leucine rich repeat and fibronectin type III domain containing-1

Overview
Nameleucine rich repeat and fibronectin type III domain containing-1 (AFJ24843.1)
Smed IDSMED30035118
Length (bp)1934
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of leucine rich repeat and fibronectin type III domain containing-1 (SMED30035118) t-SNE clustered cells

Violin plots show distribution of expression levels for leucine rich repeat and fibronectin type III domain containing-1 (SMED30035118) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of leucine rich repeat and fibronectin type III domain containing-1 (SMED30035118) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for leucine rich repeat and fibronectin type III domain containing-1 (SMED30035118) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035118

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30035118h1SMcG0002498 dd_Smed_v4_10393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035118h1SMcG0002498 dd_Smed_v4_10393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035118h1SMcG0002498 dd_Smed_v4_10393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035118h1SMcG0002498 dd_Smed_v6_10393_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Human
Match: LRFN5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20360])

HSP 1 Score: 57.3806 bits (137), Expect = 5.282e-8
Identity = 60/272 (22.06%), Postives = 106/272 (38.97%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         +        +F  +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +  +++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC---------ASPPLLTGRYFWSIPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQIVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Human
Match: LRFN5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20360])

HSP 1 Score: 57.3806 bits (137), Expect = 5.411e-8
Identity = 60/272 (22.06%), Postives = 106/272 (38.97%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         +        +F  +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +  +++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC---------ASPPLLTGRYFWSIPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQIVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Human
Match: LRFN5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20360])

HSP 1 Score: 57.3806 bits (137), Expect = 7.789e-8
Identity = 60/272 (22.06%), Postives = 106/272 (38.97%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         +        +F  +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +  +++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC---------ASPPLLTGRYFWSIPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQIVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 50.447 bits (119), Expect = 2.541e-6
Identity = 27/79 (34.18%), Postives = 42/79 (53.16%), Query Frame = 3
Query:  945 PSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLS 1181
            PS   E  +++K L +  N IE+L     Q  P L+ L +  N+I HL P   N     +  +L+ N LHC+C++ WL+
Sbjct:  102 PSGAFEDLENLKYLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLA 180          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Human
Match: PXDN (peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966])

HSP 1 Score: 51.9878 bits (123), Expect = 3.138e-6
Identity = 54/213 (25.35%), Postives = 84/213 (39.44%), Query Frame = 3
Query:  867 DLSKFSILYLYC-ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEV-PIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIW 1499
            DL     LYLY  E+  ++     G            ++ L +  N IE+L     Q  P L+ L +  N+I HL P   N     +  +L+ N LHC+C++ WL+   K+           Y  S  +++              + IC  PR  I   S A + P +L     ++P    I  +     + S   V   C  EG+P P +IW
Sbjct:  104 DLENLKYLYLYKNEIQSIDRQAFKG---------LASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLADLLKT-----------YAESGNAQA--------------AAICEYPRR-IQGRSVATITPEELNC---ERPR---ITSEPQDADVTSGNTVYFTCRAEGNPKPEIIW 275          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Zebrafish
Match: lingo3a (leucine rich repeat and Ig domain containing 3a [Source:ZFIN;Acc:ZDB-GENE-060503-54])

HSP 1 Score: 60.077 bits (144), Expect = 5.382e-9
Identity = 64/268 (23.88%), Postives = 105/268 (39.18%), Query Frame = 3
Query: 1044 HLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDF--PRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIW-SDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEG--ISFALLNLVSKRVDMSIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICI 1832
             ++LL++S N +  L+    +     E  +++GNPL C+C++ W+  R K+   D   P C         S ST +D   F     D   C  P                      K  N    +K   L     Q+V   C  EGDPTP + W S +   I T+     I      L +       +  YIC ASN  G    FA L +    +D ++  N +    +   +N+N+     KF   +  + ++ T M  I+++ + +
Sbjct:  321 QIRLLNLSNNGLVTLEEGSFHSVNTLETLRVDGNPLSCDCRLLWILQRRKTLNFDGKSPVCTAPVEVRGKSLSTFTDSALF-----DHFTCQRP----------------------KIRN----RKLQQLTAREGQVVSFVCRAEGDPTPVIFWISPQRRRITTKSTGRVIVLPEGTLEIRYAQVTDTGTYICIASNAGGNDTYFATLTVSGLPLDSALSANRTYYVGDLNDTNLNDTRVFLKFTLDLKTILVS-TAMGCIMFLGVVL 556          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Zebrafish
Match: lrfn1 (leucine rich repeat and fibronectin type III domain containing 1 [Source:NCBI gene;Acc:393587])

HSP 1 Score: 59.6918 bits (143), Expect = 6.997e-9
Identity = 70/292 (23.97%), Postives = 111/292 (38.01%), Query Frame = 3
Query:  822 RKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            R L+L N+Q      + S F       E  DL    +  T P        ++ +L +  N I+ +      +   L  LD++ N+++ L PD   LF   ++                 GNPLHCNC++ WL  R  ++  D   C         +      D +F  +  +  IC PP      I+K +                  V K Y +     Q V L C+  GDP P + W    G  L  + S  I + +  L + +     S  + C ASN  GI+ A +++
Sbjct:  126 RHLILGNNQI--HHIEESSFDEFVATIEDLDLSYNNLR-TLPWEAIARMTNINTLTLDHNLIDHIGVGTFTLLTKLVRLDMTSNRLQTLPPD--TLFQHAQVLSEPKTSSSSRLTVSFGGNPLHCNCELLWL--RRLTREDDLETC---------ASPEHLMDKYFWSIQEEEFICEPPL-----ITKHQ------------------VTKPYVM---EGQGVTLKCKAMGDPDPAIHWRFPDGK-LVHNNSRTILYDNGTLDILITTLKDSGAFNCVASNAAGIATAAVHV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Zebrafish
Match: lrfn1 (leucine rich repeat and fibronectin type III domain containing 1 [Source:NCBI gene;Acc:393587])

HSP 1 Score: 59.6918 bits (143), Expect = 6.997e-9
Identity = 70/292 (23.97%), Postives = 111/292 (38.01%), Query Frame = 3
Query:  822 RKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            R L+L N+Q      + S F       E  DL    +  T P        ++ +L +  N I+ +      +   L  LD++ N+++ L PD   LF   ++                 GNPLHCNC++ WL  R  ++  D   C         +      D +F  +  +  IC PP      I+K +                  V K Y +     Q V L C+  GDP P + W    G  L  + S  I + +  L + +     S  + C ASN  GI+ A +++
Sbjct:  126 RHLILGNNQI--HHIEESSFDEFVATIEDLDLSYNNLR-TLPWEAIARMTNINTLTLDHNLIDHIGVGTFTLLTKLVRLDMTSNRLQTLPPD--TLFQHAQVLSEPKTSSSSRLTVSFGGNPLHCNCELLWL--RRLTREDDLETC---------ASPEHLMDKYFWSIQEEEFICEPPL-----ITKHQ------------------VTKPYVM---EGQGVTLKCKAMGDPDPAIHWRFPDGK-LVHNNSRTILYDNGTLDILITTLKDSGAFNCVASNAAGIATAAVHV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Zebrafish
Match: CABZ01060891.1 (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 [Source:NCBI gene;Acc:100151059])

HSP 1 Score: 59.6918 bits (143), Expect = 8.655e-9
Identity = 67/276 (24.28%), Postives = 114/276 (41.30%), Query Frame = 3
Query: 1044 HLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRD--FPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNV---------SSVYICTASNIEG--ISFALLNLVSKRVDMSIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICI 1832
             +++L++S N +  L+    +     E  +++GNPL C+C++ W+  R ++   D   P C           S  +D   F     D   C  P                      K  N    +K   ++++  Q V   C  EG+PTP +IW   + P   R  S     S+ R+TV L G  +         S  YIC ASN  G    FA L +  + VD +I  N S+ A +   + +N+     KF   ++ + ++ T M  I+++ + +
Sbjct:  321 QIRVLNLSNNDLVTLEESSFHSVNSLETLRVDGNPLSCDCRLLWILQRRRTLNFDGKMPVCAGPPEVQGYLLSMFTDSALF-----DYFTCQKP----------------------KIRN----RKMQQVMVHEGQPVSFLCRAEGEPTPAIIW---ISPQRRRITS----KSNGRVTV-LPGGTLEIRYAQLTDSGTYICIASNAGGNDTYFATLTVKGQPVDAAIFSNRSMYAMDFNETGLNSTRVFLKFTLDLTTILVS-TAMGCIMFLGVVL 556          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Zebrafish
Match: si:cabz01090165.1 (si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017-71])

HSP 1 Score: 59.6918 bits (143), Expect = 9.096e-9
Identity = 59/244 (24.18%), Postives = 93/244 (38.11%), Query Frame = 3
Query:  975 VKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPIL--TRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            V +L +  N IE +   I      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C         +   +    +F  +  +  +C PP                            I +    + +   Q V L C + GDP P + W    G ++  T     + N S + LT  ++ S    V+ C ASN  G + A + LV
Sbjct:  177 VNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL--RRLTREDDLETC---------ASPRELAGKYFWTIREEEFVCEPPM---------------------------ITRHTSKMFVMEGQEVSLRCRSVGDPEPIVHWISPDGKLIANTSRTVCYDNGSLDILTATVKDSG---VFTCIASNAAGEATAPVELV 377          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Xenopus
Match: LRFN1 (leucine rich repeat and fibronectin type III domain containing 1, gene 1 [Source:NCBI gene;Acc:100487064])

HSP 1 Score: 63.5438 bits (153), Expect = 8.759e-10
Identity = 60/253 (23.72%), Postives = 100/253 (39.53%), Query Frame = 3
Query:  963 PFQHVKSLIVKSNSIESLHNSIDQ-------MFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            P++ +  + V  N++   HN ID        M   L  LD++ N++  L PD  NLF ++++                 GNPLHCNC++ WL  R  ++  D   C         +   Q  D +F  +  +  IC PP   +++   A  P  +                         Q V L C+  GDP P++ W    G ++  + +  + H +  L + +     S  + C ASN  G + A + L 
Sbjct:  166 PWEDIGQM-VNLNTLTLDHNLIDHIAEGTFTMLHKLVRLDMTSNQLHKLPPD--NLFLRSQVLANARGSSPSSLAISFGGNPLHCNCELLWL--RRLTREDDLETC---------ASPEQLTDKYFWSIQEEEFICDPP---LITRHYASKPFVM-----------------------EGQSVSLKCKAVGDPEPSIHWIAPDGKLI-HNTTRLVAHDNGSLDIMITTLKDSGSFTCIASNAAGEATAPVELA 377          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Xenopus
Match: ENSXETT00000007893.1 (leucine rich repeat and fibronectin type III domain containing 4 [Source:NCBI gene;Acc:101734445])

HSP 1 Score: 60.077 bits (144), Expect = 1.013e-8
Identity = 83/376 (22.07%), Postives = 150/376 (39.89%), Query Frame = 3
Query:  750 YQLGLLDVQNNLFLDWDFLTVTKS---------RKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLI------VKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTE-------------IFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIW---SDEVGPILTRHPSSHINHSSNRL--TVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDMSIHQNTSVVAFERIISNVNNRNCASKFFAQISE 1778
            Y  G L+   +L LD + LT+            + L++ N+Q +  +  ++ F   +L  E  DL       ++ + +S P++ +++++      +  N IES+          L  LD++ N++  L PD   LF +++             +    GNP HCNC++ WL  R   +  D   C         +  +Q    +F  +  +   C PP                            I +  + L +   Q   L C   GDP P + W    D++ P  +R  +S+ N + + L  T+  +GS     Y C A N  G S A ++L  K + +  H+N   ++  R     ++   +SK  A ++E
Sbjct:   94 YAFGDLESLRSLHLDGNRLTLIHEEALRGMLNLQHLIINNNQLV--TIPVATFDDFHLTLEDLDL-------SYNNLVSVPWEAIQNMVSLHTLNLDHNLIESVMEGTFSELYKLSRLDMTSNRLHTLPPD--PLFVRSQTGVISPTPYTSTIVLNFGGNPFHCNCELLWL--RRLVREDDMETC---------ASPSQLAGRYFWSIPEEEFTCEPPL---------------------------ITRHTHQLWVLEGQRATLKCRAIGDPEPVIHWVSPDDKIMPNSSR-TASYRNGTLDILVTTIRDDGS-----YTCIAINAAGESTAQVDL--KMIPLP-HRNNGSISVLRQDPGSSDITTSSKASANVTE 411          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Xenopus
Match: oaz1 (ornithine decarboxylase antizyme 1 [Source:Xenbase;Acc:XB-GENE-490737])

HSP 1 Score: 52.7582 bits (125), Expect = 1.769e-6
Identity = 54/241 (22.41%), Postives = 90/241 (37.34%), Query Frame = 3
Query:  999 NSIESLHNSIDQM-------FPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            N++   HN ID +          L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C         +   +    +F  +  +  +C PP                            I  +   LV+   Q   L C++ GDP P + W    G +++ + S  +++ +  L +          + C ASN  G S A + L 
Sbjct:  175 NTVGLDHNLIDYVPEGIFSNLHKLARLDMTSNKLKKIPPD--PLFSRIPVYAKSKGSPLTSLVLSFGGNPLHCNCELMWL--RRLTREDDLETC---------ASPAELMGKYFWSIKEEEFVCEPPM---------------------------ITHRTSKLVIMEGQSASLKCKSVGDPDPYVRWISPDGKLVS-NTSRTMSYDNGTLDIITTIYADRGNFTCIASNAAGESTANVELT 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Mouse
Match: Lrfn5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:MGI Symbol;Acc:MGI:2144814])

HSP 1 Score: 56.9954 bits (136), Expect = 7.101e-8
Identity = 62/272 (22.79%), Postives = 108/272 (39.71%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         S +  +   F+S +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +   ++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC--------ASPALLTGRYFWS-IPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQTVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Mouse
Match: Lrfn5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:MGI Symbol;Acc:MGI:2144814])

HSP 1 Score: 56.6102 bits (135), Expect = 8.566e-8
Identity = 63/275 (22.91%), Postives = 109/275 (39.64%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESL---HNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ ++    S+ +L   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         S +  +   F+S +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +   ++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKMV----SLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC--------ASPALLTGRYFWS-IPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQTVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Mouse
Match: Pxdn (peroxidasin [Source:MGI Symbol;Acc:MGI:1916925])

HSP 1 Score: 51.2174 bits (121), Expect = 1.766e-6
Identity = 57/240 (23.75%), Postives = 96/240 (40.00%), Query Frame = 3
Query:  942 FPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEV-PIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNV--------SSVYICTASNIEG 1634
             P+   E  +++K L +  N IE+L     Q  P L+ L +  N+I HL P   +     +  +L+ N LHC+C++ WL+   K+           Y  S  +++  +              C  PR  I   S A + P +L     ++P    I  +     + S   V   C  EG+P P +IW         R+ +     + +RL +  +G+ +          VY C A N+ G
Sbjct:   98 IPNGAFEDLENLKYLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDCEILWLADLLKT-----------YAQSGNAQAAAT--------------CEYPRR-IQGRSVATITPEELNC---ERPR---ITSEPQDADVTSGNTVYFTCRAEGNPKPEIIW--------LRNNNELSMKTDSRLNLLDDGTLMIQNTQEADEGVYQCMAKNVAG 297          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. UniProt/SwissProt
Match: sp|Q6PGX3|LRFN1_DANRE (Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Danio rerio OX=7955 GN=lrfn1 PE=2 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.845e-8
Identity = 70/300 (23.33%), Postives = 112/300 (37.33%), Query Frame = 3
Query:  822 RKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGS--------NVSSVYICTASNIEGISFALLNL 1658
            R L+L N+Q      + S F       E  DL    +  T P        ++ +L +  N I+ +      +   L  LD++ N+++ L PD   LF   ++                 GNPLHCNC++ WL  R  ++  D   C         +      D +F  +  +  IC PP      I+K +                  V K Y +     Q V L C+  GDP P + W         R P   + H+++R  +   G+          S  + C ASN  GI+ A +++
Sbjct:  126 RHLILGNNQI--HHIEESSFDEFVATIEDLDLSYNNLR-TLPWEAIARMTNINTLTLDHNLIDHIGVGTFTLLTKLVRLDMTSNRLQTLPPD--TLFQHAQVLSEPKTSSSSRLTVSFGGNPLHCNCELLWL--RRLTREDDLETC---------ASPEHLMDKYFWSIQEEEFICEPPL-----ITKHQ------------------VTKPYVM---EGQGVTLKCKAMGDPDPAIHW---------RFPDGKLVHNNSRTILYDNGTLDILITTLKDSGAFNCVASNAAGIATAAVHV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. UniProt/SwissProt
Match: sp|A8WGA3|LFN1L_DANRE (Leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein OS=Danio rerio OX=7955 GN=lrfn1l PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 1.007e-7
Identity = 67/307 (21.82%), Postives = 114/307 (37.13%), Query Frame = 3
Query:  966 FQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDL---FFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV----------SKRVDMSIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLM-W 1805
              +V +L +  N IE +   I      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C                DL   +F  +  +  IC PP                            I +K         Q   L C+  GDP P + W    G ++  + S  ++ S+  L + +     + ++ C ASN  G S   + LV          + R+       + ++   +  S+V+N   + +    ++EL+ N  L+ W
Sbjct:  171 LTNVNTLNMDHNLIEHVPLGIFSNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKSKGSPLSSLVLSFGGNPLHCNCELLWL--RRLTREDDLETC------------ASPPDLTAKYFWTIPEEEFICDPP---------------------------VITRKSPKTFAMEGQPTSLKCKANGDPDPDVHWISPEGRLIA-NTSRTLSFSNGSLEINITSLKDTGIFTCIASNAAGESTGTVELVVSPLPHLANSTNRIREPDPGPSDILTSAKSTSSVSNETRSQERKVVLAELSANSALIRW 433          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. UniProt/SwissProt
Match: sp|D4A1J9|LRFN5_RAT (Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.940e-7
Identity = 62/272 (22.79%), Postives = 108/272 (39.71%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         S +  +   F+S +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +   ++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC--------ASPALLTGRYFWS-IPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQTMDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. UniProt/SwissProt
Match: sp|Q96NI6|LRFN5_HUMAN (Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LRFN5 PE=1 SV=2)

HSP 1 Score: 57.3806 bits (137), Expect = 3.740e-7
Identity = 60/272 (22.06%), Postives = 106/272 (38.97%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         +        +F  +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +  +++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC---------ASPPLLTGRYFWSIPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQIVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. UniProt/SwissProt
Match: sp|Q8BXA0|LRFN5_MOUSE (Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus OX=10090 GN=Lrfn5 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.967e-7
Identity = 62/272 (22.79%), Postives = 108/272 (39.71%), Query Frame = 3
Query:  903 ELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            ++F LE + +      TI  P+  V+ + V  +++   HN ID +    F HL     LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         S +  +   F+S +  +  +C PP                            I +  + + +   Q   L C+  GDP P + W    G +++    S + + +  L + +     +  + C ASN  G +   ++L
Sbjct:  145 DVFALEELDLSYNNLETI--PWDAVEKM-VSLHTLSLDHNMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPD--PLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWL--RRLSREDDLETC--------ASPALLTGRYFWS-IPEEEFLCEPPL---------------------------ITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV-YDNGTLDILITTVKDTGAFTCIASNPAGEATQTVDL 372          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. TrEMBL
Match: I1ZII9 (Leucine rich repeat and fibronectin type III domain containing-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 455/458 (99.34%), Postives = 456/458 (99.56%), Query Frame = 3
Query:  480 KLPIQRLRNIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDM-SIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL 1850
            KLPIQRLRNIFF+SENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSL VKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDM SIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL
Sbjct:    1 KLPIQRLRNIFFKSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLTVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDMSSIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL 458          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. TrEMBL
Match: T1DF80 (LRFN-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 6.401e-170
Identity = 257/530 (48.49%), Postives = 366/530 (69.06%), Query Frame = 3
Query:  171 LEFCICGYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNS-NLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHP--SSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDMSIHQNTSVVAFERIISNVNNRNCA 1751
            + FC   YFS+  C G+ E  YYDI C+D   FP DLP +TEKLT+ C +N + S   ++ +  ++ +Q +SL SI  ++CPI  + EKLF+   YL SVTL+ LP++ LRNIFF+S NL+EL L NL+NLE+ID H+L++Q  FSR+   N T+  + L+ +L P++ +I+E  + +   +I+ +    F  Y+LGLLD+ NN   +W+FL  TKSRK+LLKN+ +  S+F LSK++ L  + ++ DLENIGI G FPS IS+P   +K+L VKSN I+SL+++IDQMFP+L   DIS N+IKHLQ  LNN FYKTE FKLEGNPLHCNC++RWL ARYKSKI+DFPRC+FG++ S +++      D++FSQL+TDSL C PP  P+LSISK +     TV+  D   N S + K+YTLVM+ +Q ++L+CET GDP PTL WS++ G +L R     +  N + N +TVGL  S  S VY+CTASNIEG+SFAL+N++S ++    +    + + E++++  N++N A
Sbjct:   18 ITFCY-KYFSSKNCEGFEENGYYDINCRDCETFPEDLPLSTEKLTLSCPSNVNDSTVGLTALNSRDFEQLESLNSIIIKSCPIETISEKLFSKKEYLGSVTLENLPLRHLRNIFFKSSNLIELSLINLYNLEYIDSHILENQNKFSRLKLKNVTISTDVLQTVLSPIKNTIRELSWTDVNHQILVIQPMLFSSYKLGLLDLSNNKIENWNFLIYTKSRKILLKNTVSYTSNFLLSKYASLPQFTQVLDLENIGIFGQFPSNISKPMIFLKTLNVKSNLIDSLNDNIDQMFPNLLFFDISLNRIKHLQSKLNNFFYKTEYFKLEGNPLHCNCEIRWLFARYKSKIQDFPRCHFGFKKSESINNRNSLKDIYFSQLSTDSLACFPPLPPVLSISKGKKSTMFTVNSTDPQTNSSTISKQYTLVMDPHQRIDLSCETLGDPIPTLTWSNKKGKVLHRSVLNITTFNSAVNTVTVGLSASEKSLVYMCTASNIEGVSFALVNIISTKIQEPQNAGLVLESNEKVLTKSNSKNIA 546          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. TrEMBL
Match: A0A0X3NMB8 (Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Schistocephalus solidus OX=70667 GN=LRFN4 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.235e-24
Identity = 131/554 (23.65%), Postives = 234/554 (42.24%), Query Frame = 3
Query:  132 KTNFVLFIVFNYLLEFCICGYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLR-NIFFQSENLVELVLTNLFNLEHIDFHLLDSQRS-FSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALK----SSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLH----NSIDQMFPHLQLLDISYNKIKHLQPDLNN----LFYKTEI-FKLEGNPLHCNCQVRWLSA-----RYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQL-----------ATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEV-GPILTRH-------PSSHINHSS-----NRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            KT  +LF++  Y     I G    +Y      E    + C +P E P+ LP+TT  L + C  N +   ++I Q+          L       CPI  L    F     L+ + +D   +  LR ++F  +    E+ ++N   L+ +       + S    ++  NT+V  E +  +L     ++ E     +++ I  L    F   +L  LD+ +N+  D D L  T+S +L+L  S+  +      F     S++ L      L+++ +    P+        + SLIV  N IESL       +D+  P L  LD+  N+I  L  +L+     L   +++  +L GNP HCNC++ WL+      R  + + +  RC        L+ +T ++   ++Q+            +  L+C+PP  P             T+  +    ++   + +YT+    N+ + L C + GDP P L W +   G +L R+       PS+H N  S      +L   L  + +    +C A N+ G+S A ++++
Sbjct:    7 KTVVILFLLSCYPPAHGISGSCMQAY-----SEKGIRVHCINPTEIPKGLPETTTDLVLSCNINGTTDAEVIKQIPADSFATLPCLEHFETAGCPIEQLDGGAFRGVKNLKRLVIDDAALNELRIDLFNPNGTFEEISISNCPLLKSLLPDPTTGKLSELQVLLLVNTSVPVEQITRLLASAGDALGEVTVSKHQLRIDSLGAADFA-LKLEKLDMSDNVIEDLDLLRRTESTELILAGSRFTRILRMDGFRTLAGSLVRLDASRTSLKSLRL-ADAPALGLPEMPRLTSLIVHDNLIESLPWEYLEELDRWTPSLLELDLRNNQITTLPAELSKSHEALIRLSKLDIRLAGNPFHCNCELTWLNGEQNGTRLPADVLEKIRCMI----PCLTVATFTEGTGYAQIIMPRSLNEVAAQSSGLVCMPPTRP-------------TIYLRSTTRSLEGSEDQYTVRTGDNKRLVLECISSGDPPPRLYWREAANGRVLGRNTVTERRGPSAH-NFPSRLSIDEKLVRRLRTTTIE--VVCEAHNMLGVSSARVSVI 533          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. TrEMBL
Match: A0A267G4B5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034245g1 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.035e-20
Identity = 109/426 (25.59%), Postives = 176/426 (41.31%), Query Frame = 3
Query:  276 DLPKTTEKLTIICLNN-SSKSRKI-----ISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFFQ-SENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPV-RRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILY-LYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKI------KHLQPDLNNLFYK---TEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIW 1499
             LP  T +L ++CL   SS  R +     +S ++    ++   L  IS ++CPI  LP  LF + P L SVTLD +    L    FQ S+++ EL+L            LL        +      ++ E L  +LK    R ++    I      ++L       + L  L + NN   D+ FL    + ++ L  ++A     +L   SI       L  LE+ G++   PS +S  F  +  L + SN I+ L  S       L  LD+S N+I      + LQP L+ + Y+   +    L  NP+HCNC++ W        I D P  +         +S Q       +L    L C PP  P +++         + +G+ +  N +++       +   + V L C +  DP P L W
Sbjct:   56 SLPAWTVRLYLLCLPRLSSGGRPLPLGPALSALSPGVFRRLVELREISIRSCPIGALPAGLFAHLPALTSVTLDNMLFTSLPPGLFQGSQSIAELILQRCHEYTSQTPALLVDTPRLRLLKLIEVGLNGEQLDNLLKSAPTRMMQTLEVIMTLYPPLRLSGATLSAFSLTSLSLSNNGITDFAFLPSVGAAEVTLSYNRAPLGRIELETSSIQPNRRVTLLRLEHSGLN-EIPSFLSVVFPELAELNLASNIIQQLEPSRLANLSRLVRLDLSGNQIQTLSDWRRLQPLLSAILYRDRQSGHIYLAENPIHCNCELSW--------IYDNPILSSSLLRDLTCQSGQFVGQLLVRLQKHQLRCRPPTVPDVTLQYWPAIFTSSDAGEPRVANETVILPGQQCNLTRRRNVTLTCSSSADPAPGLAW 472          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. TrEMBL
Match: A0A183TGI1 (Ig-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS15579 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.586e-19
Identity = 120/508 (23.62%), Postives = 214/508 (42.13%), Query Frame = 3
Query:  273 RDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLR-NIFFQSENLVELVLTNLFNLEHIDFHLLDSQRS-FSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALK----SSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLH----NSIDQMFPHLQLLDISYNKIKHLQPDLNN------LFYKTEIFKLEGNPLHCNCQVRWLSA-----RYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQL-----------ATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEV-GPILTRH-------PSSHINHSS-----NRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            R LP+TT  L + C  N +   ++I Q+          L       CPI  L    F     L+ + +D   +  LR ++F  +    E+ ++N   L+ +       + S    ++  NT+V  E +  +L     ++ E     +++ I  L    F   +L  LD+ +N+  D D L  T+S +L+L  S+  +      F     S++ L      L+++ +    P+        + SLIV  N IESL       +D+  P L  LD+  N+I  L  +L+          K +I +L GNP HCNC++ WL+      R  + + +  RC        L+ +T ++   ++Q+            +  L+C+PP  P             T+  +    ++   + +YT+    N+ + L C + GDP P L W +   G +L R+       PS+H N  S      +L   L  + +    +C A N+ G+S A ++++
Sbjct:   15 RGLPETTTDLVLSCNINGTTDAEVIKQIPADSFATLPCLEHFETAGCPIEQLDGGAFRGVKNLKRLVIDDAALNELRIDLFNPNGTFEEISISNCPLLKSLLPDPTTGKLSELQVLLLVNTSVPVEQITRLLASAGDALGEVTVSKHQLRIDSLGAADFA-LKLEKLDMSDNVIEDLDLLRRTESTELILAGSRFTRILRMDGFRTLAGSLVRLDASRTSLKSLRL-ADAPALGLPEMPRLTSLIVHDNLIESLPWEYLEELDRWTPSLLELDLRNNQITTLPAELSKSHEALIRLSKLDI-RLAGNPFHCNCELTWLNGEQNGTRLPADVLEKIRCMI----PCLTVATFTEGTGYAQIIMPRSLNEVAAQSSGLVCMPPTRP-------------TIYLRSTTRSLEGSEDQYTVRTGDNKRLVLECISSGDPPPRLYWREAANGRVLGRNTVTERRGPSAH-NFPSRLSIDEKLVRRLRTTTIE--VVCEAHNMLGVSSARVSVI 499          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Cavefish
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:103039926])

HSP 1 Score: 62.7734 bits (151), Expect = 7.748e-10
Identity = 60/244 (24.59%), Postives = 94/244 (38.52%), Query Frame = 3
Query:  975 VKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPIL--TRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            V +L +  N IE +   I      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C         +   +    +F  +  +  +C PP                            I +    + +   Q V L C + GDP PT  W    G ++  T   ++  N S + LT  ++ S    V+ C ASN  G + A + LV
Sbjct:  174 VNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL--RRLTREDDLETC---------ASPKELAGKYFWTIREEEFVCEPPM---------------------------ITRHTSKMFVMEGQEVSLRCRSVGDPEPTTHWVSPDGKLIGNTSRTTAFENGSLDILTATVKDSG---VFTCIASNAAGEATAPVELV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Cavefish
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:103039926])

HSP 1 Score: 62.3882 bits (150), Expect = 1.141e-9
Identity = 60/244 (24.59%), Postives = 94/244 (38.52%), Query Frame = 3
Query:  975 VKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPIL--TRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            V +L +  N IE +   I      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C         +   +    +F  +  +  +C PP                            I +    + +   Q V L C + GDP PT  W    G ++  T   ++  N S + LT  ++ S    V+ C ASN  G + A + LV
Sbjct:  174 VNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL--RRLTREDDLETC---------ASPKELAGKYFWTIREEEFVCEPPM---------------------------ITRHTSKMFVMEGQEVSLRCRSVGDPEPTTHWVSPDGKLIGNTSRTTAFENGSLDILTATVKDSG---VFTCIASNAAGEATAPVELV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Cavefish
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:103039926])

HSP 1 Score: 62.3882 bits (150), Expect = 1.141e-9
Identity = 60/244 (24.59%), Postives = 94/244 (38.52%), Query Frame = 3
Query:  975 VKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPIL--TRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            V +L +  N IE +   I      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C         +   +    +F  +  +  +C PP                            I +    + +   Q V L C + GDP PT  W    G ++  T   ++  N S + LT  ++ S    V+ C ASN  G + A + LV
Sbjct:  174 VNTLSLDHNLIEFVPEGIFSNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL--RRLTREDDLETC---------ASPKELAGKYFWTIREEEFVCEPPM---------------------------ITRHTSKMFVMEGQEVSLRCRSVGDPEPTTHWVSPDGKLIGNTSRTTAFENGSLDILTATVKDSG---VFTCIASNAAGEATAPVELV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Cavefish
Match: lrfn1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like [Source:NCBI gene;Acc:103039500])

HSP 1 Score: 62.003 bits (149), Expect = 1.563e-9
Identity = 72/303 (23.76%), Postives = 113/303 (37.29%), Query Frame = 3
Query:  822 RKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK--------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYT--LVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGS--------NVSSVYICTASNIEGISFALLNL 1658
            R L+L N+Q  +   D S F       E  DL    +  T P        ++ +L +  N I+ +      +   L  LD++ N+++ L PD  +LF   ++                  GNPLHCNC++ WL  R  ++  D   C         +   Q  D +F  +  +  IC PP                            I+K   T   VM   Q V L C+  GDP P + W         R P   + H+++R  +   G+          S  + C ASN  GI+ A +++
Sbjct:  126 RHLILGNNQIHQ--IDPSSFDEFVSTIEDLDLSYNNLR-TLPWEAIARMTNINTLTLDHNLIDHIGAGTFTLLTKLVRLDMTSNRLQKLPPD--SLFQHAQVLSDPKGFSSSSRLTVSFGGNPLHCNCELLWL--RRLTREDDLETC---------ASPDQLMDKYFWSIQEEEFICEPPL---------------------------IIKHHSTKPYVME-GQGVTLKCKAMGDPDPAIHW---------RFPDGKLVHNNSRTILYDNGTLDILITTLKDSGAFNCVASNAAGIATAAVDI 375          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Cavefish
Match: lrfn5a (leucine-rich repeat and fibronectin type-III domain-containing protein 5 [Source:NCBI gene;Acc:103028306])

HSP 1 Score: 58.9214 bits (141), Expect = 1.440e-8
Identity = 53/252 (21.03%), Postives = 97/252 (38.49%), Query Frame = 3
Query:  963 PFQHVKSLI------VKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            P++ ++ +I      +  N IE +      +   L  LD++ NK++ L PD   LF + ++                 GNPLHCNC++ WL  R  S+  D   C         +        +F  +  +  +C PP                            I +  + + +   Q V L C+  GDP P + W    G +++ + S  + +++  L + +     S  + C +SN  G +   ++LV
Sbjct:  163 PWEAIQRMISLHTLSLDHNMIEYIPEGTFSLLQKLNRLDVTSNKLQKLPPD--PLFQRAQVLATSGVLNPSSFALSFGGNPLHCNCELLWL--RRLSREDDLETC---------ATPPHLSGRYFWSIPEEEFLCEPPL---------------------------ITRYSHEMRVLEGQRVALKCKARGDPEPAIHWISPEGKLVS-NSSRAVVYNNGTLDILISTVKDSGSFTCISSNPAGEAHQTVDLV 373          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Sea Lamprey
Match: lrfn5a (leucine rich repeat and fibronectin type III domain containing 5a [Source:ZFIN;Acc:ZDB-GENE-080327-17])

HSP 1 Score: 53.9138 bits (128), Expect = 8.041e-8
Identity = 59/248 (23.79%), Postives = 96/248 (38.71%), Query Frame = 3
Query:  987 IVKSNSIESL---HNSIDQM----FPHLQ---LLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQS-DDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNL 1658
            I K  S+ +L   HN ID +    F HL     LD++ NK++ L PD   LF + ++F                GNPLHCNC++ WL  R  ++  D   C           S Q+    +F  +  +  +C PP                            I +  + L++   Q   L C+  GDP P + W      +++ + +  + H +  L + +  +     + C ASN  G S   + L
Sbjct:  168 IQKMTSLHTLSLDHNMIDYIEAGTFSHLHKLARLDMTSNKLQKLPPD--PLFTRLQLFANKGIHHTPPLVLNFGGNPLHCNCELLWL--RRLTREDDLETC----------ASPQALVGKYFWSIPEEEFVCEPPL---------------------------ITRHTHRLLVLEGQRATLKCKAIGDPDPWVHWISPDEKVIS-NTTRTVVHDNGTLEILVTTTKDDGTFTCIASNPAGESTTFVEL 373          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000078.1 (pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-1 gene:ENSPMAG00000000071.1 transcript:ENSPMAT00000000078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 7.838e-7
Identity = 68/264 (25.76%), Postives = 105/264 (39.77%), Query Frame = 3
Query:  456 YLQSVTLDKLPIQ---RLRNIFFQSENLVELVLTNLFNLEHIDF----HLLDSQRSFSRI---VFDNTT------VDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSK 1199
            YL    L++ P      LR +  Q EN +E+V   +  LE   F    HL D+  S + I    F  T       +   +L  + + + R ++E R  +NRI   ++P R F     G L   + L LD + L                 +S   S FS L    EL    N+    T P+ +  P   ++ LI++ N I  L   +      LQ +D+S N ++ L     N            NP HC+C + WL    +S+
Sbjct:   69 YLYDNQLEEFPAHLPPNLRELHLQ-ENNIEVVPGAV--LERTPFLEKLHLNDNSVSSAGIEPATFHGTPRLKLLFLSRNHLSSVPRGLPRGLEELRLDDNRIS--RIPDRIF-----GQLTYLSRLALDGNILG---------------DASISASSFSGLPSLTELSLARNVLT--TVPTHL--PMLGLQKLILQDNQISRLPPGVFYGLKQLQRIDLSGNGLRSLSQGSFNGLESLSHLSACNNPWHCDCGLTWLRNWLRSR 303          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Medaka
Match: lrfn1 (leucine rich repeat and fibronectin type III domain containing 1 [Source:NCBI gene;Acc:101167138])

HSP 1 Score: 67.3958 bits (163), Expect = 3.376e-11
Identity = 81/345 (23.48%), Postives = 131/345 (37.97%), Query Frame = 3
Query:  675 RSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQ---ALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            RS++      NR+ I+K       D+  GL+++                R L+L N+Q      +SFD    +I     E  DL N  + G  P        ++ +L +  N I+ +      +   L  LD++ N+++ L PD  +LF   ++                 GNPLHCNC++ WL  R  ++  D   C         +      D +F  +  +  IC PP      I+K                   +  K Y +     Q V L C+  GDP P + W    G  L  + S  I + +  L + +     +  Y C ASN  GI+ A + + 
Sbjct:   99 RSLRALHMDGNRLNIIKS------DHFKGLINL----------------RHLILGNNQIHEVASTSFDEFVSTI-----EDLDLSNNNLRG-LPWEAIARMSNINTLTLDHNLIDHIEAGTFTLLTKLVRLDMTSNRLQKLPPD--SLFQHAQVLSEVKGSSSSTLAVSFGGNPLHCNCELLWL--RRLTREDDLETC---------ASPEHLMDKYFWSIQEEEFICEPPL-----ITK------------------HVASKSYVM---EGQGVTLKCKAVGDPDPFIHWQSPDGK-LVHNNSRTILYDNGTLDILISTLKDNGAYNCVASNAAGIATAAVEIT 375          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Medaka
Match: ENSORLT00000019143.2 (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 [Source:NCBI gene;Acc:101172023])

HSP 1 Score: 59.3066 bits (142), Expect = 1.003e-8
Identity = 59/256 (23.05%), Postives = 98/256 (38.28%), Query Frame = 3
Query:  945 PSTISEPFQ-----HVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRD--FPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIW-SDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEG--ISFALLNLVSKRVDMS 1682
            P T  EP+       +K LI+ S  + ++          +++L+ S N ++ L+    +     E  +++ NPL C+C++ W+  R K+   D   P C        +S S  +D   F     D   C  PR                             +K   +V N  Q V   C  +G+PTP ++W S +   I ++ P       S  L +       +  YIC ASN  G    FA L +  + +D +
Sbjct:  298 PITTLEPWAFKDLLRLKELIMVSTGLVTVGPHALGGLRQIRVLNFSSNDLQTLEESSFHSVNSLETLRVDENPLLCDCRLLWILQRRKTLNFDGRVPVCAGPVEVQGVSLSAFTDSALF-----DHFTCQKPRIR--------------------------NRKMQKVVANEGQAVSFLCRADGEPTPAIVWISPQRRRITSKTPGRITVLPSGTLEIRFAKLTDTGTYICIASNAGGNDTYFATLTVHGQPMDAA 522          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Medaka
Match: si:cabz01090165.1 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:101172994])

HSP 1 Score: 58.9214 bits (141), Expect = 1.334e-8
Identity = 56/242 (23.14%), Postives = 91/242 (37.60%), Query Frame = 3
Query:  975 VKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            V +L +  N IES+   I      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C         +        +F  +  +  +C PP                            I +    + +   Q V L C++ GDP P+  W    G ++  + S  + + +  L +       S  + C ASN  G + A + LV
Sbjct:  180 VNTLSLDHNLIESVPEGIFSNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKMKGSPLTALVLSFGGNPLHCNCELVWL--RRVTREDDLETC---------ASPKDLAGKYFWTIREEEFVCEPPM---------------------------ITRHTSKMFVMEGQEVSLRCKSIGDPEPSTHWVSPDGKLIG-NTSRTVCYENGSLDILKASVKDSGKFTCIASNAAGEATAPVELV 380          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Medaka
Match: zgc:172282 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:101174935])

HSP 1 Score: 58.151 bits (139), Expect = 2.226e-8
Identity = 77/328 (23.48%), Postives = 123/328 (37.50%), Query Frame = 3
Query:  726 LPKRFFLDYQLGLLDVQNN---LFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLV 1661
            LP  F    +L  L + +N   +  D  F  +T  R L+L N+Q    S     F       E  DL    +      TI     +V +L +  N IE++   +      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C      S+LS        +F  +  +  IC PP                            + ++    V+   Q   L C+  GDP P + W    G +++ + S  +   +  L + +     S  + C ASN  G S   + +V
Sbjct:   91 LPSAFSDLRRLRALHLDSNRITVIKDEHFKGLTNLRHLILANNQL--HSISPHAFDDFLSTLEDLDLSYNNLIQVPWETIGH-LTNVNTLNMDHNLIENVPQGVFTNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKSKGSPLSSLVLSFGGNPLHCNCELLWL--RRLTREDDLETC---ASPSDLSAK------YFWTIPEEEFICDPP---------------------------VLTRRSPLTVIMEGQPASLKCKANGDPEPEVHWISPEGRLIS-NGSKTLVFPNGSLEINVTSQKDSGNFTCIASNAAGESTGRVEVV 374          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Medaka
Match: zgc:172282 (leucine-rich repeat and fibronectin type III domain-containing protein 1-like protein [Source:NCBI gene;Acc:101174935])

HSP 1 Score: 58.151 bits (139), Expect = 2.444e-8
Identity = 78/332 (23.49%), Postives = 124/332 (37.35%), Query Frame = 3
Query:  726 LPKRFFLDYQLGLLDVQNN---LFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFK-------------LEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRV 1673
            LP  F    +L  L + +N   +  D  F  +T  R L+L N+Q    S     F       E  DL    +      TI     +V +L +  N IE++   +      L  LD++ NK+K + PD   LF +  ++                GNPLHCNC++ WL  R  ++  D   C      S+LS        +F  +  +  IC PP                            + ++    V+   Q   L C+  GDP P + W    G +++ + S  +   +  L + +     S  + C ASN  G S   + +V   V
Sbjct:   91 LPSAFSDLRRLRALHLDSNRITVIKDEHFKGLTNLRHLILANNQL--HSISPHAFDDFLSTLEDLDLSYNNLIQVPWETIGH-LTNVNTLNMDHNLIENVPQGVFTNLHKLARLDMTSNKLKKIPPD--PLFLRIPVYAKSKGSPLSSLVLSFGGNPLHCNCELLWL--RRLTREDDLETC---ASPSDLSAK------YFWTIPEEEFICDPP---------------------------VLTRRSPLTVIMEGQPASLKCKANGDPEPEVHWISPEGRLIS-NGSKTLVFPNGSLEINVTSQKDSGNFTCIASNAAGESTGRVEVVVTAV 378          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Planmine SMEST
Match: SMESG000045027.1 (SMESG000045027.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 570/574 (99.30%), Postives = 571/574 (99.48%), Query Frame = 3
Query:  132 KTNFVLFIVFNYLLEFCICGYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDM-SIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL 1850
            KTNFVLFIVFNYLLEFCI GYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFF+SENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSL VKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDM SIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL
Sbjct:    3 KTNFVLFIVFNYLLEFCIGGYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFFKSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLTVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDMSSIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL 576          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Planmine SMEST
Match: SMESG000045027.1 (SMESG000045027.1)

HSP 1 Score: 1150.96 bits (2976), Expect = 0.000e+0
Identity = 570/574 (99.30%), Postives = 571/574 (99.48%), Query Frame = 3
Query:  132 KTNFVLFIVFNYLLEFCICGYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDM-SIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL 1850
            KTNFVLFIVFNYLLEFCI GYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFF+SENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSL VKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDM SIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL
Sbjct:    2 KTNFVLFIVFNYLLEFCIGGYFSTSYCTGYGEEAYYDILCKDPAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLRNIFFKSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLTVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSKRVDMSSIHQNTSVVAFERIISNVNNRNCASKFFAQISELNINETLMWQILYIFICIMNKYYL 575          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Planmine SMEST
Match: SMESG000080200.1 (SMESG000080200.1)

HSP 1 Score: 129.028 bits (323), Expect = 2.413e-31
Identity = 125/484 (25.83%), Postives = 225/484 (46.49%), Query Frame = 3
Query:  249 CKD-PAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLR-NIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLK-NSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLF-YKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKE---YTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPS-SHINHSS---NRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSK 1667
            C D P++   +  K T   TI C  +S+KS  + S + +K +++   LV I   +C +  LP   F +   L++V LD LPI+ L+ N F  S N++EL+L+ L +L+ I    L  Q   + +    + +DP  L+  L  V  ++ +F +  N ++ + + K +F  +    + ++ N   + DFL +  +++L LK N   +K   +   +  L    +  DL   G+    P      F  ++ L + SN I  + + +++  P+LQLLDI  NK+  L P L+ +  YK     L+GN  +CNC++ W+ +    +I+   +C+    N N  +  ++ +L  S++    +IC  P           + ++L+   K     IS+V      Y   +  N L+   C  EG+P P L W      +   +P    +N+ +   N +      +  +  Y+C A +I GIS   L +  K
Sbjct:   35 CSDIPSKEEWERIKNTTIQTIRC-KHSNKSNSL-SDIRMKNLQR---LVYIYIGDCNVQSLPMNFFEDLTQLETVYLDNLPIEILKENTFKNSSNIIELILSGLGSLKRIHPRFLGDQNKLATLTLTKSNIDPTQLRPTLLTVYNTLAKFYWRRN-VQNLIIGKDYFQPFNFESVILEYNGITNTDFLELLNTKELSLKGNPIGIKEKLNWKNYRKLSKSLKKLDLSETGLD-LRPDM---KFPKLEELALSSNGIHQIPSHVEKFLPNLQLLDIRNNKLTTL-PSLDYMLRYKFGKVYLQGNIFNCNCEMIWIRSIEADRIKGL-KCD----NVNFEKHVKNQELTRSRILKSKMICTEPL----------LKLQLSDQFKSYDYTISVVSDTLQIYKFDLYPNHLISWQCIGEGNPAPRLKWIKNQQTLKIENPPLDRLNNKTVMKNLIIPDDIKTADNETYVCRAKSIAGISEIRLEVTKK 492          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Planmine SMEST
Match: SMESG000080200.1 (SMESG000080200.1)

HSP 1 Score: 129.413 bits (324), Expect = 2.487e-31
Identity = 125/484 (25.83%), Postives = 225/484 (46.49%), Query Frame = 3
Query:  249 CKD-PAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLR-NIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLK-NSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLF-YKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKE---YTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPS-SHINHSS---NRLTVGLEGSNVSSVYICTASNIEGISFALLNLVSK 1667
            C D P++   +  K T   TI C  +S+KS  + S + +K +++   LV I   +C +  LP   F +   L++V LD LPI+ L+ N F  S N++EL+L+ L +L+ I    L  Q   + +    + +DP  L+  L  V  ++ +F +  N ++ + + K +F  +    + ++ N   + DFL +  +++L LK N   +K   +   +  L    +  DL   G+    P      F  ++ L + SN I  + + +++  P+LQLLDI  NK+  L P L+ +  YK     L+GN  +CNC++ W+ +    +I+   +C+    N N  +  ++ +L  S++    +IC  P           + ++L+   K     IS+V      Y   +  N L+   C  EG+P P L W      +   +P    +N+ +   N +      +  +  Y+C A +I GIS   L +  K
Sbjct:   82 CSDIPSKEEWERIKNTTIQTIRC-KHSNKSNSL-SDIRMKNLQR---LVYIYIGDCNVQSLPMNFFEDLTQLETVYLDNLPIEILKENTFKNSSNIIELILSGLGSLKRIHPRFLGDQNKLATLTLTKSNIDPTQLRPTLLTVYNTLAKFYWRRN-VQNLIIGKDYFQPFNFESVILEYNGITNTDFLELLNTKELSLKGNPIGIKEKLNWKNYRKLSKSLKKLDLSETGLD-LRPDM---KFPKLEELALSSNGIHQIPSHVEKFLPNLQLLDIRNNKLTTL-PSLDYMLRYKFGKVYLQGNIFNCNCEMIWIRSIEADRIKGL-KCD----NVNFEKHVKNQELTRSRILKSKMICTEPL----------LKLQLSDQFKSYDYTISVVSDTLQIYKFDLYPNHLISWQCIGEGNPAPRLKWIKNQQTLKIENPPLDRLNNKTVMKNLIIPDDIKTADNETYVCRAKSIAGISEIRLEVTKK 539          
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Planmine SMEST
Match: SMESG000080200.1 (SMESG000080200.1)

HSP 1 Score: 128.257 bits (321), Expect = 2.990e-31
Identity = 123/475 (25.89%), Postives = 222/475 (46.74%), Query Frame = 3
Query:  249 CKD-PAEFPRDLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPINDLPEKLFTNFPYLQSVTLDKLPIQRLR-NIFFQSENLVELVLTNLFNLEHIDFHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVKLPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLK-NSQALKSSFDLSKFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNSIDQMFPHLQLLDISYNKIKHLQPDLNNLF-YKTEIFKLEGNPLHCNCQVRWLSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRAPILSISKAEVPIKLTVSGKDKPNNISIVKKE---YTLVMNSNQLVELNCETEGDPTPTLIWSDEVGPILTRHPS-SHINHSS---NRLTVGLEGSNVSSVYICTASNIEGIS 1640
            C D P++   +  K T   TI C  +S+KS  + S + +K +++   LV I   +C +  LP   F +   L++V LD LPI+ L+ N F  S N++EL+L+ L +L+ I    L  Q   + +    + +DP  L+  L  V  ++ +F +  N ++ + + K +F  +    + ++ N   + DFL +  +++L LK N   +K   +   +  L    +  DL   G+    P      F  ++ L + SN I  + + +++  P+LQLLDI  NK+  L P L+ +  YK     L+GN  +CNC++ W+ +    +I+   +C+    N N  +  ++ +L  S++    +IC  P           + ++L+   K     IS+V      Y   +  N L+   C  EG+P P L W      +   +P    +N+ +   N +      +  +  Y+C A +I GIS
Sbjct:   35 CSDIPSKEEWERIKNTTIQTIRC-KHSNKSNSL-SDIRMKNLQR---LVYIYIGDCNVQSLPMNFFEDLTQLETVYLDNLPIEILKENTFKNSSNIIELILSGLGSLKRIHPRFLGDQNKLATLTLTKSNIDPTQLRPTLLTVYNTLAKFYWRRN-VQNLIIGKDYFQPFNFESVILEYNGITNTDFLELLNTKELSLKGNPIGIKEKLNWKNYRKLSKSLKKLDLSETGL-DLRPDM---KFPKLEELALSSNGIHQIPSHVEKFLPNLQLLDIRNNKLTTL-PSLDYMLRYKFGKVYLQGNIFNCNCEMIWIRSIEADRIKGL-KCD----NVNFEKHVKNQELTRSRILKSKMICTEPL----------LKLQLSDQFKSYDYTISVVSDTLQIYKFDLYPNHLISWQCIGEGNPAPRLKWIKNQQTLKIENPPLDRLNNKTVMKNLIIPDDIKTADNETYVCRAKSIAGIS 483          
The following BLAST results are available for this feature:
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRFN55.282e-822.06leucine rich repeat and fibronectin type III domai... [more]
LRFN55.411e-822.06leucine rich repeat and fibronectin type III domai... [more]
LRFN57.789e-822.06leucine rich repeat and fibronectin type III domai... [more]
PXDN2.541e-634.18peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
PXDN3.138e-625.35peroxidasin [Source:HGNC Symbol;Acc:HGNC:14966][more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lingo3a5.382e-923.88leucine rich repeat and Ig domain containing 3a [S... [more]
lrfn16.997e-923.97leucine rich repeat and fibronectin type III domai... [more]
lrfn16.997e-923.97leucine rich repeat and fibronectin type III domai... [more]
CABZ01060891.18.655e-924.28leucine-rich repeat and immunoglobulin-like domain... [more]
si:cabz01090165.19.096e-924.18si:cabz01090165.1 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LRFN18.759e-1023.72leucine rich repeat and fibronectin type III domai... [more]
ENSXETT00000007893.11.013e-822.07leucine rich repeat and fibronectin type III domai... [more]
oaz11.769e-622.41ornithine decarboxylase antizyme 1 [Source:Xenbase... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lrfn57.101e-822.79leucine rich repeat and fibronectin type III domai... [more]
Lrfn58.566e-822.91leucine rich repeat and fibronectin type III domai... [more]
Pxdn1.766e-623.75peroxidasin [Source:MGI Symbol;Acc:MGI:1916925][more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PGX3|LRFN1_DANRE4.845e-823.33Leucine-rich repeat and fibronectin type III domai... [more]
sp|A8WGA3|LFN1L_DANRE1.007e-721.82Leucine-rich repeat and fibronectin type III domai... [more]
sp|D4A1J9|LRFN5_RAT2.940e-722.79Leucine-rich repeat and fibronectin type-III domai... [more]
sp|Q96NI6|LRFN5_HUMAN3.740e-722.06Leucine-rich repeat and fibronectin type-III domai... [more]
sp|Q8BXA0|LRFN5_MOUSE4.967e-722.79Leucine-rich repeat and fibronectin type-III domai... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZII90.000e+099.34Leucine rich repeat and fibronectin type III domai... [more]
T1DF806.401e-17048.49LRFN-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0X3NMB84.235e-2423.65Leucine-rich repeat and fibronectin type-III domai... [more]
A0A267G4B55.035e-2025.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A183TGI11.586e-1923.62Ig-like domain-containing protein OS=Schistocephal... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:cabz01090165.17.748e-1024.59leucine-rich repeat and fibronectin type III domai... [more]
si:cabz01090165.11.141e-924.59leucine-rich repeat and fibronectin type III domai... [more]
si:cabz01090165.11.141e-924.59leucine-rich repeat and fibronectin type III domai... [more]
lrfn11.563e-923.76leucine-rich repeat and fibronectin type III domai... [more]
lrfn5a1.440e-821.03leucine-rich repeat and fibronectin type-III domai... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lrfn5a8.041e-823.79leucine rich repeat and fibronectin type III domai... [more]
ENSPMAT00000000078.17.838e-725.76pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrfn13.376e-1123.48leucine rich repeat and fibronectin type III domai... [more]
ENSORLT00000019143.21.003e-823.05leucine-rich repeat and immunoglobulin-like domain... [more]
si:cabz01090165.11.334e-823.14leucine-rich repeat and fibronectin type III domai... [more]
zgc:1722822.226e-823.48leucine-rich repeat and fibronectin type III domai... [more]
zgc:1722822.444e-823.49leucine-rich repeat and fibronectin type III domai... [more]
back to top
BLAST of leucine rich repeat and fibronectin type III domain containing-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045027.10.000e+099.30SMESG000045027.1[more]
SMESG000045027.10.000e+099.30SMESG000045027.1[more]
SMESG000080200.12.413e-3125.83SMESG000080200.1[more]
SMESG000080200.12.487e-3125.83SMESG000080200.1[more]
SMESG000080200.12.990e-3125.89SMESG000080200.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035118
GenBankAFJ24843.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035118 ID=SMED30035118|Name=leucine rich repeat and fibronectin type III domain containing-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1934bp
CAAATTCAACAATTATTTATTGGTAAATACTAGTGGGTAAATCAAAGAGT
CAATCAGAATCGAAAACAAAATCGGATTATAAATTCAGAGAAATCATGTA
TTATTAAATGAATTGATTGTATATAATGATGAAGACCAACTTCGTTTTGT
TTATCGTATTCAATTACCTTTTGGAATTTTGTATCTGTGGATATTTTTCT
ACGAGTTATTGCACTGGCTACGGAGAAGAAGCATATTATGATATCCTATG
TAAAGATCCAGCTGAGTTTCCACGTGATCTTCCAAAAACCACAGAAAAAC
TAACAATAATTTGTTTGAATAATTCATCAAAATCTCGAAAGATTATTTCC
CAAGTTACTCTTAAAGAAATCAAACAATATGATTCACTGGTTTCAATTTC
GTTCCAAAATTGTCCAATTAACGATTTGCCGGAGAAATTATTCACGAATT
TCCCATATCTTCAGTCAGTCACTTTAGACAAATTGCCAATTCAAAGGCTA
CGAAATATATTTTTCCAATCGGAAAATCTTGTTGAACTGGTCTTGACAAA
TCTGTTTAATTTGGAACACATCGACTTCCATCTGCTGGATTCACAGAGGT
CTTTTAGCCGGATCGTGTTTGATAACACAACTGTAGATCCGGAAAATTTA
AAAGAAATCCTTAAACCAGTAAGACGTTCCATAAAAGAATTCCGATTTAT
CAACAATCGCATTGAAATAGTGAAATTACCTAAAAGGTTTTTTCTTGATT
ATCAGTTAGGGTTGTTGGATGTTCAAAACAATTTGTTCCTTGACTGGGAT
TTTCTCACTGTCACCAAATCGAGAAAGCTTCTTCTGAAAAACAGTCAAGC
CTTAAAATCAAGCTTTGATTTATCAAAATTTTCAATTCTCTATTTGTATT
GTGAATTGTTTGATTTAGAAAATATCGGCATCCATGGAACATTCCCTTCG
ACTATTTCCGAACCGTTTCAACACGTCAAAAGTCTCATTGTCAAATCAAA
CAGTATCGAAAGCCTGCATAATAGCATAGATCAAATGTTTCCTCATTTGC
AACTGCTTGACATAAGTTACAATAAAATAAAACATTTACAGCCAGATTTA
AACAATTTGTTTTACAAAACCGAAATTTTCAAACTCGAAGGAAATCCTCT
CCATTGCAACTGTCAAGTTCGATGGCTGTCGGCAAGATACAAATCAAAGA
TTCGAGATTTTCCTCGCTGTAACTTTGGATATCGAAATTCTAATTTATCC
GAATCAACCCAATCAGATGATTTATTTTTCTCCCAATTAGCAACCGACAG
TCTCATTTGTCTTCCACCTAGGGCCCCAATTTTATCAATTTCAAAAGCTG
AGGTTCCTATTAAATTGACGGTTTCCGGAAAAGACAAACCAAATAATATT
TCTATAGTCAAAAAGGAATATACTTTGGTAATGAATTCGAATCAACTCGT
AGAATTAAATTGTGAAACAGAAGGTGATCCTACTCCTACATTAATTTGGT
CAGATGAAGTCGGTCCTATACTGACGCGTCATCCATCATCTCACATTAAC
CATTCATCAAATCGACTCACAGTTGGTTTAGAAGGCTCAAACGTTTCCTC
AGTATACATTTGCACCGCTTCTAATATCGAAGGAATCTCGTTTGCTTTAC
TGAATTTGGTATCCAAAAGGGTAGACATGTCCATTCACCAAAATACCTCA
GTTGTCGCTTTCGAGCGAATAATATCAAATGTAAACAATAGAAATTGTGC
CTCGAAATTCTTTGCTCAAATTTCAGAGTTAAATATTAATGAAACTTTGA
TGTGGCAGATTTTATATATTTTTATATGTATTATGAATAAATATTATTTA
TAAACAAATTGTTTGGTTGAAAACAATTATTTTCATTTGAAATTGTAAAT
AAGATTTTATGATTGTTTTCTTGTGAATTCGGCG
back to top

protein sequence of SMED30035118-orf-1

>SMED30035118-orf-1 ID=SMED30035118-orf-1|Name=SMED30035118-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=576bp
MMKTNFVLFIVFNYLLEFCICGYFSTSYCTGYGEEAYYDILCKDPAEFPR
DLPKTTEKLTIICLNNSSKSRKIISQVTLKEIKQYDSLVSISFQNCPIND
LPEKLFTNFPYLQSVTLDKLPIQRLRNIFFQSENLVELVLTNLFNLEHID
FHLLDSQRSFSRIVFDNTTVDPENLKEILKPVRRSIKEFRFINNRIEIVK
LPKRFFLDYQLGLLDVQNNLFLDWDFLTVTKSRKLLLKNSQALKSSFDLS
KFSILYLYCELFDLENIGIHGTFPSTISEPFQHVKSLIVKSNSIESLHNS
IDQMFPHLQLLDISYNKIKHLQPDLNNLFYKTEIFKLEGNPLHCNCQVRW
LSARYKSKIRDFPRCNFGYRNSNLSESTQSDDLFFSQLATDSLICLPPRA
PILSISKAEVPIKLTVSGKDKPNNISIVKKEYTLVMNSNQLVELNCETEG
DPTPTLIWSDEVGPILTRHPSSHINHSSNRLTVGLEGSNVSSVYICTASN
IEGISFALLNLVSKRVDMSIHQNTSVVAFERIISNVNNRNCASKFFAQIS
ELNINETLMWQILYIFICIMNKYYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR032675LRR_dom_sf
IPR013783Ig-like_fold
IPR001611Leu-rich_rpt
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 406..514
e-value: 1.3E-7
score: 33.9
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 28..163
e-value: 2.0E-5
score: 25.9
coord: 230..372
e-value: 9.4E-15
score: 56.2
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 279..514
NoneNo IPR availablePANTHERPTHR45842:SF11coord: 279..514
NoneNo IPR availableCDDcd00096Igcoord: 442..503
e-value: 5.10489E-6
score: 42.6145
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.788
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 59..362
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 422..507
score: 8.339
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 87..108
score: 4.57
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 210..231
score: 4.662
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 307..329
score: 7.666
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 283..304
score: 5.024
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 428..511