3b (glutamate receptor, ionotropic, AMPA 3b [Source:ZFIN;Acc:ZDB-GENE-030616-53])

HSP 1 Score: 75.8702 bits (185), Expect = 1.739e-13
Identity = 75/361 (20.78%), Postives = 142/361 (39.34%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI-------------TDYMY-----PDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNG 2212
            N  Y G+ V+L + + K   I      +     G       S++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +             TD +      PD    + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M    P+    T  D ++ +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G
Sbjct:  438 NEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWQLDETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSG 797          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Zebrafish
Match: gria3b (glutamate receptor, ionotropic, AMPA 3b [Source:ZFIN;Acc:ZDB-GENE-030616-53])

HSP 1 Score: 75.8702 bits (185), Expect = 1.739e-13
Identity = 75/361 (20.78%), Postives = 142/361 (39.34%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI-------------TDYMY-----PDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNG 2212
            N  Y G+ V+L + + K   I      +     G       S++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +             TD +      PD    + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M    P+    T  D ++ +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G
Sbjct:  438 NEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWQLDETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSG 797          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-969312])

HSP 1 Score: 82.0333 bits (201), Expect = 1.285e-15
Identity = 73/355 (20.56%), Postives = 148/355 (41.69%), Query Frame = 2
Query: 1184 PFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNY--SFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALL-AKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLV--ISTKLRQYRAQGKTSVLIEKYWPNQFQSCN 2209
            PFS  +     GF ++LL+ + +       Y    +K+ G Y + +   +++G++G V     D   AP+ +T  R     F    +   I    +         L  ++ PF    W  +L +   T++ L +   + P ++         +  L S++F   + T       P+ V  R++   WW++ + +V  +++++AA L + +  TT + +F D++NQ   ++ T+N      F KN+  P  + IY  M++      V +  + +  +   NY  L +         K+C  +    +    G  +    +  L+  +S  + +    G    L +K+W N   +CN
Sbjct:   38 PFSMKTESGMEGFCIDLLSELAQSLGF--NYTIKEVKD-GRYGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFSKETWIGILVAYVVTSLCLFLVGRLSPCEWTELSTEQNNFNFLNSLWFGVGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVKESNYAFLGESVMQDIMVAKHCDLVRAPQIIAGRGYGIAASLDSPLIKPLSVAILEQTESGNIEYLRKKWWDN---TCN 386          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-969312])

HSP 1 Score: 82.0333 bits (201), Expect = 1.346e-15
Identity = 73/355 (20.56%), Postives = 148/355 (41.69%), Query Frame = 2
Query: 1184 PFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNY--SFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALL-AKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLV--ISTKLRQYRAQGKTSVLIEKYWPNQFQSCN 2209
            PFS  +     GF ++LL+ + +       Y    +K+ G Y + +   +++G++G V     D   AP+ +T  R     F    +   I    +         L  ++ PF    W  +L +   T++ L +   + P ++         +  L S++F   + T       P+ V  R++   WW++ + +V  +++++AA L + +  TT + +F D++NQ   ++ T+N      F KN+  P  + IY  M++      V +  + +  +   NY  L +         K+C  +    +    G  +    +  L+  +S  + +    G    L +K+W N   +CN
Sbjct:   42 PFSMKTESGMEGFCIDLLSELAQSLGF--NYTIKEVKD-GRYGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFSKETWIGILVAYVVTSLCLFLVGRLSPCEWTELSTEQNNFNFLNSLWFGVGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVKESNYAFLGESVMQDIMVAKHCDLVRAPQIIAGRGYGIAASLDSPLIKPLSVAILEQTESGNIEYLRKKWWDN---TCN 390          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Xenopus
Match: dzank1 (double zinc ribbon and ankyrin repeat domains 1 [Source:Xenbase;Acc:XB-GENE-969312])

HSP 1 Score: 81.2629 bits (199), Expect = 2.665e-15
Identity = 73/355 (20.56%), Postives = 148/355 (41.69%), Query Frame = 2
Query: 1184 PFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNY--SFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALL-AKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLV--ISTKLRQYRAQGKTSVLIEKYWPNQFQSCN 2209
            PFS  +     GF ++LL+ + +       Y    +K+ G Y + +   +++G++G V     D   AP+ +T  R     F    +   I    +         L  ++ PF    W  +L +   T++ L +   + P ++         +  L S++F   + T       P+ V  R++   WW++ + +V  +++++AA L + +  TT + +F D++NQ   ++ T+N      F KN+  P  + IY  M++      V +  + +  +   NY  L +         K+C  +    +    G  +    +  L+  +S  + +    G    L +K+W N   +CN
Sbjct:   52 PFSMKTESGMEGFCIDLLSELAQSLGF--NYTIKEVKD-GRYGAKDQDGNWNGMVGEVLRKEADLAVAPLTITGARERELAFTKPFMQTGISILLRKDDVSENSYLFGFLTPFSKETWIGILVAYVVTSLCLFLVGRLSPCEWTELSTEQNNFNFLNSLWFGVGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSMQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVKESNYAFLGESVMQDIMVAKHCDLVRAPQIIAGRGYGIAASLDSPLIKPLSVAILEQTESGNIEYLRKKWWDN---TCN 400          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 81.6481 bits (200), Expect = 3.309e-15
Identity = 102/438 (23.29%), Postives = 186/438 (42.47%), Query Frame = 2
Query:  953 NTLTG--DFNG-SNRTTFLFNIIQNPGIQNKSMGYMKFDR-LAKSVTSQAKLSYINLIYSYNLSASNLLATGFRIGYIEYPPFSFISNGSYTGFTVELLN--SVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYK--SSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKY--------ARYKLLMSVXXXXXXLTH--GAYFDP-----PRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN--YIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            + LTG  +FN    RT +   I++  G  ++ +G    +R LA + TS   LS    + +  L  + +L   + +    Y   S   N  Y GF  E+L   + L  FN     + L    +      N S++G++G + N   D   A   +T  R    DF+   ++  I   Y+    +K G  +   +++PF   +W  +L +  A +  L +   + P ++         R+ +L + +   +SL    G +        PR +  R +   WW + L ++  + +N AA L        + S  D+ +Q + +Y T++     +F +N+ Y   Q ++  MN + P+  V + E+ I+ + LN  Y  L +     Y    NC LT  G  +    YG+ +P  S     I+  + Q +   +  +L  K+W
Sbjct:  350 DGLTGRVEFNSKGQRTNYTLRILEKAGDGHREIGVWYSNRTLAMNATS-LDLSTSETLENKTLVVTTILENPYMMRKSNYRSLS--GNDQYEGFCAEMLMELAALLRFNY---KIKLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFS---FLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARV-LNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPYRDEITLAILQLQENNRLEILKRKWW 777          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 81.6481 bits (200), Expect = 4.152e-15
Identity = 102/438 (23.29%), Postives = 186/438 (42.47%), Query Frame = 2
Query:  953 NTLTG--DFNG-SNRTTFLFNIIQNPGIQNKSMGYMKFDR-LAKSVTSQAKLSYINLIYSYNLSASNLLATGFRIGYIEYPPFSFISNGSYTGFTVELLN--SVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYK--SSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKY--------ARYKLLMSVXXXXXXL--THGAYFDP-----PRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN--YIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            + LTG  +FN    RT +   I++  G  ++ +G    +R LA + TS   LS    + +  L  + +L   + +    Y   S   N  Y GF  E+L   + L  FN     + L    +      N S++G++G + N   D   A   +T  R    DF+   ++  I   Y+    +K G  +   +++PF   +W  +L +  A +  L +   + P ++         R+ +L + +   +SL    G +        PR +  R +   WW + L ++  + +N AA L        + S  D+ +Q + +Y T++     +F +N+ Y   Q ++  MN + P+  V + E+ I+ + LN  Y  L +     Y    NC LT  G  +    YG+ +P  S     I+  + Q +   +  +L  K+W
Sbjct:  352 DGLTGRVEFNSKGQRTNYTLRILEKAGDGHREIGVWYSNRTLAMNATS-LDLSTSETLENKTLVVTTILENPYMMRKSNYRSLS--GNDQYEGFCAEMLMELAALLRFNY---KIKLVEDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVQMGRKPGYFS---FLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARV-LNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPYRDEITLAILQLQENNRLEILKRKWW 779          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Mouse
Match: Grid2 (glutamate receptor, ionotropic, delta 2 [Source:MGI Symbol;Acc:MGI:95813])

HSP 1 Score: 77.0258 bits (188), Expect = 7.193e-14
Identity = 98/457 (21.44%), Postives = 187/457 (40.92%), Query Frame = 2
Query:  938 QTGIKNTLTGDFN-GSNRTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLS------ASNLLATGFRIGYIEYPPFSFISNG------SYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNI-VGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFD-----PPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDL---------LNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL----NYIILYDDRTLYYQS--TKNC--LTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQ 2200
            + G  N LTGD   G N          NP +  + +G    + L + V    KL   N +   N S       +N+     R+  +   PF  +S         Y GF++++L+++             P    G+    + +++G++G +     D   + + +T +R    DF T  +  ++ V   ++ K V M A    + PF+  +WA +  +     + + + +++ P +     +  +  ++     +G++       P   +  R++M  WWL+ L V+  + +N AA L  T   + + S  D+  Q D  Y TV D           LN F +++ Y     ++R++N    NG+ N + ++ + I      NY  ++D   L Y +    +C   T+        YG+ L   S    V S ++ + +  G   +L  K+WP   Q
Sbjct:  374 KKGGVNGLTGDLEFGENGG--------NPNVHFEILGTNYGEELGRGVR---KLGCWNPVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGS-PQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFAC---LAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLNPFERDSMY---SQMWRMINRS--NGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQSGDMDILKHKWWPKNGQ 810          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 75.485 bits (184), Expect = 2.195e-13
Identity = 71/364 (19.51%), Postives = 142/364 (39.01%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA-----------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
            F  N  Y G+ V+L + + K   I      +P    G   +    ++G++G +  G  +   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P ++                   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M    P+    T  + ++ +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  437 FEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 799          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 75.485 bits (184), Expect = 2.195e-13
Identity = 71/364 (19.51%), Postives = 142/364 (39.01%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA-----------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
            F  N  Y G+ V+L + + K   I      +P    G   +    ++G++G +  G  +   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P ++                   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M    P+    T  + ++ +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  437 FEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 799          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 75.0998 bits (183), Expect = 2.611e-13
Identity = 77/368 (20.92%), Postives = 145/368 (39.40%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSN---YSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-----------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            F  N  Y G+ VEL   + K    +     L I + G Y + +    +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                 D+   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T+       F + +     + ++  M    P+  V T E+ +  +  +      +L      Y +  K C TM   G      YG+  PK S     ++  + +   QG    L  K+W ++ + C   D
Sbjct:  429 FEGNDRYEGYCVELAAEIAKH---VGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGE-CGSKD 791          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 75.0998 bits (183), Expect = 3.018e-13
Identity = 77/368 (20.92%), Postives = 145/368 (39.40%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSN---YSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP-----------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            F  N  Y G+ VEL   + K    +     L I + G Y + +    +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                 D+   + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T+       F + +     + ++  M    P+  V T E+ +  +  +      +L      Y +  K C TM   G      YG+  PK S     ++  + +   QG    L  K+W ++ + C   D
Sbjct:  360 FEGNDRYEGYCVELAAEIAKH---VGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGE-CGSKD 722          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. UniProt/SwissProt
Match: sp|Q91756|GLRK_XENLA (Glutamate receptor U1 OS=Xenopus laevis OX=8355 GN=kbp PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.279e-16
Identity = 75/353 (21.25%), Postives = 147/353 (41.64%), Query Frame = 2
Query: 1172 IEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNY--SFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALL-AKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMI-PLNYIILYDDRTLYYQSTKNCLTMFGKFVYF--DYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN 2191
            I   PFS  S     GF ++LL+ + +       Y    +K+ G Y + +   +++G++G V    +D   AP+ +T NR     F    +   I    +         L  ++ PF    W  +L +   T++ L +   + P ++         +  L S++F   + T       P+ V  R++   WW++ + +V  +++++AA L + +  TT + +F D++NQ   ++ T+N      F KN+  P  + IY  M++      V +  + +  +   NY  L +         K+C       +     YG+     S+    +S  + +    G    L +K+W N
Sbjct:   48 IMEQPFSMKSESGMEGFCIDLLSELSQSLGF--NYTIKEVKD-GRYGAKDQDGNWNGMVGEVLRKEVDLAVAPLTITANRERELAFTKPFMQTGISILLRKEDASENSFLFGFLTPFSKETWIGILVAYMVTSLCLFLVGRLSPCEWTELSTEQNNFTFLNSLWFGAGAFTLQGAEPHPKSVSARIIAVIWWIFSIVLVAAYIASFAAFLNSDSVQTTNIQTFEDLVNQRTLEFGTINSSSTFQFFKNSKNPTYRMIYEYMDKRKDELLVKSFAEGVRRVRESNYAFLGESVMQDIMVAKHCELARAPQIIAGRGYGIAASIDSQLIKQLSIAILEQTESGNIEYLRKKWWDN 397          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. UniProt/SwissProt
Match: sp|Q90218|GLRK_ANAPL (Probable glutamate receptor OS=Anas platyrhynchos OX=8839 GN=KBP PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.881e-14
Identity = 71/348 (20.40%), Postives = 147/348 (42.24%), Query Frame = 2
Query: 1184 PFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGN----YISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYK-------LLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNCLTMFGKFV--YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            P+  +      G+ ++LL ++         +    +K VG+     +SSN +++G++G +     D   AP+ +T  R     F T  L   I    +        +  +++ PF    W  LL +   T   L +   + P ++   K        L S++F   +L        P+ +  RV+   WWL+ + ++  +++N+ ALL+       + +F D++ Q   ++ T++      + KN+  P  Q IY  M++   +  V T ++A+  ++  NY  + +  +    + ++C  +    V     +G+   + S  T  +S  + + R  G    L  K+W
Sbjct:   58 PYVMVRRAELEGYCIDLLKALASML-----HFSYKVKVVGDGKYGAVSSNGNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQTGIGILLRKDTMSQEMSFFHFLAPFSKETWTGLLFAYILTCFCLFLVARLSPCEWNEPKNEENHFTFLNSLWFGAGALALQGVTPRPKALSVRVIAAIWWLFTIALLAAYIANFTALLSSGSEQLPIQTFEDLVKQRKLEFGTLDGSSTFYYFKNSKNPIHQMIYEYMDKRRDHVLVKTYQEAVQRVMDSNYAFIGESISQDLAAARHCNLIRAPEVIGARGFGIATAQASPWTKKLSIAVLKLRESGDLDYLRNKWW 400          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. UniProt/SwissProt
Match: sp|P19439|GLRK_CHICK (Probable glutamate receptor OS=Gallus gallus OX=9031 GN=KBP PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 4.127e-14
Identity = 71/351 (20.23%), Postives = 152/351 (43.30%), Query Frame = 2
Query: 1184 PFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGN----YISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMD-ALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYK-------LLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNCLTMFGKFV--YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN 2191
            P+  + +    G+ ++LL ++         +    +K VG+     IS + +++G++G +     D   AP+ +T  R     F T  L   I G     + +  + +  +++ PF    W  LL +   T + L +   + P ++   K        L S++F   +LT       P+    RV+   WWL+ + ++  +++N+ ALL+       + +F D++ Q   ++ T++      F KN+  P  + +Y  M++   +  V T ++A+  ++  NY  + +  +    + ++C  +    V     +G+   + S  T  +S  + + R  G    L  K+W +
Sbjct:   58 PYVMVRSAELEGYCIDLLKALASML-----HFSYKVKVVGDGKYGAISPSGNWTGMIGEILRQEADIAVAPLTVTSAREEVVSFTTPFLQTGI-GILLRKETISQEMSFFHFLAPFSKETWTGLLFAYVLTCVCLFLVARLSPCEWNEPKNEENHFTFLNSLWFGAGALTLQGVTPRPKAFSVRVIAAIWWLFTIALLAAYIANFTALLSSGSEQLSIQTFEDLVKQRKLEFGTLDGSSTFYFFKNSKNPIHRMVYEYMDKRRDHVLVKTYQEAVQRVMESNYAFIGESISQDLAAARHCNLIRAPEVIGARGFGIATAQASPWTKKLSVAVLKLRETGDLDYLRNKWWES 402          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. UniProt/SwissProt
Match: sp|Q63226|GRID2_RAT (Glutamate receptor ionotropic, delta-2 OS=Rattus norvegicus OX=10116 GN=Grid2 PE=1 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.821e-13
Identity = 98/457 (21.44%), Postives = 187/457 (40.92%), Query Frame = 2
Query:  938 QTGIKNTLTGDFN-GSNRTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLS------ASNLLATGFRIGYIEYPPFSFISNG------SYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNI-VGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFD-----PPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDL---------LNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL----NYIILYDDRTLYYQS--TKNC--LTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQ 2200
            + G  N LTGD   G N          NP +  + +G    + L + V    KL   N +   N S       +N+     R+  +   PF  +S         Y GF++++L+++             P    G+    + +++G++G +     D   + + +T +R    DF T  +  ++ V   ++ K V M A    + PF+  +WA +  +     + + + +++ P +     +  +  ++     +G++       P   +  R++M  WWL+ L V+  + +N AA L  T   + + S  D+  Q D  Y TV D           LN F +++ Y     ++R++N    NG+ N + ++ + I      NY  ++D   L Y +    +C   T+        YG+ L   S    V S ++ + +  G   +L  K+WP   Q
Sbjct:  374 KKGGVNGLTGDLEFGENGG--------NPNVHFEILGTNYGEELGRGVR---KLGCWNPVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGS-PQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFAC---LAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTDIPYGTVLDSAVYQHVRMKGLNPFERDSMY---SQMWRMINRS--NGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQSGDMDILKHKWWPKNGQ 810          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. UniProt/SwissProt
Match: sp|P26591|GLRK_LYMST (Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.886e-13
Identity = 68/306 (22.22%), Postives = 129/306 (42.16%), Query Frame = 2
Query: 1193 FISNGSYTGFTVELLNSVLKD--FNIIPTYVPLPIKNVGNYIS--SNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFD-----------PPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN---YIILYDDRTLYYQSTKN-CLTM 2053
             + N    GF ++L  +V +   F+ +  +V       G+Y S  SN ++ G++G +     D   AP  +T +R    DF    +S  I    K  +  G    S+ + P    IW  ++ +    ++ L +     P+++   +   S   +  S+++  +F             PR + GR++   WW + L ++  + +N AA L      T + S  D+  Q + +Y T+      +F KN+ +   Q ++  M    P+  V T E+ I  +  +   Y  L +  T+ Y S +  C T+
Sbjct:  450 LVGNEPVEGFCIDLTKAVAEKVGFDFVIQFV-----KDGSYGSVLSNGTWDGIVGELIRHEADMAIAPFTITADRSRVIDFTKPFMSLGISIMIKRPQPAGKHFFSF-MEPLSSEIWMCIVFAYIGVSVVLFLVSRFSPNEWHLSEAHHSYIANDFSISNSLWFSLGAFMQQGCDISPRSMSGRIVGSVWWFFTLIIISSYTANLAAFLTVERMLTPIDSAEDLARQTEIQYGTIMSGSTKAFFKNSQFQTYQRMWAYMTSAQPSVFVKTHEEGIQRVRQSNGKYAYLTESSTIDYVSNRKPCDTL 749          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. TrEMBL
Match: A0A183UR43 (Uncharacterized protein OS=Toxocara canis OX=6265 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.951e-20
Identity = 83/349 (23.78%), Postives = 151/349 (43.27%), Query Frame = 2
Query: 1181 PPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD--YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN--QFQSC 2206
            P  S      Y GF V+LL+ + ++ N       +     G  I+    +SG++G +  G+ D   API +T  RL   DF    L   I    +   +    +L+ ++ P    +W     ++  TA+ + I   + P + AR + +  S+++    L           V  RV+   WW + L ++  + +N+AA+L     +    SF ++ NQ +Y + ++       F K +     Q I+  M   TP+  V+T  + +  ++   Y+ L +  +L YQ T+NC LT  G  V     Y + LPK S     ++ ++  +  +G   +L   +W    Q + C
Sbjct:   74 PKRSLDGAVEYEGFCVDLLDKLAENLNFDYKLYIVKDGKYGEPINGTAEWSGMIGEILRGSADMAVAPITVTARRLEVVDFTDPFLQLGISMLMRQPDRATSSSLTSFLWPLSGSVWMYSAFATIGTALSVIIVSLLSPAESARQFNITNSIWYLVCILLRAGSGYNCESVSNRVISTVWWSFTLVLIAQYTANFAAVLTVNRKSMPFNSFEELGNQTEYTFGSILGGSTMQFFKYSRLETFQRIWTRMQNITPSVFVHTNSEGVQRVLKEKYVFLMESASLEYQLTQNCNLTRVGTVVLGSNGYSIALPKGSRWREKLTRQILDFNEKGVMMMLKSTWWKKTPQMEDC 422          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. TrEMBL
Match: A0A3P7GL66 (Uncharacterized protein OS=Toxocara canis OX=6265 GN=TCNE_LOCUS10963 PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.969e-20
Identity = 83/349 (23.78%), Postives = 151/349 (43.27%), Query Frame = 2
Query: 1181 PPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD--YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN--QFQSC 2206
            P  S      Y GF V+LL+ + ++ N       +     G  I+    +SG++G +  G+ D   API +T  RL   DF    L   I    +   +    +L+ ++ P    +W     ++  TA+ + I   + P + AR + +  S+++    L           V  RV+   WW + L ++  + +N+AA+L     +    SF ++ NQ +Y + ++       F K +     Q I+  M   TP+  V+T  + +  ++   Y+ L +  +L YQ T+NC LT  G  V     Y + LPK S     ++ ++  +  +G   +L   +W    Q + C
Sbjct:   74 PKRSLDGAVEYEGFCVDLLDKLAENLNFDYKLYIVKDGKYGEPINGTAEWSGMIGEILRGSADMAVAPITVTARRLEVVDFTDPFLQLGISMLMRQPDRATSSSLTSFLWPLSGSVWMYSAFATIGTALSVIIVSLLSPAESARQFNITNSIWYLVCILLRAGSGYNCESVSNRVISTVWWSFTLVLIAQYTANFAAVLTVNRKSMPFNSFEELGNQTEYTFGSILGGSTMQFFKYSRLETFQRIWTRMQNITPSVFVHTNSEGVQRVLKEKYVFLMESASLEYQLTQNCNLTRVGTVVLGSNGYSIALPKGSRWREKLTRQILDFNEKGVMMMLKSTWWKKTPQMEDC 422          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. TrEMBL
Match: A0A0B2VUI9 (Glutamate receptor ionotropic, kainate 2 OS=Toxocara canis OX=6265 GN=GRIK2 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 4.887e-20
Identity = 83/349 (23.78%), Postives = 151/349 (43.27%), Query Frame = 2
Query: 1181 PPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD--YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPN--QFQSC 2206
            P  S      Y GF V+LL+ + ++ N       +     G  I+    +SG++G +  G+ D   API +T  RL   DF    L   I    +   +    +L+ ++ P    +W     ++  TA+ + I   + P + AR + +  S+++    L           V  RV+   WW + L ++  + +N+AA+L     +    SF ++ NQ +Y + ++       F K +     Q I+  M   TP+  V+T  + +  ++   Y+ L +  +L YQ T+NC LT  G  V     Y + LPK S     ++ ++  +  +G   +L   +W    Q + C
Sbjct:  393 PKRSLDGAVEYEGFCVDLLDKLAENLNFDYKLYIVKDGKYGEPINGTAEWSGMIGEILRGSADMAVAPITVTARRLEVVDFTDPFLQLGISMLMRQPDRATSSSLTSFLWPLSGSVWMYSAFATIGTALSVIIVSLLSPAESARQFNITNSIWYLVCILLRAGSGYNCESVSNRVISTVWWSFTLVLIAQYTANFAAVLTVNRKSMPFNSFEELGNQTEYTFGSILGGSTMQFFKYSRLETFQRIWTRMQNITPSVFVHTNSEGVQRVLKEKYVFLMESASLEYQLTQNCNLTRVGTVVLGSNGYSIALPKGSRWREKLTRQILDFNEKGVMMMLKSTWWKKTPQMEDC 741          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. TrEMBL
Match: A0A0B2V0Z6 (Glutamate receptor ionotropic, kainate 2 OS=Toxocara canis OX=6265 GN=GRIK2 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.023e-19
Identity = 98/408 (24.02%), Postives = 161/408 (39.46%), Query Frame = 2
Query: 1124 NLSASNLLATGFRIGYIEYPPFSFI--------SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTH-GAYFDP--------------------------------PRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEET--PNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNG 2212
            N+  S+ L   FR+  I   P+  +         N    GF ++LL  + +D     T   +  KN GN +  N ++ G++G +  G  +   AP+ +   R    DF    LS  I   +K       D  S+ +NP    IW  +L S     +G+ I  ++ P     Y+  ++     +   H  A F P                                PR V  R+L   WW++ L +V  + +N AA+L  + T   + +F D+ NQ    Y T+       F + +       ++  M +           +E A+S    NY  L +  +L Y+  +NC LT  G  +    YG+ L K SE T  IS ++  Y  +G   +   K+W ++  SC G
Sbjct:  423 NVQVSDELKPHFRVTTIMERPYVMLKKNYYELDENSRLEGFCIDLLAELSRDLGFTYTIHLVKDKNYGNDVYGNGTWDGMIGEILRGEAEMAVAPLTVNFRRAEVVDFTKPFLSLGISILFKIPADNQPDVFSF-LNPLPLQIWICILISIVGLTLGMYIVAHLTP-----YEWNLNFSCCTAHQPHPAAQFSPANSPVQLANNYSFWNTLWYVMSTMLKGGCDFGPRAVSTRLLGGTWWVFTLVIVAAYTANLAAVLTVSRTFIPIKNFDDLANQTTISYGTIQGGSTMQFFQESKISSHVKMWNYMKDRQVFVKNNAKGVEKALSE---NYAFLMESSSLEYEVQQNCNLTQIGGVLGSKGYGIALKKRSEWTDRISRQILLYAKRGIIEMKKTKWWRSKGASCAG 821          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. TrEMBL
Match: A0A564YGU2 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5961 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.909e-19
Identity = 126/568 (22.18%), Postives = 232/568 (40.85%), Query Frame = 2
Query:  614 FHHFTSVENVIINLRQINYFTIISILNDPDVNARLINQVYLAHLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYS----GRSILLQAAFNLT------ILLKCSSQTGIKN--TLTGDFNGSN----RTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLSASN------LLATGFRIGYIEYPPFSFISNGS-------------YTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETP--NGTVNTLEDAISMI-PLNYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQS 2203
            + +    E +   + + N   +I +L   ++N  +I   Y  +L  W  +W+I  + GG   +  P  GQ V + NV+++  G+   +      ++  + AF+        + + C+      N   LTGDF+ +N    RTT    + +  G+ NK         +  SVT       +   Y    S +N      L +   RI  +  PPF+  SN S              TG T++++ ++L          P+ ++       ++ S   +L  V NG  D       +  +   YFDF +N L  +     K         L  +  P     W  ++  S   A+ LA  +Y  P++   Y    S+F +F  L  G    PP +   R ++C WWL+ LF +VI+++NYAA++  +    + T F+ +L      +  +   L  + ++ +   + Q I  + ++  P  N    T+E+ +  +    Y ++ D  TL Y + K CL + G++    Y ++L   +  T  ++ +L      G    + + Y   Q  S
Sbjct:  161 YQNADDTEVLTTKINEANADNVILLLPSENINI-VIKNAYNKNLFTWNRRWVIASVDGG---IPQPPNGQEVNNANVSVLYVGRPNATPLDIANTVEDKLAFDTAYAARAYMEIACNDSLSEANYEGLTGDFDFTNINTPRTTVTMTVAR--GLMNKP-------NVVGSVTITGDKYDVVGNYDEIFSFANETIEAILRSRKMRIAVVLAPPFAMFSNDSKQIVKPTSCDISTLTGMTIDVVKAILD---------PIGVQYECTCYPASMSNDSLLS-VNNGLADMAVGEFAVLPHLRDYFDFISNFLYFSFAILEKPEITQEKTYLWLFFKPLSAGSWVMIVFCSIVVALVLATLNYFSPNQ-VDYGFFESIFVAFGCLFQGLTVSPPNQWSSRFMLCVWWLFVLFFIVIYIANYAAIIMHSGIQNEATGFTALLVDPSIPFGALPSSLAATQMRRSHKLEIQKINYLSDKLHPQTNERNITIEERVQQVRDGKYRLISDSFTLEYFANKYCLALTGEYSSHQYAIILKLNTVYTEYLNRRLTALINDGNIKEIADSYTGQQSSS 704          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 78.9518 bits (193), Expect = 1.526e-14
Identity = 76/360 (21.11%), Postives = 144/360 (40.00%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI----TDYMYPDKYA----------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            + + N  + GF ++LL  +            +P    G +      ++G++  +     D   AP+ +T  R    DF+   ++  I   Y+          S+ +NP    IW  +L +    +  L +    + Y + D +            + LL S +F   SL        P+ +  R++   WW + L ++  + +N AA L      + + S  D+  Q   +Y  V D    SF K +     + ++  M+ +     V ++ED I  ++  +Y +L +  T+ Y + +NC LT  G  +    YG+  PK S     ++  +      G+  +L EK+W     SC   +
Sbjct:  451 ALVGNDRFEGFCIDLLKELASILGFAYEIRLVPDGKYG-FQDDKGQWNGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTNSGFFSF-LNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWSG--SSCQEDE 806          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 78.5666 bits (192), Expect = 2.155e-14
Identity = 76/360 (21.11%), Postives = 144/360 (40.00%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI----TDYMYPDKYA----------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            + + N  + GF ++LL  +            +P    G +      ++G++  +     D   AP+ +T  R    DF+   ++  I   Y+          S+ +NP    IW  +L +    +  L +    + Y + D +            + LL S +F   SL        P+ +  R++   WW + L ++  + +N AA L      + + S  D+  Q   +Y  V D    SF K +     + ++  M+ +     V ++ED I  ++  +Y +L +  T+ Y + +NC LT  G  +    YG+  PK S     ++  +      G+  +L EK+W     SC   +
Sbjct:  405 ALVGNDRFEGFCIDLLKELASILGFAYEIRLVPDGKYG-FQDDKGQWNGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTNSGFFSF-LNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWSG--SSCQEDE 760          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 78.5666 bits (192), Expect = 2.184e-14
Identity = 76/360 (21.11%), Postives = 144/360 (40.00%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAI----TDYMYPDKYA----------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
            + + N  + GF ++LL  +            +P    G +      ++G++  +     D   AP+ +T  R    DF+   ++  I   Y+          S+ +NP    IW  +L +    +  L +    + Y + D +            + LL S +F   SL        P+ +  R++   WW + L ++  + +N AA L      + + S  D+  Q   +Y  V D    SF K +     + ++  M+ +     V ++ED I  ++  +Y +L +  T+ Y + +NC LT  G  +    YG+  PK S     ++  +      G+  +L EK+W     SC   +
Sbjct:  453 ALVGNDRFEGFCIDLLKELASILGFAYEIRLVPDGKYG-FQDDKGQWNGIIRELMEHRADLAVAPLTITFVRERVIDFSKPFMNTGISILYRRPNSTNSGFFSF-LNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQVGGIIDSKGYGIGTPKGSPYRDKVTIAILSLLEDGRLHMLKEKWWSG--SSCQEDE 808          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 75.0998 bits (183), Expect = 2.198e-13
Identity = 71/345 (20.58%), Postives = 137/345 (39.71%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKY--------------ARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD-YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            N  + GF ++LL  +      +     +     G    S   ++G++  + +   D   AP+ +T  R    DF+   ++  I   Y+          S+ +NP    IW  +L +    +  L +     P ++                + LL S +F   +L        P+ +  R++   WW + L ++  + +N AA L      + + S  D+  Q   +Y  V D    +F K         ++  M+    +  V ++E+ I  ++  +Y  L +  T+ + + +NC LT  G  +    YGV  P  S     I+  + Q + +GK  ++ EK+W
Sbjct:  457 NDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF-LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW 800          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 74.7146 bits (182), Expect = 2.972e-13
Identity = 71/345 (20.58%), Postives = 137/345 (39.71%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKY--------------ARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAIS-MIPLNYIILYDDRTLYYQSTKNC-LTMFGKFVYFD-YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            N  + GF ++LL  +      +     +     G    S   ++G++  + +   D   AP+ +T  R    DF+   ++  I   Y+          S+ +NP    IW  +L +    +  L +     P ++                + LL S +F   +L        P+ +  R++   WW + L ++  + +N AA L      + + S  D+  Q   +Y  V D    +F K         ++  M+    +  V ++E+ I  ++  +Y  L +  T+ + + +NC LT  G  +    YGV  P  S     I+  + Q + +GK  ++ EK+W
Sbjct:  457 NDRFEGFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSF-LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWW 800          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 66.2402 bits (160), Expect = 1.697e-11
Identity = 74/388 (19.07%), Postives = 144/388 (37.11%), Query Frame = 2
Query: 1190 SFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR----------------------------------------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN---YIILYDDRT-LYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
             F  N  Y G+ V+L   +         +  +P    G        ++G++G +  G  D   AP+ +++ R    DF+   +S  I    K  +K     +S+ ++P  + IW  ++ +    ++ L +     P ++ R                                        + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + + S  D+  Q +  Y T++      F + +     + ++  M +  P   V T  D +S +  +   Y  L +  T  Y +  K C TM   G      YG+  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:   52 QFEGNDKYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISF-LDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 438          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 4.241e-11
Identity = 60/293 (20.48%), Postives = 115/293 (39.25%), Query Frame = 2
Query: 1355 NGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKY--------------ARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNC-LTMFGKFV-YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            N   D   AP+ +   R    DF+   ++  I   Y+          S+ +NP    IW  +L +    +  L +     P ++                + +L S +F   +L        P+ +  R++   WW + L ++  + +N AA L      + ++S  D+  Q   +Y  V D    +F K +     + ++  M+        N  E    ++  +Y +L +   + Y + +NC LT  G  +    YG+  P  S     I+  + Q + +GK  ++ EK+W
Sbjct:    7 NHKADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSF-LNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWW 298          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 6.171e-11
Identity = 54/268 (20.15%), Postives = 114/268 (42.54%), Query Frame = 2
Query: 1472 KKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKY---ARYKLLMSVXXXXXXLTHGAYF----------DP-PRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNE-----ETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVL--PKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNG 2212
            K+V    +  ++ P    +W ++L + A  ++ L +   ++PD++   A+ KL+        +L +  +F          DP P  + G++++  WW + L V   + +N AA L     T+ + S  D+  Q D +Y T +   +  FL ++A     T++R + +      +P   +   E A       YI + +   ++     +C  +     +F + + L  P  S     +S  + +    G+ + L  +++  + Q C G
Sbjct:   22 KEVNEPRIFQFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLTAEGQTS-IRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHIRDNRTMVASPKKGLEQAEKA------GYIFIGEASAVFTAKKDHCDLIISDRRFFRHRLALPFPPGSRLAAEVSRAVTELEDSGQLAELERQWFAQEGQECVG 282          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 67.0106 bits (162), Expect = 1.393e-11
Identity = 81/374 (21.66%), Postives = 150/374 (40.11%), Query Frame = 2
Query: 1169 YIEYPPFSFI--------SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYA------------RYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAA-LLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETP--NGTVNTLEDAISMIPLNYIILYDDRTL-YYQSTKNCLTMFGK--FVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNG 2212
            Y++  PF  I         N  Y GF+ +L+  + +  N           + G+ +   +   G++G +     D    PI +T  R    DF+   L   I    +      ++  ++ + PF+  +W T L      ++ +   D   P  Y              + L  S++F+ +S+      + PR   GRVL   +WL+ L ++  + +N AA    +    +++ S  D+++Q+  KY       L +F   +      T+++ M  +    NGT   +  A +  P  Y  L D  +L YY   K C TM  K       Y + + + SE T +IS  + + R +G+      ++W +  +   G
Sbjct:    5 YLQDEPFMMIKPNASLLKGNDRYRGFSKDLMELLSRKLNFRYEICISKESSYGSKVEGQWQ--GLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLL-PFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQETFVNGTQYGVLKARTQ-PFAY--LTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSECPTG 372          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 60.8474 bits (146), Expect = 6.200e-10
Identity = 64/258 (24.81%), Postives = 109/258 (42.25%), Query Frame = 2
Query: 1502 YINPFEWPIWATLLCSSAATAIGLAITDYMYP------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISM---IPLNYIILYDDRTL-YYQSTKNCLTMFGKFVY--FDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSDV 2221
            ++ PF+  +WA       A  I + I D   P             +   + L  S++F+  S+      + PR   GRVL   +WL+ L ++  + +N AA      + + + S  D++ Q+ +KY       L SF + +     + ++  M+  T N  V   ++ ++     P  Y  L D  +L YY   K C TM  K +     Y + L + SE T  IS  + Q R +G+   +  K+W +    CN  D 
Sbjct:    4 FLMPFQKDLWACCCLVVGAVTILMWILDRFSPYGFRAEAKNTGEGEGDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKMS--TLNTFVKGTDEGVNRSRTTPFAY--LTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQRNSEWTDGISVAILQLREEGEVERIRYKWW-DAMSECNLKDA 256          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 60.077 bits (144), Expect = 3.505e-9
Identity = 71/320 (22.19%), Postives = 131/320 (40.94%), Query Frame = 2
Query: 1313 SSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATN-ALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXX-------------XLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYK---YTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNYI--ILYDDRTLYYQSTKNC-LTMFGK-FVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCN 2209
            S    ++G++G V  G  D + A + +   R  + +F+      G  +   K+ +   +D+   ++ PF+  +W  +L S    A+ L + D   P  + R+KL        +              L  G     PR    RVL   W  + + +V  + +N AA L        ++   D   +N  K   Y TV +  ++++ +     +  ++Y  M        V T ++ I  +    +   ++D   LYY+++K+C LT  G+ F    YG+ +PK S  +  IS  +  +   G    L E  W +  + CN
Sbjct:  477 SDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDS---FLRPFQIHLWLLVLLSVHIVAVILYLLDRFSP--FGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQV--ELSSMYTFME----GYNVKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEEL-ETTWIDASK-CN 783          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 53.9138 bits (128), Expect = 2.777e-7
Identity = 74/365 (20.27%), Postives = 136/365 (37.26%), Query Frame = 2
Query: 1211 YTGFTVELLN--SVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALS---GNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMY--------------------PDKYARYKLLMSV-----XXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIY------RIMNEETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNCLTMFGK-----FVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKY 2182
            + G  ++LL+  S +  FN      P     V N ++ N+   GV+  +     D    PI +T +R    DF    ++   G ++G   S K         ++ PF+  +W T+        +G+ + ++++                       Y + K  +S        +   L  G   + P    GR  +  WW     +   + +N AA L  T   T +    D+ +Q +  Y  V + L  +F ++++    Q ++      R +  +T      TL+   + I    I+ Y  R  Y    K    + G      F    YG  LPK S  T ++S ++ +    G    +IE++
Sbjct:  406 FEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWD--GVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPK-----PYFRFLEPFKSDLWITIF----GAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYTAIERTLKGKYAFIHDAPILEYLARKTYCGRIK----LIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIEEW 755          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Nematostella
Match: EDO32621 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK3])

HSP 1 Score: 50.447 bits (119), Expect = 7.963e-7
Identity = 49/205 (23.90%), Postives = 88/205 (42.93%), Query Frame = 2
Query: 1367 DTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDA--LSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR---------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLM-CFWWLYCLFVVVIWVSNYAALLAKTFTTTQ----LTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEE 1933
            D  ++P+ +T  RL Y +F+   +   +      SKK   D   L  ++ P+   +W   L       I + + +Y+ P  Y +         +    S++F  +S+        PR + GRVL  CFW     F ++IW+S Y A LA  FT       +++  D+++   Y +  +    L  F K  +Y   + ++  M+ E
Sbjct:    1 DLSTSPLTITSERLQYLEFSKPFMQFTMSLI---SKKFDNDNQYLMAFMRPYSSTVWLLTLAGLLLVTILMFVVNYISPYGYRKSHKSKNGEAFNFFNSLWFCLASMLQQGADSTPRSLSGRVLAGCFW-----FCILIWISTYTANLAAFFTVRSAGKTVSTLEDVVD-GGYHFYIIRHTALYHFFKMASYHTYRKLWERMSAE 196          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Medaka
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:101158221])

HSP 1 Score: 78.1814 bits (191), Expect = 2.317e-14
Identity = 74/363 (20.39%), Postives = 140/363 (38.57%), Query Frame = 2
Query: 1199 SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP------------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
             N  Y G+ V+L + + K   I      +P    G       +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                  D    + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + +    D+  Q +  Y T++      F + +     + ++  M    P+  V T  D +S +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  440 GNDRYEGYCVDLASEIAKHVGIRYKLSVVPDGKYGARDPETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDENDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIEGAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVSRVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 801          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Medaka
Match: si:ch211-251b21.1 (glutamate receptor U1 [Source:NCBI gene;Acc:101161808])

HSP 1 Score: 77.0258 bits (188), Expect = 2.785e-14
Identity = 73/360 (20.28%), Postives = 156/360 (43.33%), Query Frame = 2
Query: 1148 ATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSY-YINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYAR-------YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPL-NYIILYDDRTLYYQSTKNCLTMFGKFV--YFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQ 2194
            A    I  I+  P++        G+ ++L++ + K        V +   N    + ++ +++G++G +     D   AP+ +T  R  + D A   +   +  ++ + K    +  S+  + PF   +W  LL S   T + + +   + P ++A        + LL S ++   SLT       P+ + GRV+   WW++C+ ++  + +N+++++        +++F D+ NQ+   Y TV       F KN+  P  + +Y+ M  E     V+T+E+ +      N+  + +  +L     + C     + V     Y +  P  S     +S  + +    G+ + L EK+W ++
Sbjct:   23 AKQLSITTIKEDPYTMSKGSGLEGYCIDLISELSKKLGF-DYKVHVVKDNRYGAMDASGNWNGMIGELVRKEADLAVAPLTVTAVRERHVDMAAPFIHTGL--SFITRKASDSEESSFSLLAPFSTDMWVGLLVSFLLTGLCIYLVGRISPAEWAEPRTDEHSFTLLHSFWYIIGSLTLQGAGPHPKALSGRVISALWWIFCVLLLACYFANFSSVMQSKSRQVSISTFEDLANQDVIDYGTVEFGSTMLFFKNSNNPVYKRLYQHM--ERKKSFVSTMEEGVRRTQEGNFAFIGEAVSLDLAVARYCKLSRAQEVISMRAYSIATPLGSPMMKNLSIAILELSESGELTHLREKWWASK 377          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Medaka
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:101158221])

HSP 1 Score: 77.7962 bits (190), Expect = 2.870e-14
Identity = 74/363 (20.39%), Postives = 140/363 (38.57%), Query Frame = 2
Query: 1199 SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP------------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
             N  Y G+ V+L + + K   I      +P    G       +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                  D    + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + +    D+  Q +  Y T++      F + +     + ++  M    P+  V T  D +S +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  404 GNDRYEGYCVDLASEIAKHVGIRYKLSVVPDGKYGARDPETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDENDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIEGAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVSRVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 765          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Medaka
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:101158221])

HSP 1 Score: 77.7962 bits (190), Expect = 3.258e-14
Identity = 74/363 (20.39%), Postives = 140/363 (38.57%), Query Frame = 2
Query: 1199 SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP------------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGS 2215
             N  Y G+ V+L + + K   I      +P    G       +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                  D    + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + +    D+  Q +  Y T++      F + +     + ++  M    P+  V T  D +S +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ +  +G 
Sbjct:  440 GNDRYEGYCVDLASEIAKHVGIRYKLSVVPDGKYGARDPETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDENDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIEGAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVSRVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGG 801          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Medaka
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:101158221])

HSP 1 Score: 76.6406 bits (187), Expect = 7.217e-14
Identity = 75/364 (20.60%), Postives = 140/364 (38.46%), Query Frame = 2
Query: 1199 SNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP------------------DKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNY----IILYDDRTLYYQSTKNCLTM--FGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSD 2218
             N  Y G+ V+L + + K   I      +P    G       +++G++G +  G  D   AP+ +T+ R    DF+   +S  I    K  +K      S+ ++P  + IW  ++ +    ++ L +     P                  D    + +  S++FS  +         PR + GR++   WW + L ++  + +N AA L      + +    D+  Q +  Y T++      F + +     + ++  M    P+  V T  D +S +  +      +L      Y +  K C TM   G      YGV  PK S     ++  + +   QG    L  K+W ++ + C   D
Sbjct:  440 GNDRYEGYCVDLASEIAKHVGIRYKLSVVPDGKYGARDPETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF-LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDENDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIEGAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVSRVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSEQGILDKLKNKWWYDKGE-CGTKD 801          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Planmine SMEST
Match: SMESG000047329.1 (SMESG000047329.1)

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 771/780 (98.85%), Postives = 773/780 (99.10%), Query Frame = 2
Query:  107 ATAYLCFFPGTVSIINFLYTSPWYGGPTDILAAKALIIDVNDCVKNLQFTPNYVTXXXXXXXXXXXXNAEASRLKGINMDYTIGESNALLNFIYPLNASATILIQPMYPTDEELMSVVLQVFDTLYNPSVPKQKILVIINRTQDFNNLEINNYENIVRMINNRLWTDVIFHHFTSVENVIINLRQINYFTIISILNDPDVNARLINQVYLAHLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYSGRSILLQAAFNLTILLKCSSQTGIKNTLTGDFNGSNRTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLSASNLLATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSDVPNIIAQWLSSIIKYPLPTSFDXXXXXXXXXXXXXXXXXXXXXXXXEKLIRFCVLKTQERRDKYKYETTVEQLTAF 2446
            ATAYLCFFPGTVSIINFLYTSPWYGGPTDILAAKALIIDVNDCVKNLQFTPNYVTSGLSLLSPISSLNAEASRLKGINMDYTIGESNALLNFIYPLNASATILIQPMYPTDEELMSVVLQVFDTLYNPSVPKQKILVIINRTQDFNNLEINNYENIVRMINNRLW DVIFHHFTSVENVIINLRQINYFTIISILNDPDVNARLINQVYLAHLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYSGRSILLQAAFNLTILLKCSSQTGIKNTL GDFNGSNRTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLSASNLLATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKN+GNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVFFSFSSLTHGAYFDPPRRVGGRVLMCFWWLYCLFVV+IWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLL SFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNCLTMFGK VYFDYGVVLPKFSEKTLVI TKLRQYRAQG TSVLIEKYWPNQFQSCNGSDVPNIIAQWLSSIIKYPLPTSFDINIMIGVFVIVVVGGVAAMILAVIEKLIR CVLKTQERRDKYKYETTVEQLTAF
Sbjct:    7 ATAYLCFFPGTVSIINFLYTSPWYGGPTDILAAKALIIDVNDCVKNLQFTPNYVTSGLSLLSPISSLNAEASRLKGINMDYTIGESNALLNFIYPLNASATILIQPMYPTDEELMSVVLQVFDTLYNPSVPKQKILVIINRTQDFNNLEINNYENIVRMINNRLWIDVIFHHFTSVENVIINLRQINYFTIISILNDPDVNARLINQVYLAHLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYSGRSILLQAAFNLTILLKCSSQTGIKNTLIGDFNGSNRTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLSASNLLATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNIGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVFFSFSSLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVIIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLYSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTKNCLTMFGKSVYFDYGVVLPKFSEKTLVIRTKLRQYRAQGNTSVLIEKYWPNQFQSCNGSDVPNIIAQWLSSIIKYPLPTSFDINIMIGVFVIVVVGGVAAMILAVIEKLIRLCVLKTQERRDKYKYETTVEQLTAF 786          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Planmine SMEST
Match: SMESG000065489.1 (SMESG000065489.1)

HSP 1 Score: 138.272 bits (347), Expect = 1.262e-33
Identity = 122/529 (23.06%), Postives = 242/529 (45.75%), Query Frame = 2
Query:  740 HLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYSGRSI-----------LLQAAFNLTILL---KCSSQTG-IKNTLTGDFNGSN----RTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSY--INLIYSYNLSASNLL----ATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMI-PLNYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQ-SCNGSDVPNIIAQWL 2245
            +L+ W+ +W+I       ++  T  +G   L  NVTI  F +N  +  ++           L   ++ +  L+   +C+   G I N  TG+F+ +N    R  ++ +I +  G            ++ +++     +S    N+ + +NL+A N+L       FR+  +   PF +    +  G ++++++ +L   N+  TY  +   N+ N + S+   +G+LG  QNG  D V  PI   +  ++Y DF        I   YK++       +  +IN F W IW  ++ S    AI L + + + P K A + +L S+     SL  G     P  + G++L+ FWW++ + +++ +V+NY A L      + +    D++ Q  Y Y TV    +++FL+++   D     +++  +  N   N+L +A +++    Y ++Y    L+     +C ++      F+Y   LP  S+ T +I+ ++    +      L  KY+P   Q +C+ S   +++ + L
Sbjct:   64 NLLHWKMRWLI--FFSTLSFAKTNIFGNLPLRQNVTIYDFPKNSETSTNVPQGITDEQDFVLTDISYTVVKLMDYSECNIDPGNILNLGTGNFSFNNGAVTRNNWIVDIYRPSG---------SLLKVGQAIIRNGAISLNQPNVPF-FNLTAQNILKEMQTKPFRVAVMAEKPFGYYVGNTTVGHSIDIISLILGKLNV--TY-NITYYNLSNGLLSDGKLTGMLGIAQNGQADIVIGPITQNLKYISYVDFTDPVGQYFIAIGYKTNASNAYSQIFEFINAFNWVIWVLIIGSCIIYAIALTLVNLISPSK-AHFNILYSILLMMGSLVQGVTTALPDTISGKILIVFWWIFNIAILLAYVANYGAYLTNLRMQSSIQQVGDLIAQTKYAYGTVIGSAIDTFLQSSTSTDILNTNKVIRSQYLNIMPNSLSEAFNLVNKTPYALIYHSTVLHSLGNSSCFSVSTGTDSFNYSYALPFKSDYTAIINAQINSLNSSFMMD-LQNKYFPTYIQPACDTSSWIDLVLEVL 575          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Planmine SMEST
Match: SMESG000065489.1 (SMESG000065489.1)

HSP 1 Score: 138.272 bits (347), Expect = 1.284e-33
Identity = 122/529 (23.06%), Postives = 242/529 (45.75%), Query Frame = 2
Query:  740 HLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYSGRSI-----------LLQAAFNLTILL---KCSSQTG-IKNTLTGDFNGSN----RTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSY--INLIYSYNLSASNLL----ATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMI-PLNYIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQ-SCNGSDVPNIIAQWL 2245
            +L+ W+ +W+I       ++  T  +G   L  NVTI  F +N  +  ++           L   ++ +  L+   +C+   G I N  TG+F+ +N    R  ++ +I +  G            ++ +++     +S    N+ + +NL+A N+L       FR+  +   PF +    +  G ++++++ +L   N+  TY  +   N+ N + S+   +G+LG  QNG  D V  PI   +  ++Y DF        I   YK++       +  +IN F W IW  ++ S    AI L + + + P K A + +L S+     SL  G     P  + G++L+ FWW++ + +++ +V+NY A L      + +    D++ Q  Y Y TV    +++FL+++   D     +++  +  N   N+L +A +++    Y ++Y    L+     +C ++      F+Y   LP  S+ T +I+ ++    +      L  KY+P   Q +C+ S   +++ + L
Sbjct:   57 NLLHWKMRWLI--FFSTLSFAKTNIFGNLPLRQNVTIYDFPKNSETSTNVPQGITDEQDFVLTDISYTVVKLMDYSECNIDPGNILNLGTGNFSFNNGAVTRNNWIVDIYRPSG---------SLLKVGQAIIRNGAISLNQPNVPF-FNLTAQNILKEMQTKPFRVAVMAEKPFGYYVGNTTVGHSIDIISLILGKLNV--TY-NITYYNLSNGLLSDGKLTGMLGIAQNGQADIVIGPITQNLKYISYVDFTDPVGQYFIAIGYKTNASNAYSQIFEFINAFNWVIWVLIIGSCIIYAIALTLVNLISPSK-AHFNILYSILLMMGSLVQGVTTALPDTISGKILIVFWWIFNIAILLAYVANYGAYLTNLRMQSSIQQVGDLIAQTKYAYGTVIGSAIDTFLQSSTSTDILNTNKVIRSQYLNIMPNSLSEAFNLVNKTPYALIYHSTVLHSLGNSSCFSVSTGTDSFNYSYALPFKSDYTAIINAQINSLNSSFMMD-LQNKYFPTYIQPACDTSSWIDLVLEVL 568          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Planmine SMEST
Match: SMESG000065907.1 (SMESG000065907.1)

HSP 1 Score: 121.709 bits (304), Expect = 4.859e-28
Identity = 126/546 (23.08%), Postives = 235/546 (43.04%), Query Frame = 2
Query:  641 VIINLRQINYFTIISILNDPDVNARLINQVYLAHLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSNNVTIITFGQNGYSGRSILLQAAFNLTILLKCSSQTGIK--------------NTLTGDFNGSN----RTTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLSASNLL----ATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNII--PTYVPLPIKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGA-YKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYPDKYARYKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNNAYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLN------YIILYDDRTLYYQSTKNCLTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYW 2185
            + ++L +I    ++S  ND              +L  WR +W++        + S+  YG      NVTI  +  N     ++         IL    S   +K              N  TG F  +N    RT+++ +  Q   +  K+      + +  +  +   L        +N S  NLL    A  FR+  ++  P++F +NG+ TG +VE++  +L   N+    T+  LP    G  +  N   +G++G  QNG  D V  PI   +   +Y D+ TN +S + +G  YK +       +  ++  F++ +W  +L S A   I L + + + P++  ++   +S+ F+  S+  G     P ++ GR+L  FWW++ + V++ +V+NY A+L  +     +   SD+  QN Y Y T+ +  ++ FL+ +A    Q + + +  +  N    T   +I ++         Y ++Y +  L   ++  C  +       +Y   LP  S+ T +I+ +L         S LI KY+
Sbjct:  201 IAMDLSRIGSLEVLSACND-------------LNLQNWRIRWLV--------FFSSLSYGNYTQRPNVTIFDYAHNSDYSSTVNPTILEEQDILFSDFSMMAVKLMDSECNNPIPPSLNLRTGQFTFTNAIYTRTSWILDAYQ---LNAKTASVQIVNGIVTTDYNSLPL--------FNSSTQNLLNEMRAKPFRVAAMQEKPYAFYANGTQTGHSVEIIIKILSSLNVTYNITFYELP---SGTLV--NGKLNGMMGIAQNGQADIVIGPITTNLVYQSYVDY-TNVVSTDTIGILYKINSTDLYKNMFEFVFAFDYIVWILILVSCAIYGIALTLVNLISPNQ-TKFTGGLSILFTMGSMVQGVTTALPDKISGRILAVFWWIFNIAVLLAYVANYGAILTNSRMQGSIVELSDLFQQNTYSYGTIVNSAVDYFLQTSASSSIQNVNQAIRAQYANIMPTTFNASIDLVNNKDVSLKPYALIYGNSILKPYTSLACYVLVSGTNQVNYSYALPFNSDYTNIINAQLNALDPSFLNS-LITKYF 706          
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Planmine SMEST
Match: SMESG000013939.1 (SMESG000013939.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.928e-14
Identity = 84/369 (22.76%), Postives = 153/369 (41.46%), Query Frame = 2
Query: 1202 NGSYTGFTVELLNSVLKDFNIIPTYVPLPIKN-----VGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNALSGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDYMYP---------DKYAR----YKLLMSVXXXXXXLTHGAYFDPPRRVGGRVLMCFWWLYCLFVVVIWVSNYAALLAKTFTTTQLTSFSDILNQN-DYKYTTVND-DLLNSFLKNNAYPDPQTIYRIMN---EETPNGTVNTLEDAISMI---PLNYIILYDDR-TLYYQSTKNCLTMFGKFVYFD--YGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWPNQFQSCNGSDV 2221
            N  Y GF V+LLN +   F      + L   N     +G   +    ++G++G + NGT D V AP+ ++++R     F+   L+  +    K   K      S++  P  +P+W     +    + GL I   M P         D + +    +     V+FS ++         P+  G R+L   WW + L ++  + +N AA L  +     +  + D+++     +Y T+N     N F+  N  P     +R M    ++ P+    T+E+ +  +     NY  L + R   Y+ +   C TM     Y D  YG+  PK       I+  + + R + + + L +K+W  + + CN  + 
Sbjct:  481 NERYEGFCVDLLN-LTASFLGFKYEIHLVNDNSFGVKIGQNPNGTEIWNGLIGEILNGTADMVVAPLTISLSRARVVHFSEPFLTFGLSVIIKKPGKKKAGIFSFF-RPLSYPVWGCYFAACLVVSCGLYIIARMSPYEWNINNPYDPHQKITRDFTFFNCVWFSIAAFVQQGVDVAPKSPGARILSSVWWFFTLIMIAYYTANLAAFLTISLMIPPINDWPDLVSPGVGIEYGTINSGSTKNFFMTTNLEP-----FRTMGLFMKQNPHVFRKTIEEGVKKVRSSKGNYAFLLESRMNEYFNNRYPCDTMMVGTPYGDNGYGIATPKNYSLNENITDAILKLREKQELTKLYKKWWIEKGE-CNDDNA 841          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA43.595e-1319.51glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA43.595e-1319.51glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA14.024e-1320.92glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA14.653e-1320.65glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA14.870e-1320.92glutamate ionotropic receptor AMPA type subunit 1 ... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-56.193e-2224.75GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-61.070e-2022.54GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-35.165e-1923.22GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-44.811e-1520.59GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-49.481e-1520.59GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG111553.362e-1422.41gene:FBgn0039927 transcript:FBtr0333701[more]
CG111553.362e-1422.41gene:FBgn0039927 transcript:FBtr0089195[more]
Ekar1.596e-1320.22gene:FBgn0039916 transcript:FBtr0110906[more]
GluRIIC1.887e-1322.37gene:FBgn0046113 transcript:FBtr0336969[more]
Ekar2.517e-1220.22gene:FBgn0039916 transcript:FBtr0344874[more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-183j2.109.541e-1521.02si:dkey-183j2.10 [Source:ZFIN;Acc:ZDB-GENE-130530-... [more]
CR933820.21.004e-1421.02si:dkey-183j2.10 [Source:NCBI gene;Acc:100151589][more]
LO018303.11.076e-1321.78glutamate receptor ionotropic, kainate 3 [Source:N... [more]
gria3b1.739e-1320.78glutamate receptor, ionotropic, AMPA 3b [Source:ZF... [more]
gria3b1.739e-1320.78glutamate receptor, ionotropic, AMPA 3b [Source:ZF... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dzank11.285e-1520.56double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank11.346e-1520.56double zinc ribbon and ankyrin repeat domains 1 [S... [more]
dzank12.665e-1520.56double zinc ribbon and ankyrin repeat domains 1 [S... [more]
ogfr3.309e-1523.29opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr4.152e-1523.29opioid growth factor receptor [Source:Xenbase;Acc:... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grid27.193e-1421.44glutamate receptor, ionotropic, delta 2 [Source:MG... [more]
Gria42.195e-1319.51glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria42.195e-1319.51glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria12.611e-1320.92glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria13.018e-1320.92glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91756|GLRK_XENLA1.279e-1621.25Glutamate receptor U1 OS=Xenopus laevis OX=8355 GN... [more]
sp|Q90218|GLRK_ANAPL3.881e-1420.40Probable glutamate receptor OS=Anas platyrhynchos ... [more]
sp|P19439|GLRK_CHICK4.127e-1420.23Probable glutamate receptor OS=Gallus gallus OX=90... [more]
sp|Q63226|GRID2_RAT4.821e-1321.44Glutamate receptor ionotropic, delta-2 OS=Rattus n... [more]
sp|P26591|GLRK_LYMST4.886e-1322.22Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183UR431.951e-2023.78Uncharacterized protein OS=Toxocara canis OX=6265 ... [more]
A0A3P7GL661.969e-2023.78Uncharacterized protein OS=Toxocara canis OX=6265 ... [more]
A0A0B2VUI94.887e-2023.78Glutamate receptor ionotropic, kainate 2 OS=Toxoca... [more]
A0A0B2V0Z61.023e-1924.02Glutamate receptor ionotropic, kainate 2 OS=Toxoca... [more]
A0A564YGU22.909e-1922.18Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK31.526e-1421.11glutamate ionotropic receptor kainate type subunit... [more]
GRIK32.155e-1421.11glutamate ionotropic receptor kainate type subunit... [more]
GRIK32.184e-1421.11glutamate ionotropic receptor kainate type subunit... [more]
GRIK22.198e-1320.58glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK22.972e-1320.58glutamate receptor ionotropic, kainate 2 [Source:N... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gria1b1.697e-1119.07glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.14.241e-1120.48pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000007790.16.171e-1120.15pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412911.393e-1121.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412936.200e-1024.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355453.505e-922.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466332.777e-720.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326217.963e-723.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria3a2.317e-1420.39glutamate receptor 3 [Source:NCBI gene;Acc:1011582... [more]
si:ch211-251b21.12.785e-1420.28glutamate receptor U1 [Source:NCBI gene;Acc:101161... [more]
gria3a2.870e-1420.39glutamate receptor 3 [Source:NCBI gene;Acc:1011582... [more]
gria3a3.258e-1420.39glutamate receptor 3 [Source:NCBI gene;Acc:1011582... [more]
gria3a7.217e-1420.60glutamate receptor 3 [Source:NCBI gene;Acc:1011582... [more]
back to top
BLAST of Glutamate receptor, ionotropic kainate 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047329.10.000e+098.85SMESG000047329.1[more]
SMESG000065489.11.262e-3323.06SMESG000065489.1[more]
SMESG000065489.11.284e-3323.06SMESG000065489.1[more]
SMESG000065907.14.859e-2823.08SMESG000065907.1[more]
SMESG000013939.11.928e-1422.76SMESG000013939.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035131 ID=SMED30035131|Name=Glutamate receptor, ionotropic kainate 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2635bp
CAACAATTTCGCATACGCTGCATACAGGACACGCTTCATTGATAATTTTG
GTAACTTTTAATCGGATATCGATTAATTTATTTTAATAATGCTCTTTTTG
TTATTTGCAACTGCTTATTTATGCTTTTTTCCTGGAACAGTTTCAATTAT
TAATTTCTTATACACTTCTCCTTGGTATGGAGGTCCGACAGACATTTTAG
CGGCTAAGGCCTTAATAATTGATGTCAATGATTGTGTAAAAAACCTTCAA
TTTACTCCAAATTACGTTACAAGTGGACTTTCGTTATTATCACCAATTAG
TTCCTTAAATGCAGAGGCATCTCGTTTAAAAGGTATAAATATGGATTATA
CAATTGGAGAATCAAATGCTTTACTTAATTTCATTTATCCTCTCAATGCT
AGCGCTACAATTCTAATTCAGCCGATGTATCCGACTGACGAAGAATTGAT
GAGCGTCGTTCTACAAGTTTTTGACACTTTATATAATCCCAGTGTACCAA
AACAAAAGATTCTAGTAATAATAAACCGAACTCAGGATTTCAACAATTTA
GAAATTAACAATTATGAAAATATAGTTAGAATGATTAATAATAGGCTATG
GACTGATGTTATATTTCATCACTTTACATCAGTAGAAAATGTCATCATCA
ATCTGCGCCAGATCAATTACTTCACAATAATTAGTATCTTAAATGATCCG
GATGTTAATGCCAGGCTAATTAATCAGGTATACTTAGCTCATTTGATGGT
ATGGAGATATCAGTGGATAATTGTCGATCTATTAGGTGGATTTAATTATT
TAAGCACTCCTGACTATGGACAGGGAGTCCTATCAAATAATGTTACAATA
ATAACCTTTGGGCAGAATGGATATTCTGGAAGATCAATTTTGCTTCAAGC
TGCCTTCAATCTGACAATTTTACTAAAATGTTCCTCTCAAACAGGAATAA
AAAATACTCTTACTGGAGACTTTAACGGAAGTAATCGTACAACCTTTCTA
TTCAACATAATTCAGAATCCCGGTATCCAGAATAAAAGCATGGGATACAT
GAAGTTTGATAGGCTAGCGAAAAGTGTTACTTCACAAGCTAAGCTTTCCT
ATATTAATTTAATTTATTCTTATAATTTGAGTGCATCAAATTTGCTTGCA
ACTGGGTTCAGAATAGGTTATATAGAATATCCTCCGTTTTCCTTTATCTC
AAATGGATCTTATACAGGTTTTACTGTAGAATTATTGAATAGTGTACTAA
AAGATTTCAACATTATTCCCACATACGTACCGTTACCGATAAAAAACGTT
GGAAATTATATATCATCAAATTATAGTTTTTCTGGAGTTTTAGGATATGT
CCAAAATGGGACTATTGATACAGTTTCCGCTCCTATCATACTGACAATAA
ACAGACTGACTTATTTTGATTTTGCAACAAATGCCTTATCTGGAAACATT
GTAGGTGCTTATAAAAGTTCAAAAAAGGTTGGAATGGATGCTCTGTCCTA
CTACATAAACCCATTTGAATGGCCCATATGGGCAACGCTCTTATGTAGTT
CCGCAGCGACTGCAATAGGACTTGCAATAACAGATTATATGTACCCCGAC
AAATATGCCAGATACAAATTACTCATGAGTGTATTTTTTTCGTTCAGTTC
ATTGACTCATGGAGCCTATTTTGATCCACCAAGACGAGTTGGCGGAAGAG
TACTCATGTGTTTTTGGTGGCTTTATTGTCTATTTGTGGTTGTCATTTGG
GTTTCGAATTATGCAGCTCTCTTGGCCAAAACATTCACAACTACACAATT
AACATCATTTTCGGATATACTCAATCAAAATGATTACAAATATACAACCG
TCAATGATGATTTATTAAATTCGTTTTTGAAGAATAATGCTTATCCGGAC
CCACAGACAATTTATCGAATAATGAATGAAGAGACTCCAAATGGAACAGT
TAACACATTAGAGGATGCTATATCCATGATTCCACTAAATTATATCATTC
TTTATGATGATCGAACTTTATATTATCAAAGTACTAAAAATTGTTTAACA
ATGTTCGGGAAATTTGTATATTTTGATTATGGAGTTGTTTTACCAAAATT
TTCAGAAAAGACTCTTGTTATTAGCACAAAATTAAGACAATATAGAGCAC
AAGGAAAAACATCTGTATTAATTGAAAAGTATTGGCCTAATCAATTTCAA
AGTTGCAATGGTTCTGATGTGCCCAATATCATTGCCCAATGGTTGTCATC
AATAATAAAATATCCTTTGCCAACTTCATTTGATATAAACATTATGATAG
GAGTTTTTGTTATCGTTGTCGTTGGTGGGGTTGCTGCGATGATTCTGGCT
GTTATTGAAAAATTAATTCGTTTCTGTGTCTTGAAAACCCAAGAGAGAAG
AGACAAATATAAATATGAAACTACAGTTGAACAATTGACAGCATTTTGAT
TGTGTGGATGATATAATACAACGCTCGAATTTATCATTTCTATACACAGA
TATTATGTTTTTCAGAGGAACTTTCATTAACAAAAATTAATCATATTTAA
TTCTGAAGCTTGTTAAACCTGGTATAATTTACCCCAGTTGCACGCATCCA
TTCCGTTCTTTCGAATTCTAAAATATAATAAATAT
back to top

protein sequence of SMED30035131-orf-1

>SMED30035131-orf-1 ID=SMED30035131-orf-1|Name=SMED30035131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=787bp
MLFLLFATAYLCFFPGTVSIINFLYTSPWYGGPTDILAAKALIIDVNDCV
KNLQFTPNYVTSGLSLLSPISSLNAEASRLKGINMDYTIGESNALLNFIY
PLNASATILIQPMYPTDEELMSVVLQVFDTLYNPSVPKQKILVIINRTQD
FNNLEINNYENIVRMINNRLWTDVIFHHFTSVENVIINLRQINYFTIISI
LNDPDVNARLINQVYLAHLMVWRYQWIIVDLLGGFNYLSTPDYGQGVLSN
NVTIITFGQNGYSGRSILLQAAFNLTILLKCSSQTGIKNTLTGDFNGSNR
TTFLFNIIQNPGIQNKSMGYMKFDRLAKSVTSQAKLSYINLIYSYNLSAS
NLLATGFRIGYIEYPPFSFISNGSYTGFTVELLNSVLKDFNIIPTYVPLP
IKNVGNYISSNYSFSGVLGYVQNGTIDTVSAPIILTINRLTYFDFATNAL
SGNIVGAYKSSKKVGMDALSYYINPFEWPIWATLLCSSAATAIGLAITDY
MYPDKYARYKLLMSVFFSFSSLTHGAYFDPPRRVGGRVLMCFWWLYCLFV
VVIWVSNYAALLAKTFTTTQLTSFSDILNQNDYKYTTVNDDLLNSFLKNN
AYPDPQTIYRIMNEETPNGTVNTLEDAISMIPLNYIILYDDRTLYYQSTK
NCLTMFGKFVYFDYGVVLPKFSEKTLVISTKLRQYRAQGKTSVLIEKYWP
NQFQSCNGSDVPNIIAQWLSSIIKYPLPTSFDINIMIGVFVIVVVGGVAA
MILAVIEKLIRFCVLKTQERRDKYKYETTVEQLTAF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR001638Solute-binding_3/MltF_N
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 463..757
e-value: 1.3E-54
score: 187.4
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 453..664
e-value: 1.3E-54
score: 187.4
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 373..704
e-value: 1.3E-54
score: 187.4
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 289..760
NoneNo IPR availablePANTHERPTHR18966:SF354coord: 289..760
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 357..701
NoneNo IPR availableTMHMMTMhelixcoord: 511..528
NoneNo IPR availableTMHMMTMhelixcoord: 733..755
NoneNo IPR availableTMHMMTMhelixcoord: 476..498
NoneNo IPR availableTMHMMTMhelixcoord: 538..560
NoneNo IPR availableTMHMMTMhelixcoord: 2..24
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 556..704
e-value: 7.1E-12
score: 46.7
IPR001638Solute-binding protein family 3/N-terminal domain of MltFPFAMPF00497SBP_bac_3coord: 358..555
e-value: 3.2E-9
score: 36.6