Potassium voltage-gated channel protein Shaw

Overview
NamePotassium voltage-gated channel protein Shaw
Smed IDSMED30035114
Length (bp)1793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium voltage-gated channel protein Shaw (SMED30035114) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium voltage-gated channel protein Shaw (SMED30035114) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035114

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035114 dd_Smed_v4_42862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035114 dd_Smed_v4_42862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035114 dd_Smed_v4_42862_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035114 dd_Smed_v4_25015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035114 dd_Smed_v4_25015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035114 dd_Smed_v4_25015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 262.692 bits (670), Expect = 9.524e-79
Identity = 152/450 (33.78%), Postives = 246/450 (54.67%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK---------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN-----FFSEYDDEPNDN-----------------------CCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                 E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+       +   DE  D+                        CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EILRVGNITSVHFRREVETEPI-LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 262.307 bits (669), Expect = 1.225e-78
Identity = 152/450 (33.78%), Postives = 246/450 (54.67%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK---------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN-----FFSEYDDEPNDN-----------------------CCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                 E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+       +   DE  D+                        CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EILRVGNITSVHFRREVETEPI-LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 262.307 bits (669), Expect = 1.225e-78
Identity = 152/450 (33.78%), Postives = 246/450 (54.67%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK---------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN-----FFSEYDDEPNDN-----------------------CCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                 E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+       +   DE  D+                        CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EILRVGNITSVHFRREVETEPI-LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC4 (potassium voltage-gated channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:6236])

HSP 1 Score: 261.922 bits (668), Expect = 1.327e-78
Identity = 152/450 (33.78%), Postives = 246/450 (54.67%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK---------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN-----FFSEYDDEPNDN-----------------------CCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                 E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+       +   DE  D+                        CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EILRVGNITSVHFRREVETEPI-LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNB2 (potassium voltage-gated channel subfamily B member 2 [Source:HGNC Symbol;Acc:HGNC:6232])

HSP 1 Score: 264.233 bits (674), Expect = 3.914e-77
Identity = 157/441 (35.60%), Postives = 237/441 (53.74%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R V+INVGG   E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E       +E ++ CC    K LW    KP+SS  A I AI+  +F++LS  A    + P+ +       + +    LN+N    H          ++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   D   FTSIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   35 RRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPDKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQ-------ETDEFGQLNDNRQLAH----------VEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 250.366 bits (638), Expect = 6.801e-76
Identity = 144/436 (33.03%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  290 MDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENF---------------FSEYDDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFK-SNQNTSSKVELIPALNNNEFANHGNSMWI---------GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            MD    V +NVGG   ET    L KIP ++L++L  +   Y   L EYFFDR P +F ++LNY+R G+LH P ++CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   E+                F   DD    N  + W +    +W  F++P SSK A + + +   F++ S  +FI ++ P F+  + +    + ++   +   F N+  ++            F Y+D  C  +F+++L IR L  P+  KF+ + +T+I++IS   ++ +   H I     +  +G L  +  L +  VLR+ K+ +++SGL++L+ T ++S ++L L++ F+ +A + F+ L+Y+ +       N FTSIP G WWS++T++TVG+GD+ PK + G +VGS C+L+GVL +A  VP++V++F   YSH+Q+
Sbjct:    1 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ-WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVV---DEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAI-----LIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQA 427          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 250.366 bits (638), Expect = 6.801e-76
Identity = 144/436 (33.03%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  290 MDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENF---------------FSEYDDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFK-SNQNTSSKVELIPALNNNEFANHGNSMWI---------GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            MD    V +NVGG   ET    L KIP ++L++L  +   Y   L EYFFDR P +F ++LNY+R G+LH P ++CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   E+                F   DD    N  + W +    +W  F++P SSK A + + +   F++ S  +FI ++ P F+  + +    + ++   +   F N+  ++            F Y+D  C  +F+++L IR L  P+  KF+ + +T+I++IS   ++ +   H I     +  +G L  +  L +  VLR+ K+ +++SGL++L+ T ++S ++L L++ F+ +A + F+ L+Y+ +       N FTSIP G WWS++T++TVG+GD+ PK + G +VGS C+L+GVL +A  VP++V++F   YSH+Q+
Sbjct:    1 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ-WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVV---DEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAI-----LIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQA 427          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 250.366 bits (638), Expect = 9.074e-76
Identity = 144/436 (33.03%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  290 MDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENF---------------FSEYDDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFK-SNQNTSSKVELIPALNNNEFANHGNSMWI---------GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            MD    V +NVGG   ET    L KIP ++L++L  +   Y   L EYFFDR P +F ++LNY+R G+LH P ++CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   E+                F   DD    N  + W +    +W  F++P SSK A + + +   F++ S  +FI ++ P F+  + +    + ++   +   F N+  ++            F Y+D  C  +F+++L IR L  P+  KF+ + +T+I++IS   ++ +   H I     +  +G L  +  L +  VLR+ K+ +++SGL++L+ T ++S ++L L++ F+ +A + F+ L+Y+ +       N FTSIP G WWS++T++TVG+GD+ PK + G +VGS C+L+GVL +A  VP++V++F   YSH+Q+
Sbjct:   24 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ-WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVV---DEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAI-----LIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQA 450          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 251.136 bits (640), Expect = 9.685e-76
Identity = 144/436 (33.03%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  290 MDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENF---------------FSEYDDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFK-SNQNTSSKVELIPALNNNEFANHGNSMWI---------GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            MD    V +NVGG   ET    L KIP ++L++L  +   Y   L EYFFDR P +F ++LNY+R G+LH P ++CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   E+                F   DD    N  + W +    +W  F++P SSK A + + +   F++ S  +FI ++ P F+  + +    + ++   +   F N+  ++            F Y+D  C  +F+++L IR L  P+  KF+ + +T+I++IS   ++ +   H I     +  +G L  +  L +  VLR+ K+ +++SGL++L+ T ++S ++L L++ F+ +A + F+ L+Y+ +       N FTSIP G WWS++T++TVG+GD+ PK + G +VGS C+L+GVL +A  VP++V++F   YSH+Q+
Sbjct:   51 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ-WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVV---DEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAI-----LIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQA 477          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 249.98 bits (637), Expect = 1.006e-75
Identity = 144/436 (33.03%), Postives = 247/436 (56.65%), Query Frame = 2
Query:  290 MDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENF---------------FSEYDDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFK-SNQNTSSKVELIPALNNNEFANHGNSMWI---------GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            MD    V +NVGG   ET    L KIP ++L++L  +   Y   L EYFFDR P +F ++LNY+R G+LH P ++CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   E+                F   DD    N  + W +    +W  F++P SSK A + + +   F++ S  +FI ++ P F+  + +    + ++   +   F N+  ++            F Y+D  C  +F+++L IR L  P+  KF+ + +T+I++IS   ++ +   H I     +  +G L  +  L +  VLR+ K+ +++SGL++L+ T ++S ++L L++ F+ +A + F+ L+Y+ +       N FTSIP G WWS++T++TVG+GD+ PK + G +VGS C+L+GVL +A  VP++V++F   YSH+Q+
Sbjct:   11 MDTEHRVILNVGGIRHETYSHVLKKIPATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWGLDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGDPPTQEEIAKKFGWEDDYYTGNMSQ-WQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKTDPSFQIPDIDVFYSLRVV---DEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFESLLHAI-----LIQTGSLVTLDFLSMICVLRLFKLTQHFSGLKILIQTFKASAQELFLLVFFVILAIVIFAALVYYAERSQLNKDNQFTSIPLGLWWSLVTISTVGFGDMVPKTYLGMLVGSLCALMGVLTIALPVPVIVSNFSNLYSHSQA 437          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 257.299 bits (656), Expect = 2.950e-78
Identity = 139/428 (32.48%), Postives = 240/428 (56.07%), Query Frame = 2
Query:  284 LNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCR-------------TWTKYL----WKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NMD    V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   +    + +    +   R             +W + +    W  F++P SS  A    ++   F+ +SI +F  ++HP  +     +  V+     N         +  I F YI+  C  +F+ ++ +RF+ +PN+ +F+ + + +I+ I+ + +Y+D +   +   +   ++  F  ++ ++R+F      K+ R+ SGL++L+ T R+S K+L L++ F+ +  + F++L+Y+ +       N F SIP G WW+++TMTTVGYGD+ PK + G  VG+ C+L GVL +A  VP++V++F +YYSH Q+
Sbjct:    4 INMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLF------KLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 425          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 256.914 bits (655), Expect = 2.969e-78
Identity = 139/428 (32.48%), Postives = 240/428 (56.07%), Query Frame = 2
Query:  284 LNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCR-------------TWTKYL----WKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NMD    V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   +    + +    +   R             +W + +    W  F++P SS  A    ++   F+ +SI +F  ++HP  +     +  V+     N         +  I F YI+  C  +F+ ++ +RF+ +PN+ +F+ + + +I+ I+ + +Y+D +   +   +   ++  F  ++ ++R+F      K+ R+ SGL++L+ T R+S K+L L++ F+ +  + F++L+Y+ +       N F SIP G WW+++TMTTVGYGD+ PK + G  VG+ C+L GVL +A  VP++V++F +YYSH Q+
Sbjct:    4 INMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLF------KLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 425          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 256.914 bits (655), Expect = 3.299e-77
Identity = 139/428 (32.48%), Postives = 240/428 (56.07%), Query Frame = 2
Query:  284 LNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCR-------------TWTKYL----WKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NMD    V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   +    + +    +   R             +W + +    W  F++P SS  A    ++   F+ +SI +F  ++HP  +     +  V+     N         +  I F YI+  C  +F+ ++ +RF+ +PN+ +F+ + + +I+ I+ + +Y+D +   +   +   ++  F  ++ ++R+F      K+ R+ SGL++L+ T R+S K+L L++ F+ +  + F++L+Y+ +       N F SIP G WW+++TMTTVGYGD+ PK + G  VG+ C+L GVL +A  VP++V++F +YYSH Q+
Sbjct:    4 INMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLF------KLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 425          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 256.529 bits (654), Expect = 3.898e-77
Identity = 139/428 (32.48%), Postives = 240/428 (56.07%), Query Frame = 2
Query:  284 LNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCR-------------TWTKYL----WKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NMD    V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   +    + +    +   R             +W + +    W  F++P SS  A    ++   F+ +SI +F  ++HP  +     +  V+     N         +  I F YI+  C  +F+ ++ +RF+ +PN+ +F+ + + +I+ I+ + +Y+D +   +   +   ++  F  ++ ++R+F      K+ R+ SGL++L+ T R+S K+L L++ F+ +  + F++L+Y+ +       N F SIP G WW+++TMTTVGYGD+ PK + G  VG+ C+L GVL +A  VP++V++F +YYSH Q+
Sbjct:    4 INMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLF------KLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 425          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 256.914 bits (655), Expect = 5.744e-77
Identity = 145/454 (31.94%), Postives = 250/454 (55.07%), Query Frame = 2
Query:  206 ILKKTRSFLHPNDANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCR-------------TWTKYL----WKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            I KK + + H   A +N+        +NMD    V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   +    + +    +   R             +W + +    W  F++P SS  A    ++   F+ +SI +F  ++HP  +     +  V+     N         +  I F YI+  C  +F+ ++ +RF+ +PN+ +F+ + + +I+ I+ + +Y+D +   +   +   ++  F  ++ ++R+F      K+ R+ SGL++L+ T R+S K+L L++ F+ +  + F++L+Y+ +       N F SIP G WW+++TMTTVGYGD+ PK + G  VG+ C+L GVL +A  VP++V++F +YYSH Q+
Sbjct:    4 IPKKMQHYAH---AAMNL--------INMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLF------KLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 440          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 266.544 bits (680), Expect = 5.987e-81
Identity = 155/456 (33.99%), Postives = 250/456 (54.82%), Query Frame = 2
Query:  278 ENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLA-------QLNVHSVYYRSQL-KEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPND---------------NCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKF---------KSNQNTSSKVELI---PALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD--IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            E    +D   + INVGGT  ET  STL  IP S+LA       Q+N  +   ++    E+FFDR P IF  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE    E  ++  D                CC  W   +W  F  P SS+ A + A +   F+++SI  F  E+H  F         KS  N+++ ++++   P L                  ++  CV +F+ +  +R +C PN++ F+ N + +I+ ++++P+Y++  + G+  +     ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  +  L++ F+ +  L F+T+IY+ +            +   F +IP GFWW+++TMTT+GYGD+ PK + G IVG+ C++ GVL +A  VP++VN+F +YYS A +
Sbjct:   28 EMARCEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHTDTKSATNSTTIIQVMDTKPVLT----------------VVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAK--DVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 266.929 bits (681), Expect = 8.709e-81
Identity = 155/456 (33.99%), Postives = 250/456 (54.82%), Query Frame = 2
Query:  278 ENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLA-------QLNVHSVYYRSQL-KEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPND---------------NCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKF---------KSNQNTSSKVELI---PALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD--IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            E    +D   + INVGGT  ET  STL  IP S+LA       Q+N  +   ++    E+FFDR P IF  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE    E  ++  D                CC  W   +W  F  P SS+ A + A +   F+++SI  F  E+H  F         KS  N+++ ++++   P L                  ++  CV +F+ +  +R +C PN++ F+ N + +I+ ++++P+Y++  + G+  +     ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  +  L++ F+ +  L F+T+IY+ +            +   F +IP GFWW+++TMTT+GYGD+ PK + G IVG+ C++ GVL +A  VP++VN+F +YYS A +
Sbjct:   28 EMARCEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHTDTKSATNSTTIIQVMDTKPVLT----------------VVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAK--DVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc4 (potassium voltage-gated channel, Shaw-related subfamily, member 4 [Source:ZFIN;Acc:ZDB-GENE-060503-773])

HSP 1 Score: 266.929 bits (681), Expect = 8.709e-81
Identity = 155/456 (33.99%), Postives = 250/456 (54.82%), Query Frame = 2
Query:  278 ENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLA-------QLNVHSVYYRSQL-KEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPND---------------NCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKF---------KSNQNTSSKVELI---PALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD--IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            E    +D   + INVGGT  ET  STL  IP S+LA       Q+N  +   ++    E+FFDR P IF  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE    E  ++  D                CC  W   +W  F  P SS+ A + A +   F+++SI  F  E+H  F         KS  N+++ ++++   P L                  ++  CV +F+ +  +R +C PN++ F+ N + +I+ ++++P+Y++  + G+  +     ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  +  L++ F+ +  L F+T+IY+ +            +   F +IP GFWW+++TMTT+GYGD+ PK + G IVG+ C++ GVL +A  VP++VN+F +YYS A +
Sbjct:   28 EMARCEDSDKIIINVGGTRHETYRSTLRTIPGSRLAWLADTDSQVNPDADTGQTHPNSEFFFDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFEPPDPEDAEDDQDMPRRFGIEDSPDRSRGCCEVWQPKIWALFEDPYSSRAARVIAFVSLFFILVSITNFCLETHEAFFEFHNHTDTKSATNSTTIIQVMDTKPVLT----------------VVEGICVVWFTFEFLVRIICCPNKLLFIKNQLNIIDFVAILPFYLERSLIGNTSKAAK--DVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASVNEFCLLIIFLALGVLIFATMIYYAERISADPDDPSGCNHTHFKNIPIGFWWAVVTMTTLGYGDMVPKTWLGMIVGALCAIAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnb2 (potassium voltage-gated channel, Shab-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-170])

HSP 1 Score: 268.855 bits (686), Expect = 6.618e-80
Identity = 158/441 (35.83%), Postives = 240/441 (54.42%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV---DDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R VRINVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E    +  D+ +  CC    + LW    KPSSS  A + AII  +F+ILS  A             NT  ++++I     +EF    ++      +++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++     +D   FTSIPA FWW+ ITMTTVGYGDIYP+   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   34 RRVRINVGGLVHEVLWRTLDRLPRTRLGKLRDCNTHETLMEICDDYSLNDNEYFFDRHPGAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREKEGDQVDTGCCPDKRQKLWDLLEKPSSSVAAKVLAIISILFIILSTIALSL----------NTLPELQVI-----DEFGQSNDNP--NLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 451          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnb2 (potassium voltage-gated channel, Shab-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070912-170])

HSP 1 Score: 268.47 bits (685), Expect = 1.644e-79
Identity = 158/441 (35.83%), Postives = 240/441 (54.42%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV---DDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R VRINVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E    +  D+ +  CC    + LW    KPSSS  A + AII  +F+ILS  A             NT  ++++I     +EF    ++      +++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++     +D   FTSIPA FWW+ ITMTTVGYGDIYP+   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   34 RRVRINVGGLVHEVLWRTLDRLPRTRLGKLRDCNTHETLMEICDDYSLNDNEYFFDRHPGAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREKEGDQVDTGCCPDKRQKLWDLLEKPSSSVAAKVLAIISILFIILSTIALSL----------NTLPELQVI-----DEFGQSNDNP--NLAHVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 451          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4 [Source:NCBI gene;Acc:100492941])

HSP 1 Score: 274.633 bits (701), Expect = 1.413e-83
Identity = 156/440 (35.45%), Postives = 250/440 (56.82%), Query Frame = 2
Query:  278 ENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQL----NVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPND-----------------NCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            E    +D   + INVGGT  ET +STL  +P ++LA L       +    SQ  E+FFDR P IF  VLNY+R G+LH P  ICGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FEN   E  +E N                   C + W   +W  F  P SS+ A + A +   F+++SI  F  E+H  F  ++N +  V  I  +          +  I   YI+  CV +F+++  +R +C P+++ F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            +   F +IP GFWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   28 EMAKGEDSGKITINVGGTRHETYKSTLRTLPGTRLAWLADPDTASNSESDSQRTEFFFDRHPGIFSYVLNYYRTGKLHCPADICGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFENVEPEDGEEENKGSSPELLCIEERTDRSRGCWKVWQPKMWALFEDPYSSRAARVVAFVSLFFILMSITTFCLETHESFIVDRNVTETV-TIGNMTEILVVREVETEPI-LTYIEGVCVFWFTLEFLVRIICCPDKVFFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPTDPSGSNHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 462          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNB2 (potassium channel, voltage gated Shab related subfamily B, member 2 [Source:NCBI gene;Acc:100489419])

HSP 1 Score: 264.233 bits (674), Expect = 2.499e-77
Identity = 155/441 (35.15%), Postives = 236/441 (53.51%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV---DDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R V+INVGG   E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E       +E ++ CC    K LW    KP+SS  A I AII  +F++LS  A    + P  +                 +EF    ++  +   +++  C+ +F+++  +RFL +PN+ KF    + +I++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++     +D   FTSIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   35 RRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIISILFIVLSTIALSLNTLPDLQ---------------ETDEFGQPNDNPQLA--HVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNIIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 251.136 bits (640), Expect = 6.664e-75
Identity = 155/448 (34.60%), Postives = 246/448 (54.91%), Query Frame = 2
Query:  266 GDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVY----YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDF---ENFFSEYDDEPNDNCCRT-------WTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKS--------NQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV-------DD-----QNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            GD+ +N + D I    INVGG   ET  STL  +P ++L+ L     +    Y  +  E+FFDR P++F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW++Y Q +  + +L  F   E    E D +    C +        W +    +W  F  P SSK A   A     F+++SI  F  E+H  F           Q   ++ E I  +    F            Y++  CV +F+ +  IR +  P++M+F+ + + +I+ ++++P+Y++I    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+        DD        F +IP GFWW+++TMTT+GYGD+YP  + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   27 GDMGKNEDSDKIV---INVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPF----------LTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 251.136 bits (640), Expect = 7.006e-75
Identity = 155/448 (34.60%), Postives = 246/448 (54.91%), Query Frame = 2
Query:  266 GDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVY----YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDF---ENFFSEYDDEPNDNCCRT-------WTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKS--------NQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV-------DD-----QNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            GD+ +N + D I    INVGG   ET  STL  +P ++L+ L     +    Y  +  E+FFDR P++F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW++Y Q +  + +L  F   E    E D +    C +        W +    +W  F  P SSK A   A     F+++SI  F  E+H  F           Q   ++ E I  +    F            Y++  CV +F+ +  IR +  P++M+F+ + + +I+ ++++P+Y++I    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+        DD        F +IP GFWW+++TMTT+GYGD+YP  + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   27 GDMGKNEDSDKIV---INVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPF----------LTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 251.136 bits (640), Expect = 8.878e-75
Identity = 155/448 (34.60%), Postives = 246/448 (54.91%), Query Frame = 2
Query:  266 GDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVY----YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDF---ENFFSEYDDEPNDNCCRT-------WTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKS--------NQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV-------DD-----QNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            GD+ +N + D I    INVGG   ET  STL  +P ++L+ L     +    Y  +  E+FFDR P++F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW++Y Q +  + +L  F   E    E D +    C +        W +    +W  F  P SSK A   A     F+++SI  F  E+H  F           Q   ++ E I  +    F            Y++  CV +F+ +  IR +  P++M+F+ + + +I+ ++++P+Y++I    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+        DD        F +IP GFWW+++TMTT+GYGD+YP  + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   27 GDMGKNEDSDKIV---INVGGIRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEAFNDVNNKTEVFTQGNITRTETILEMETEPF----------LTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAAPDDITGSKHTDFKNIPIGFWWAVVTMTTLGYGDMYPVTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 260.766 bits (665), Expect = 3.174e-78
Identity = 153/454 (33.70%), Postives = 247/454 (54.41%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK-------------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEY----------DDE---------PNDNC---------CRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                     E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+               DDE         P++           CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EIHRVGNITSVRFRREVETEPI-LTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 488          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnb2 (potassium voltage gated channel, Shab-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:99632])

HSP 1 Score: 266.544 bits (680), Expect = 3.929e-78
Identity = 156/441 (35.37%), Postives = 238/441 (53.97%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R V+INVGG   E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E       +E ++ CC    K LW    KP+SS  A I AI+  +F++LS  A    + P+ +                N+EF    ++  +   +++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   D   FTSIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   35 RRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQ---------------ENDEFGQPSDNRKLA--HVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnb2 (potassium voltage gated channel, Shab-related subfamily, member 2 [Source:MGI Symbol;Acc:MGI:99632])

HSP 1 Score: 266.544 bits (680), Expect = 3.929e-78
Identity = 156/441 (35.37%), Postives = 238/441 (53.97%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R V+INVGG   E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E       +E ++ CC    K LW    KP+SS  A I AI+  +F++LS  A    + P+ +                N+EF    ++  +   +++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   D   FTSIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   35 RRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQ---------------ENDEFGQPSDNRKLA--HVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc4 (potassium voltage gated channel, Shaw-related subfamily, member 4 [Source:MGI Symbol;Acc:MGI:96670])

HSP 1 Score: 260.766 bits (665), Expect = 7.194e-78
Identity = 153/454 (33.70%), Postives = 247/454 (54.41%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK-------------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEY----------DDE---------PNDNC---------CRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                     E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+               DDE         P++           CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EIHRVGNITSVRFRREVETEPI-LTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 488          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnb1 (potassium voltage gated channel, Shab-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96666])

HSP 1 Score: 261.922 bits (668), Expect = 9.123e-77
Identity = 158/441 (35.83%), Postives = 235/441 (53.29%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFE-NFFSEYDDEPNDN-CCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R VR+NVGG   E L  TL ++P ++L +L   N H         Y  +  EYFFDR P  F  +LN++R G LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  E     E + E  DN CC    K LW    KP+SS  A I AII  +F++LS  A    + P+ +S        E   + +N + A           +++  C+ +F+++  +RFL +P + KF    +  I++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   D   F SIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLEKPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLD------EFGQSTDNPQLA-----------HVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 448          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|Q03721|KCNC4_HUMAN (Potassium voltage-gated channel subfamily C member 4 OS=Homo sapiens OX=9606 GN=KCNC4 PE=1 SV=2)

HSP 1 Score: 262.307 bits (669), Expect = 5.885e-78
Identity = 152/450 (33.78%), Postives = 246/450 (54.67%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK---------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN-----FFSEYDDEPNDN-----------------------CCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                 E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+       +   DE  D+                        CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPETDGGGVGSSGSSGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGSGAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EILRVGNITSVHFRREVETEPI-LTYIEGVCVLWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 484          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|Q63734|KCNC4_RAT (Potassium voltage-gated channel subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Kcnc4 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 6.448e-78
Identity = 153/451 (33.92%), Postives = 247/451 (54.77%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK----------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEY----------DDE---------PNDNC---------CRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                  E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+               DDE         P++           CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EIHRVGNITSVRFRREVETEPI-LTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 485          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|Q8R1C0|KCNC4_MOUSE (Potassium voltage-gated channel subfamily C member 4 OS=Mus musculus OX=10090 GN=Kcnc4 PE=2 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 2.220e-77
Identity = 153/454 (33.70%), Postives = 247/454 (54.41%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLK-------------------EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEY----------DDE---------PNDNC---------CRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            INVGGT  ET  STL  +P ++LA L       R +                     E+FFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE+               DDE         P++           CR W   +W  F  P SS+ A + A     F+++SI  F  E+H  F  ++N + ++  +  + +  F     +  I   YI+  CV +F+++  +R +C P+ + F+ N++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            D   F +IP GFWW+++TMTT+GYGD+YPK + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   40 INVGGTRHETYRSTLRTLPGTRLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVSITTFCLETHEAFNIDRNVT-EIHRVGNITSVRFRREVETEPI-LTYIEGVCVMWFTLEFLVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 488          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|A6H8H5|KCNB2_MOUSE (Potassium voltage-gated channel subfamily B member 2 OS=Mus musculus OX=10090 GN=Kcnb2 PE=1 SV=2)

HSP 1 Score: 266.544 bits (680), Expect = 2.748e-77
Identity = 156/441 (35.37%), Postives = 238/441 (53.97%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R V+INVGG   E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E       +E ++ CC    K LW    KP+SS  A I AI+  +F++LS  A    + P+ +                N+EF    ++  +   +++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   D   FTSIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   35 RRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETMREREGEEFDNTCCPEKRKKLWDLLEKPNSSVAAKILAIVSILFIVLSTIALSLNTLPELQ---------------ENDEFGQPSDNRKLA--HVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 452          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.976e-77
Identity = 139/428 (32.48%), Postives = 240/428 (56.07%), Query Frame = 2
Query:  284 LNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCR-------------TWTKYL----WKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NMD    V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q +  + +L   +    + +    +   R             +W + +    W  F++P SS  A    ++   F+ +SI +F  ++HP  +     +  V+     N         +  I F YI+  C  +F+ ++ +RF+ +PN+ +F+ + + +I+ I+ + +Y+D +   +   +   ++  F  ++ ++R+F      K+ R+ SGL++L+ T R+S K+L L++ F+ +  + F++L+Y+ +       N F SIP G WW+++TMTTVGYGD+ PK + G  VG+ C+L GVL +A  VP++V++F +YYSH Q+
Sbjct:    4 INMDSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFSIIRIMRLF------KLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGLWWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQA 425          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: Q86MY4 (Potassium channel Kv3.2 OS=Notoplana atomata OX=221862 PE=2 SV=1)

HSP 1 Score: 477.248 bits (1227), Expect = 2.159e-159
Identity = 245/448 (54.69%), Postives = 324/448 (72.32%), Query Frame = 2
Query:  293 DDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFF----SEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANH-GNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTLKRMSFYSFLPEFD 1621
            +D + VRINVGG++F T + T+ K+P S+L +L     +Y    + Y+FDRDPEIF+VVLNYHR+GELHLPLH+CGP LEKELQYWG+PE++IEKCCW+ Y+QLKSQKYSL+DFE FF    S     P    C  +   +W   +KPSSSK A +Y +IV++FV LS+F FIAE+HP F+   N++++       + ++  +H     W G + +D+ CV FF+ D+ +R   TP ++ FL + +TVIEII+VIPYY+D   H+I   Y  + + +L V+HV RIFG+LR+ KILR+YSGLQVL+YTLR+S KDLLLMLTFIG+ATLFFSTLIY  DD+  F+SIPA FWWSIITMTTVGYGD YP    GY+VGSAC+L+GVLVVAFTVPILVNSFML+YSH+QSIL +++E+ L+      R Y++   K LK +     +P F+
Sbjct:   50 EDRQLVRINVGGSLFLTRQRTIKKMPNSRLGRLRTTGPHYLRDQEMYYFDRDPEIFRVVLNYHRLGELHLPLHVCGPSLEKELQYWGLPEELIEKCCWVSYVQLKSQKYSLLDFERFFDDRMSPRKVGPRCPRCYRFLDAMWTFLDKPSSSKGAFLYGVIVAVFVFLSLFVFIAETHPAFQLPLNSTNET------STSDVGDHYERQPWPGLETLDYVCVAFFTFDILLRVCVTPQKVTFLISPMTVIEIIAVIPYYIDFVSHFIHARYGHKPNKYLDVIHVFRIFGILRVFKILRHYSGLQVLIYTLRTSLKDLLLMLTFIGIATLFFSTLIYFSDDRTKFSSIPASFWWSIITMTTVGYGDFYPTRPWGYLVGSACALIGVLVVAFTVPILVNSFMLFYSHSQSILSVKREERLSRY--HGRGYVDQPPKILKELQLKHLVPSFE 489          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: K1Q186 (Potassium voltage-gated channel protein Shaw OS=Crassostrea gigas OX=29159 GN=CGI_10010533 PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 5.280e-94
Identity = 175/446 (39.24%), Postives = 261/446 (58.52%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFE----NFFSEYDDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHP------------KFKSNQNTSSK------VELIPALNNNEFANHGNSMWI-----GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQ--EDNLNSMTDDE 1549
            V  NVGGT FET  STL   P S LA     + +Y    KEYFFDRDP++FK +LNY R GELHLP  ICGP   +EL +WG+ + II++CCW HY    S   +L+  E        EY      +    W K    LWK  NKP+SS+ A  Y  I  IFV++SI +F+ E+HP             F +++N +S             LNN       + + +      F  ID  C+ +F++D  +R +    + +++++++ V++I+++IP Y+    + I    ++   G +  + +LR+  VLRI +++R+  GL +L+YTL+SS+K+LLLM+ F+ V  L FS+LIY VDD+  F SIP  FWWS+ITMTTVGYGD+YP    GYIVGS  +L G+L++ F+VP+LVN+F++YY H +  ++  +  E+N +S  DD+
Sbjct:   43 VMFNVGGTKFETYRSTLCSQPNSPLADDTFMNRHYNEDRKEYFFDRDPDVFKAILNYLRTGELHLPSFICGPAAREELLFWGVSDDIIQRCCWSHYNSWNSTLEALMQLEKDRKGSMDEYASSKGRSKGTPWEKLQTKLWKILNKPNSSRTAKAYGYISLIFVLISIASFVVETHPVFDNRVKILKPGTFDASRNVTSSFPYNTSASFNATLNNASIPKDTDYVTVKVTHPAFLAIDISCLIYFTIDYIVRLIFARKKFQYMTSLMGVVDILAIIPDYIQFVVYAIHP--EMRYDGNINYIAILRVARVLRIFRLIRHVPGLWILIYTLKSSFKELLLMIVFLIVGMLIFSSLIYFVDDRETFKSIPHSFWWSLITMTTVGYGDMYPVTELGYIVGSFTALSGLLMIGFSVPVLVNNFIMYYKHLEFAIIDEEAKENNEDSDKDDD 486          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1S3KDT6 (potassium voltage-gated channel protein Shaw OS=Lingula unguis OX=7574 GN=LOC106180131 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 7.255e-91
Identity = 172/424 (40.57%), Postives = 249/424 (58.73%), Query Frame = 2
Query:  278 ENLNMDDIRTVRINVGGTIFETLESTLHKIPESKL---AQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCRTWT---KYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIP-----ALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQ 1516
            EN    D R + +N+GG   ET  STL  IP S+L   A +      Y    KEYFFDR P  F  +L Y+R+GELH+   +CG +++ EL YWG+ E  IE CCW HY   +  K +L   +  F      PND C   ++   + LW+    P SS+ A  YA+I   FV +SI  F+ E+HP F+    ++S   L+       L   +F   G  + +    ID+ CVGFF+++L  RFL  P+++ F   V+ +I++I +IP Y+DI    +E       +  LK + V RI  +LR+ K++++Y   ++LVYT++ S K+LLLM+ F+    L F+++IY+ +  N F +IP GFWW+++TMTTVGYGD +PK   GY +G AC L GVL +AFTVPI+VN+F LYYSHAQS L + Q
Sbjct:    9 ENKRFGDKR-ITLNIGGHRHETWLSTLKTIPGSRLYHLANMQEADESYDPVNKEYFFDRHPIAFATILQYYRVGELHMDQTLCGNVMDDELDYWGLNETDIETCCWSHYYSYREHKNTLDALDENFG-----PNDVCPEHFSPMRRMLWQFLEDPQSSRAAKAYAVISMAFVGISILVFVLETHPFFQQPSTSNSTSLLVDYTQCVCLEEPKFV-EGVPLQV-MTIIDYVCVGFFTIELLARFLVAPSKLAFWKEVLNLIDLICLIPNYIDIIREIVE---PGSTNSALKFLVVFRIIRILRVFKLMKHYGAFKILVYTIKVSAKELLLMVIFLFTGVLIFASIIYYAEPSN-FKNIPIGFWWALVTMTTVGYGDKFPKEALGYFIGCACVLCGVLTIAFTVPIVVNNFSLYYSHAQSRLQMPQ 420          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A2C9JUN9 (BTB domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068965 PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 2.264e-90
Identity = 167/436 (38.30%), Postives = 263/436 (60.32%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN------FFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNT--SSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD---IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIY---HVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTF 1573
            ++ NVGG+IFET +STL  +P+S L+     S ++R   ++YFFDRDP IF  VLNY R GELHLP  +CGP++  EL++WG+ E  IE+CCW  Y    +    L   E          EY ++ N +C R   +  W+ F +PSSS  A IY       + L+IF+F A +H  F+  + +   S V  + +  + +   H + +    +YID  C+ FFSV+L +RFL +P +++F++  +++IE ++++P  +D   +   Y +    + +  F+K++ V RIF      +++R+  GL +L YTL++S KDLLL+L F+ V  L  S+LIY    V+ + +F+SIP  FWWS++TMTTVGYGD++PK   GY++G+A  + GVL++ FTVP+LVN+F+LYY+H  S   I +E+    +  D++    H F
Sbjct:   42 IKFNVGGSIFETYKSTLSAVPKSPLSSDKFLSKHFRESHRDYFFDRDPAIFHCVLNYFRTGELHLPTSVCGPVVRSELEFWGVDEVDIEECCWSRYATWATTLQDLRKLEEDRKNNLQLGEYPEKDNSSCFREVRRKAWRFFAQPSSSLPAKIYCCTSLSVIFLNIFSFCANTHEAFQVKEISYLDSSVTPVNSTQSVDAVEHSHPV---LRYIDVACLVFFSVELLLRFLVSPQKLRFITLPMSIIEFLALLPDLIDNAMLLSPYAKGPTLLWIIDFMKLLRVFRIF------RLMRHIPGLWILFYTLKASIKDLLLLLLFVCVGMLISSSLIYFAERVEQKELFSSIPKCFWWSVVTMTTVGYGDMFPKTNWGYLIGTATGISGVLMIGFTVPVLVNNFVLYYNHTTS--TISREEERKRLAGDKKSGRFHDF 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A2C9JUN6 (BTB domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068965 PE=3 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 1.279e-89
Identity = 165/429 (38.46%), Postives = 261/429 (60.84%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN------FFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNT--SSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD---IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIY---HVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDER 1552
            ++ NVGG+IFET +STL  +P+S L+     S ++R   ++YFFDRDP IF  VLNY R GELHLP  +CGP++  EL++WG+ E  IE+CCW  Y    +    L   E          EY ++ N +C R   +  W+ F +PSSS  A IY       + L+IF+F A +H  F+  + +   S V  + +  + +   H + +    +YID  C+ FFSV+L +RFL +P +++F++  +++IE ++++P  +D   +   Y +    + +  F+K++ V RIF      +++R+  GL +L YTL++S KDLLL+L F+ V  L  S+LIY    V+ + +F+SIP  FWWS++TMTTVGYGD++PK   GY++G+A  + GVL++ FTVP+LVN+F+LYY+H  S   I +E+    +  D++
Sbjct:   42 IKFNVGGSIFETYKSTLSAVPKSPLSSDKFLSKHFRESHRDYFFDRDPAIFHCVLNYFRTGELHLPTSVCGPVVRSELEFWGVDEVDIEECCWSRYATWATTLQDLRKLEEDRKNNLQLGEYPEKDNSSCFREVRRKAWRFFAQPSSSLPAKIYCCTSLSVIFLNIFSFCANTHEAFQVKEISYLDSSVTPVNSTQSVDAVEHSHPV---LRYIDVACLVFFSVELLLRFLVSPQKLRFITLPMSIIEFLALLPDLIDNAMLLSPYAKGPTLLWIIDFMKLLRVFRIF------RLMRHIPGLWILFYTLKASIKDLLLLLLFVCVGMLISSSLIYFAERVEQKELFSSIPKCFWWSVVTMTTVGYGDMFPKTNWGYLIGTATGISGVLMIGFTVPVLVNNFVLYYNHTTS--TISREEERKRLAGDKK 459          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 265.774 bits (678), Expect = 6.286e-81
Identity = 149/440 (33.86%), Postives = 243/440 (55.23%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVH------SVYYRSQLK-EYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFE-NFFS---------------------EYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWI----GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NVGGT  ET  +TL  +P ++LA L         +V  R++   EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  F+ N                        E+ D+  D   R W   +W  F  P SS+ A   A     F+++SI  F  E+H  F +  N +       AL N+          I       Y++  CV +F+ +  +R   +P++++F+ +V+ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  +  L++ F+ +  L F+T+IY+ +            D  +F +IP GFWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   23 LNVGGTRHETYRNTLRTLPGTRLALLATELPSSACAVTVRARANNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFDMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAFNTIINKTD------ALRNDSLLEVSPQYEIETDPALTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 453          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 263.462 bits (672), Expect = 3.596e-80
Identity = 149/440 (33.86%), Postives = 241/440 (54.77%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLN-------VHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFE-NFFS---------------------EYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWI----GFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +NVGGT  ET  +TL  +P ++LA L           V  R+   EYFFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  F+ N                        E+ D+  D   R W   +W  F  P SS+ A   A     F+++SI  F  E+H  F +  N +       AL N+          I       Y++  CV +F+ +  +R   +P++++F+ +V+ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  +  L++ F+ +  L F+T+IY+ +            D  +F +IP GFWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:    9 LNVGGTRHETYRNTLRTLPGTRLALLATELPSSACQQVRARAN-NEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFDMNALGGGPEGPGGEDGDELGEAAEQREHADKERDTGWRRWQPVMWNLFEDPYSSRAARFVAFASLFFIMVSITTFCLETHEAFNTIINKTD------ALRNDSLLEVSPQYEIETDPALTYVEGVCVLWFTFEFLVRVTFSPDKLEFVKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASVNEFFLLIIFLALGVLIFATMIYYAERIGANPNDPTASDHTMFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 438          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnb2 (potassium voltage-gated channel subfamily B member 2-like [Source:NCBI gene;Acc:103023195])

HSP 1 Score: 268.47 bits (685), Expect = 1.313e-79
Identity = 158/441 (35.83%), Postives = 241/441 (54.65%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV---DDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R VRINVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E    +  +E +  CC    + LW    KPSSS  A + AII  +F+ILS  A             NT  ++++I     +EF    ++  +   +++  C+ +F+++  +RFL +PN+ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++     +D   FTSIPA FWW+ ITMTTVGYGDIYP+   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   34 RRVRINVGGLVHEVLWRTLDRLPRTRLGKLRDCNTHDTLMEICDDYSLNDNEYFFDRHPGAFSSILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKKEQMNEELRREAETLREKEGEEVDTGCCPDKRQKLWDLLEKPSSSVAAKVLAIISILFIILSTIALSL----------NTLPELQVI-----DEFGQSNDNPSLA--HVEAVCIAWFTMEYLLRFLSSPNKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDATKFTSIPASFWWATITMTTVGYGDIYPQTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 451          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: ENSAMXT00000048024.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:103030489])

HSP 1 Score: 257.684 bits (657), Expect = 2.126e-77
Identity = 147/441 (33.33%), Postives = 242/441 (54.88%), Query Frame = 2
Query:  296 DIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVY----YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCC------------------------RTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHV-------DDQNV-----FTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            D   + IN GG   ET  STL  +P ++L+ L     +    Y  +  E+FFDR P +F  +LNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW++Y Q +  + +L  FE   S   + P+D+                          R W   +W  F  P SSK A   A    +F+++SI  F  E+H  F +  N +  V +                W+   Y++  CV +F++++F R +  P++ +F  +++ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+        DD        F +IP GFWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   34 DSERIVINCGGVRHETYRSTLKTLPGTRLSWLTEPDAFSNFDYDPKADEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETDVEACCWMNYRQHRDAEEALDSFE---SPEPEAPDDDAALAGGADGDLKRLCLQEDNRKVGWWRVWQPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMETHEAFNTIYNKTENVTVGNVTREEIVYEVVTDSWL--TYVEGVCVVWFTIEVFTRVVFCPDKAEFFKSLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGANPDDPTASAHTNFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 466          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 256.914 bits (655), Expect = 2.742e-77
Identity = 147/460 (31.96%), Postives = 236/460 (51.30%), Query Frame = 2
Query:  293 DDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDF--------------------ENFFSEYDDEPNDNCCRT----------------WTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSM----------WIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            DD   V +NVGG   ET   TL  +P ++LA+L   +        ++FFDR P +F  +LNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +LV F                    +      D +      R                 W K +W  F  P SS+ A   A     F+++SI  F  E+H  F             P +N  E+    N +           +   YI+  CV +F+ +  IR    P+++KF+ N + +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + +L++ F+ +  L F+T+IY+ +            +   F +IP GFWW+++TMTT+GYGD+YPK   G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:    5 DDEERVVLNVGGVRHETYRGTLRTLPGTRLARLAEQA---EGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETDVEPCCWMTYRQHREAEEALVSFGGAAPLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLETHEAFN------------PIINRTEYDVVDNEIVERNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFILLIIFLALGVLIFATMIYYAERIGANPNDPRASEHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTTSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 446          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 269.626 bits (688), Expect = 2.514e-82
Identity = 152/448 (33.93%), Postives = 252/448 (56.25%), Query Frame = 2
Query:  263 NGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVY----YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNC--------------------CRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +GD+  +   D+   V INVGGT  ET   TL  +P ++L+ L     +    Y ++  E+FFDR P +F  +LNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW++Y Q +  + +LV FEN     +DE N++                      R W   +W  F  P SS+ A I A+   +F+++SI  F  E+H  F +  N +    +        + +      +   Y++  CV +FS +  +R +C P++  F+ N + VI+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+I++ +            D   F +IP GFWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   26 DGDLGRS---DENERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETDVEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLETHEAFNTVLNKTENYTINNVTTQKVYVDVETDPVL--MYVEGVCVAWFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSLTSKPARDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIFYAERFGANPNDPTASDHTSFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFSMYYSLAMA 465          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 249.595 bits (636), Expect = 5.995e-77
Identity = 150/439 (34.17%), Postives = 228/439 (51.94%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQ---NVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            VR+NVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  VLN++R G LH+   +C     +EL YWG+ E  +E CC   Y Q K Q    +  + E+      DE    CC    + LW+    P+SS  A   AI+  +F++LS  A    + P  +       K E    ++N + A            ++  C+ +F+++  +RF+  PN+ KF    + VI++++++PYY+ IF     R    +     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +       F SIPA FWW+ ITMTTVGYGDIYP    G I+G  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:    2 VRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEIYLETCCQARYHQKKEQMSEELRREAESAREREGDEFEGTCCADKRRKLWELLENPNSSLAAKGMAIVSILFIVLSTIALSLNTLPDLQH------KDEFSHIIDNPKLAQ-----------VEAVCIAWFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTESSRGVS-QFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEPDTKFHSIPASFWWATITMTTVGYGDIYPMTLLGKIIGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAVKRREALERAKRNGSIVSM 417          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: KCNA3 (potassium voltage-gated channel subfamily A member 3 [Source:HGNC Symbol;Acc:HGNC:6221])

HSP 1 Score: 196.438 bits (498), Expect = 2.132e-56
Identity = 126/423 (29.79%), Postives = 226/423 (53.43%), Query Frame = 2
Query:  239 NDANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIG-ELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDE-PNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPA--LNNNEFA-NHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIY--HVDDQNV-FTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYY 1483
            +DA L  +  +  E L  +    + INV G  FET   +L + P++ L   +  S Y+     EYFFDR+   F  +L Y++ G  L  P+++   +  +E++++ +  + + K                 + E F  E +   P+D     + + +W  F  P SS  A   AI+  + +++SI  F  E+ P+F+  +      + +PA  +N  +    HG+S    F  ++  C+ +FS +L +RF   P++  F  +++ +I+I++++PY++ +     +     + +  L ++ V+R+  V RI K+ R+  GLQ+L  TL++S ++L L++ F+ +  + FS+ +Y    D QN  F SIP  FWW+++TMTTVGYGD+ P   GG IVGS C++ GVL +A  VP++V++F  +Y
Sbjct:    7 DDAALLEDGPETAEPLTHEYCERIVINVSGLRFETQLKSLDQFPDTLLGNPSKRSRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVSIDVFSEEIKFYELGNEAMAK---------------FQEDEGFIKEEEKPLPSDE----FQRQVWLLFEYPESSNPARGIAIVSVLVILISIIIFCLETLPEFRDEKEQ----KFLPAKDINGTQVKIMHGSSFTDPFFIVETICIIWFSFELLVRFFACPSKPGFFKSIMNIIDIVAILPYFITLGTEMAKHQGSGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADHQNSEFRSIPDAFWWAVVTMTTVGYGDMRPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 406          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcnf1b (potassium voltage-gated channel, subfamily F, member 1b [Source:ZFIN;Acc:ZDB-GENE-090312-39])

HSP 1 Score: 193.356 bits (490), Expect = 6.992e-56
Identity = 131/432 (30.32%), Postives = 218/432 (50.46%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQL--------KEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQK---YSLVDFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDI----FGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDD---QNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERI 1555
            +NVGG+        L ++P+S LA L V     R            E+FFDRDP  F  +L+ +  GE+H+    C    ++E+ +WG+    ++ CC   Y +L+ +      +V+ E   S          C      +W+   KP SS+LA   A+    F+++S       + P+ +            P  +      H          I+  C+G+F+V+  +RF   P+R+KF+S+ + V+++++V+PY+V +     G  +     + L+   + V  LRI  V R+ K+ R+ SGLQ L Y L+SS+K+L L+L ++GV    FS L Y V+    + +F+SIP  FWW+IITMTTVGYGDIYPK   G I  +   L G L +A  +  ++N+F+ +Y+  Q +L +  +  L  ++  E++
Sbjct:    4 VNVGGSRHVLRSELLARLPDSLLATLLVRPGAARRPAYDDFDPDSGEFFFDRDPRAFDRILDAYHFGEVHMDRSACPMCFKQEMDFWGVGADCLDDCCRFRYSELQEELDEIVQMVETELRDSGTAGAAQRGRCERARVGVWQLMEKPDSSRLARSLALTSFAFIVVSSVVMCLGTIPELQPG----------PGADGAAGEEHPT-----IAAIETVCIGWFTVEFALRFFSAPDRVKFMSSPMNVVDLLAVLPYFVVLALTEMGGSV-----MGLASMQQGVQALRIMRVARVFKLARHSSGLQTLTYALKSSFKELGLLLLYLGVGVYLFSALGYTVEQSHPETLFSSIPHSFWWAIITMTTVGYGDIYPKTELGKINAAVSFLCG-LAIALPIHPIINNFVKFYNK-QRVLEMAAKHQLELLSVSEQL 413          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006566.1 (pep scaffold:Pmarinus_7.0:GL476463:190204:191544:-1 gene:ENSPMAG00000005936.1 transcript:ENSPMAT00000006566.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 1.261e-53
Identity = 117/396 (29.55%), Postives = 204/396 (51.52%), Query Frame = 2
Query:  314 INVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLN-YHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGF--LKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYY 1483
            +NV G  FET   TL + P + L   +  + +YR  L E+FFDR    F+ VL+ Y   GEL  P  +       E+ ++ + ++ +E+           ++  L D        DDE      +   +YLW  F  P +S  A   A+   + V+LS+  F AE+ P F++  +   +     + ++   +   +        ++  C+ +F ++L IR    PN++ F  + + +++ IS++PY + +    +      E S    L V+  +R+  V RILK+ R+   LQVL  TLR+S+++++ +L F+ +A + F++ IY  +   D+  F S+P  FWW+++T+TTVGYGD+ P    G +VGS C+L GVL++A  VP++ N+F   Y
Sbjct:   52 VNVSGLRFETERRTLERYPGTLLGDASRRAPFYRPDLGEFFFDRHRSSFESVLHFYQSGGELRRPCAVPPLTFVGEVLFFDLGDEAVERL---------REEEGLAD--------DDEQRLPSGKV-RRYLWNLFEHPDTSTSAKATAVFSLVMVLLSVVTFCAETLPTFRNRHHRRHQHGRNDSADSQPSSEWMDPFSDPLFLVETVCIAWFGLELLIRAFACPNKLAFARDPMNIVDFISILPYGITLAMDQLGSSATGEKSKASNLAVLRTMRLLRVCRILKLSRHSQALQVLAKTLRASFQEIVTLLIFVAIAVVLFASAIYFAEVGADEAHFNSVPDAFWWAVVTLTTVGYGDMTPVTLPGKLVGSMCALTGVLLIALPVPVIANNFTTIY 429          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO38237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ4])

HSP 1 Score: 246.514 bits (628), Expect = 9.409e-76
Identity = 147/426 (34.51%), Postives = 239/426 (56.10%), Query Frame = 2
Query:  290 MDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN-FFSEYDDEPND------------NCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYS---GLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSIL 1504
            + D   + INVGG   ET  STL  IP+++L+ +  +S       +EYFFDR P  F  VLN++R G+LH P  +CGP+ E+EL +WG+ E+ +E CCW  Y Q +  + +L  F    F++  DEP +            NC +     LW+T ++P SSK+A I++    +F+ LSI  F A + P  + N    S+                     G  +I+  C  FFS +LF+R +  P+++ F   ++  I+ +++IP+YV+IF  Y   I              +R+F V+RI+++ R+     GLQ+++ TL++S  +L+L+L  + +  + FS+++Y+V+         FTS+P  FWW +ITMTTVGYGD+ P+ + G I+G AC++ GVL+VA  + ++ ++F LYY+HAQ+ L
Sbjct:   12 IADSSRIIINVGGFRHETSVSTLQNIPDTRLSWIAENSTVNEDNKREYFFDRHPTAFCQVLNFYRTGKLHCPTEMCGPMFEEELIFWGIDEKQMEPCCWGTYTQHREAEENLKAFVGPGFNDLKDEPAENHMGSYGSINELNCWKRIQPQLWETLDEPHSSKMAKIFSYTSCLFIALSIATFCATTMPAIRKNNIMGSRE--------------------GLDHIEMFCSIFFSFELFMRLISCPSKLHFCRGIMNWIDFVAIIPFYVNIF--YPNPI--------------VRMFLVIRIMRLFRFIKLSYGLQIMIQTLKASSHELVLLLLMVLIPMVMFSSIVYYVEVIIEGRGAQFTSVPESFWWCLITMTTVGYGDMTPQTWPGKIIGGACAICGVLIVALPISVIGSNFNLYYAHAQARL 401          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 234.572 bits (597), Expect = 3.036e-71
Identity = 146/435 (33.56%), Postives = 238/435 (54.71%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKL---AQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFEN--FFSEYDDEPNDNCCR--------------TWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGF------LKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQ---NVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQE 1519
            V INVGG   ET +STL  IP+++L   A+ +  +  +     EYFFDR P +F  VLNY+R G+LH PL +CGPL E EL +WG+ +Q +E CCW+ Y Q +  + +L  FE   F +EY+D+   +  R               W +Y   +W    +P SS LA + A      +++S+  F  ES  KF         V L                       +  CV +F+++L +RF+  P + +F   ++  I+ ++++P+YV +              GF      +  + ++R+  + RI K+ R+ SGLQ+L +TLR+S+++LLL++ F+ +  + F++LI++ + +     F  IP+ FWW+++TMTTVGYGD+ P+   G  +GS C++ GVL +A  VP++VN+F LYYSHAQ+ L + ++
Sbjct:    3 VSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDDQQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGRYGFNFAAESEPDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESMEKFSEKYLKDLLVIL-----------------------EGICVVWFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSL--------------GFNNNNNDIDALMIIRLIRIFRIFKLSRHSSGLQILGHTLRASFRELLLLIFFLLIGVVLFASLIFYCEKKIPGTKFVDIPSSFWWAVVTMTTVGYGDMAPQSPSGKFIGSLCAVCGVLTIALPVPVIVNNFSLYYSHAQARLKLPKK 400          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 232.646 bits (592), Expect = 2.102e-70
Identity = 142/432 (32.87%), Postives = 234/432 (54.17%), Query Frame = 2
Query:  272 INENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVY---YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCC-------------RTWTK----YLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNV---FTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            + E  N  D   V INVGG   ET   TL  IP+++L  +  +      +     E+FFDR P +F  VLN++R G+LH P  +CGPL E EL +WG+ E  +E CCW++Y Q +  + +L  F++  S+ +   + +               RTW K     +W  F +P SS  A + A I    +I S+  F  E+ PKF + + +   V  I                     ++  CV +F+++   R +  P+++ F    +  I++ +++P+Y+ +    I R    +    L+VV ++R+F   RI K+ R+  GLQ+L +TLRSS  +L L++ F+ +  + FS++I++ +       FT+IP  FWW+++TMTT+GYGD+ P  + G IVGS C++ GVL++A  VP++V++F LYYSHA++
Sbjct:    8 LEEQTNAGD--RVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPEFDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDELQVEPCCWLNYKQHREAQANLDPFDHHDSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETVPKFDNPKTSEGFVLYI---------------------LEAVCVAWFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYLTL----IVRESNFKTIVVLRVVRLIRVF---RIFKLSRHSYGLQILGHTLRSSCSELFLLVFFLTIGVVIFSSVIFYAEKDTKGTHFTTIPHTFWWAVVTMTTLGYGDMVPITWQGQIVGSLCAVCGVLMIALPVPVIVSNFSLYYSHAKA 409          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO31803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW6])

HSP 1 Score: 230.72 bits (587), Expect = 7.716e-69
Identity = 137/402 (34.08%), Postives = 219/402 (54.48%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV---DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNV---FTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQ 1495
            V INV G  FET  +TL + PE+ L   +    +Y ++ KEYFFDRDP++F+ +LNY+R G+LH P   C    E EL+++G+ E ++  CCW  + + K +    +   D  +  S+  DE  D+  R   + LW  F  P SSK+A ++  I  +                F +    S+ VE +P            ++   F  ++  CV  F+V+   R    P+R+KF  +++++I++++++P+YV +       +    +SG    + V RIF   RI K  R+  GL++L YTL+S   +L  +L  + +A + F+T++Y+V+   V   F SIPA FW++I+TMTT+GYGD+ P    G IVGS CSL GVLV+A  VP++V++F   Y   Q
Sbjct:   40 VTINVSGRRFETWRNTLARFPETLLGS-DEKDYFYDAETKEYFFDRDPDLFRHLLNYYRNGKLHYPRGECVSSFEDELEFFGISEDVVHDCCWEDFRERKKECMERIFEPDKLDDASQNGDEVTDHSIR---EKLWTAFQNPQSSKVASVFYYITGL----------------FIAISVISTVVETLPCKGKTSCGEVHKTV---FFSLEAACVVVFTVEYVARLYSAPDRVKFARDLLSIIDVVAILPFYVGLI------VPNNSISGAFVTLRVFRIF---RIFKFSRHSRGLRILGYTLKSCASELGFLLFSLSMAVIIFATVMYYVEKGEVDTKFISIPASFWYTIVTMTTLGYGDMVPTTVPGKIVGSLCSLSGVLVIALPVPVIVSNFSRIYLQNQ 409          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO45172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTZ3])

HSP 1 Score: 216.468 bits (550), Expect = 4.455e-64
Identity = 148/451 (32.82%), Postives = 248/451 (54.99%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL--NV-HSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDF--ENFFSEYDDEPNDNCCRT---------WTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVD-IFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQE------DNLNSMTDDERIYLNH 1567
            + + +NVGG   ET  ST+   P+++L  +  NV  ++ Y S+  E FFDR P+IF  VLNY+R G+LH P  +CGPL E+EL YWG+ E+ +E CCW  Y Q +  +++L  F   +F ++ D +  +    T         W KY   +W    +P SS+ A  + I+  + ++LS+    A + P+F +   + S                 +S ++ F  I++ C  +F+++L +R L  PN+  F  +    ++++SVIP+YV  IF H  +            +   L++  +LR+ +  R   GLQV+++TL++S  +L L+L  + +  + FS++IY+V+         F SIP  FWWS+ITMTTVGYGD+ P+ + G I+G AC++ GVL+VA  + ++ ++F LYY+HAQ+ L + ++      D L +    +  +L H
Sbjct:   10 KRITLNVGGQKHETYLSTIRNYPDTRLYWVVENVTKAIDYHSEKIELFFDRHPKIFDQVLNYYRTGKLHCPNDVCGPLFEEELAYWGIDEKEMEPCCWTTYTQHREAEHNLKSFNVTDFSTDIDSDRQEETETTSKAKGLHPFWVKYQPRIWAILEEPRSSRTAKAFWILSVLLIVLSVATACAITLPQFATEGGSVSSE---------------SSAYVAFTVIEYICGVWFTIELGLRLLFCPNKRTFFKSYSFWVDVLSVIPFYVRLIFPHEHD------------LADALQVIRLLRLFRFFRLLYGLQVIMHTLKASSYELFLLLLILLIPVVLFSSIIYYVEKNIDGKTTKFRSIPESFWWSLITMTTVGYGDMTPRTWEGKIIGGACAIFGVLMVALPISVIGSNFSLYYAHAQARLKLPKKKTKIHFDTLATAMPRQVCHLMH 433          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000007744.2 (potassium voltage-gated channel subfamily C member 4 [Source:NCBI gene;Acc:101165306])

HSP 1 Score: 276.174 bits (705), Expect = 1.429e-84
Identity = 156/448 (34.82%), Postives = 248/448 (55.36%), Query Frame = 2
Query:  278 ENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLA-------QLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFE-------------NFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKF---------KSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            E    +D   + INVGGT  ET +STL  +P ++LA       Q++  SV       E+F+DR P IF  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE              F  E   + + +CC  W   LW  F+ P SS+ A   A +   F++LSI  F  E+H  F          +N +  SK EL            G+ +  G + +   CV +F+++  +R +C PN+  F+ N + +I+ ++++P+Y+++    +       + GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +            +   F +IP  FWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:   28 EMARGEDSDKIVINVGGTRHETYKSTLRTLPGTRLAWLAEPDAQVSTDSVAEPPSAAEFFYDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMSYRQHRDAEAALEIFEPPDPDDTDDEAPRRFGIEDCSDRSRSCCEVWQPKLWALFDDPYSSRAARGVAFVSLFFILLSITTFCLETHDAFNEWMDKVFQGNNTSGKSKAEL-----------GGSKILHGVEGV---CVFWFTLEFLVRIICCPNKCFFIKNTLNIIDFVAILPFYLEMCLEGLSSKAAKNVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASVNEFLLLVIFLALGVLIFATMIYYAERIGASPNDPTGFNHTHFKNIPISFWWAVVTMTTLGYGDMYPQTWLGMMVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 458          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 260.381 bits (664), Expect = 2.215e-79
Identity = 156/441 (35.37%), Postives = 236/441 (53.51%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R VR+NVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL +WG+ E  +E CC   Y Q K Q    +  + EN      +E    CC    K LW    KPSSS  A I AI+  +F+ILS  A    + P+ +         E   A +N + A           +++  C+ +F+++  +RFL +P++ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   +   F SIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   28 RRVRLNVGGLLHEVLWRTLERLPRTRLGKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENMREREGEEFTTTCCSEKRKKLWDLLEKPSSSFAAKILAIVSILFIILSTIALSLNTLPELQDTD------EFGQASDNPQLA-----------HVEAVCIAWFTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 445          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc2 (potassium voltage-gated channel subfamily C member 2 [Source:NCBI gene;Acc:101159160])

HSP 1 Score: 261.151 bits (666), Expect = 9.919e-79
Identity = 151/449 (33.63%), Postives = 244/449 (54.34%), Query Frame = 2
Query:  293 DDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHS---------------VYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFE---------------NFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKF-----KSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD------------DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            DD   + +NVGGT  ET +STL  +P ++LA L   S               + Y ++ K+YFFDR P +F  VLNY+R G+LH P  +CGPL E+EL +WG+ E  +E CCW+ Y Q +  + +L  FE                   +   + N    R W   +W  F  P SS+ A   A     F+++SI  F  E+H  F     K+N   +S  +L+P                   Y++  CV +F+++  +R    P +++F+ NV+ +I+ ++++P+Y+++    +      ++ GFL+VV  +RI   LRI K+ R++ GL+VL +TLR+S  + LL++ F+ +  L F+T+IY+ +                F +IP GFWW+++TMTT+GYGD+YP+ + G +VG+ C+L GVL +A  VP++VN+F +YYS A +
Sbjct:    5 DDNERIILNVGGTRHETYKSTLKTLPGTRLALLASDSDIDSVLDQLQQVPGFIEYNARTKQYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETDVEPCCWMTYRQHRDAEEALDVFELNVDNGDEDDDVGGGLGIEDVHVDGNAGLWRKWQPVIWNLFEDPYSSRAARFVAFASLFFILVSITTFCLETHEAFNTIINKTNMRNNSCQDLVPQYEIETDP--------ALTYVEGVCVFWFTIEFLVRVTFCPVKLEFVKNVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRI---LRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGAKANDPTASQHTKFKNIPIGFWWAVVTMTTLGYGDMYPETWSGMVVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMA 442          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 264.618 bits (675), Expect = 2.588e-78
Identity = 154/441 (34.92%), Postives = 237/441 (53.74%), Query Frame = 2
Query:  302 RTVRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL 1582
            R VR+NVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL +WG+ E  +E CC   Y Q K Q    +  + EN      +E    CC    K LW    KPSSS  A I AI+  +F+ILS  A    + P+ +               + +EF    ++  +   +++  C+ +F+++  +RFL +P++ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   +   F SIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++
Sbjct:   28 RRVRLNVGGLLHEVLWRTLERLPRTRLGKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENMREREGEEFTTTCCSEKRKKLWDLLEKPSSSFAAKILAIVSILFIILSTIALSLNTLPELQ---------------DTDEFGQASDNPQLA--HVEAVCIAWFTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSM 445          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnb1 (potassium voltage-gated channel subfamily B member 1 [Source:NCBI gene;Acc:101167947])

HSP 1 Score: 256.529 bits (654), Expect = 3.382e-78
Identity = 163/468 (34.83%), Postives = 245/468 (52.35%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQL---NVHSVY------YRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLV--DFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD---DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTL-------KRMSFY-------SFLPEFDSL 1627
            VR+NVGG + E L  TL ++P ++L +L   N H         Y     EYFFDR P  F  +LN++R G+LH+   +C     +EL +WG+ E  +E CC   Y Q K Q    +  + EN      +E    CC    K LW    KPSSS  A I AI+  +F+ILS  A    + P+ +         E   A +N + A           +++  C+ +F+++  +RFL +P++ KF    + VI++++++PYYV IF     +   ++     +VV + RI  +LRILK+ R+ +GLQ L +TLR SY +L L++ F+ +  + FS+L++  +   +   F SIPA FWW+ ITMTTVGYGDIYPK   G IVG  C + GVLV+A  +PI+VN+F  +Y   +     RQE  +      ER   N +  ++       +R  F+       S  P FDSL
Sbjct:    5 VRLNVGGLLHEVLWRTLERLPRTRLGKLRDCNTHDSIMEICDDYSLDGNEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDFWGIDEIYLESCCQARYHQKKEQMNEELKREAENMREREGEEFTTTCCSEKRKKLWDLLEKPSSSFAAKILAIVSILFIILSTIALSLNTLPELQDTD------EFGQASDNPQLA-----------HVEAVCIAWFTMEYLLRFLSSPSKWKFFKGPLNVIDLLAILPYYVTIFLTESNKSV-LQFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEEDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFYKEQK-----RQEKAIKRREALERAKRNGSIVSMNFKDAFGRRERFHIPLLQYESRTPVFDSL 449          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000069015.1 (SMESG000069015.1)

HSP 1 Score: 1132.47 bits (2928), Expect = 0.000e+0
Identity = 567/567 (100.00%), Postives = 567/567 (100.00%), Query Frame = 2
Query:   92 MSRHYVNSIKIPLPKSWKNRDKDTIYDLHRNIKKRNSNILKKTRSFLHPNDANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTLKRMSFYSFLPEFDSLSSKKRVSNFPAENMRRNSPIGECKEDSLIFKKPSNNEIEKTNDIRSHSMNHRPRT 1792
            MSRHYVNSIKIPLPKSWKNRDKDTIYDLHRNIKKRNSNILKKTRSFLHPNDANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYAIIVSIFVILSIFAFIAESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTLKRMSFYSFLPEFDSLSSKKRVSNFPAENMRRNSPIGECKEDSLIFKKPSNNEIEKTNDIRSHSMNHRPRT
Sbjct:    1 MSRHYVNSIKIPLPKSWKNRDKDTIYDLHRNIKKRNSNILKKTRSFLHPNDANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCRTWTKYLWKTFNKPSSSKLAMIYAIIVSIFVILSIFAFIAESHPKFKSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTLKRMSFYSFLPEFDSLSSKKRVSNFPAENMRRNSPIGECKEDSLIFKKPSNNEIEKTNDIRSHSMNHRPRT 567          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000058857.1 (SMESG000058857.1)

HSP 1 Score: 263.077 bits (671), Expect = 7.583e-80
Identity = 151/454 (33.26%), Postives = 260/454 (57.27%), Query Frame = 2
Query:  236 PNDANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPND-------------NCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHG-----NSMWIG---FQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYI----ERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            P+D +  I  G     +++ D R + +N+GG   ET ++TL KIP ++L++L      Y   L E+FFDR P +F  +LNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q ++ + +L   ++   + D    D             N  + W +     W  F +P SS  A + A+I   F+I SI +F  ++ P+F+    T S   L   LN+   +N       NS +     F YI+  C  +F +++F+RF+  P +++F+ + I +I+I++++ ++VD F        E+ + +E+  F  ++ ++R+F      K+ R+ SGL +L++T R+S K+L+L++ F+ V  + F+ L+Y+ +       N F SIP G WW+I+TMTTVGYGD+ PK + G +VG+ C++ GVL ++  VP++V++F ++YSH Q+
Sbjct:   11 PSDTSATIY-GFYYRQMSIADHRVI-LNIGGFRHETYKATLKKIPATRLSRLTEALANYDPILNEFFFDRHPAVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTQYRNTQETLQILDDIEVDPDGSSEDRYIKFGLEEKYRNNTLKWWHRVKVQTWTMFEEPYSSTSAKMVAVISISFIIFSILSFCLKTAPRFRI--PTISNKSLTVILNDAHRSNLTTWYLVNSFYQSHKYFSYIEAICNSWFIIEIFVRFVSAPTKLEFIKSPINIIDILALVSFFVDTFLSNTELLSEKFHNLEVLEFFSIIRIMRLF------KLTRHISGLNILLHTFRASMKELILLVFFLIVFIVIFAALMYYAERFQHNKYNDFNSIPQGLWWAIVTMTTVGYGDMVPKTYMGMMVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 454          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000058857.1 (SMESG000058857.1)

HSP 1 Score: 262.307 bits (669), Expect = 7.701e-80
Identity = 147/438 (33.56%), Postives = 254/438 (57.99%), Query Frame = 2
Query:  284 LNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPND-------------NCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFKSNQNTSSKVELIPALNNNEFANHG-----NSMWIG---FQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYI----ERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            +++ D R + +N+GG   ET ++TL KIP ++L++L      Y   L E+FFDR P +F  +LNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y Q ++ + +L   ++   + D    D             N  + W +     W  F +P SS  A + A+I   F+I SI +F  ++ P+F+    T S   L   LN+   +N       NS +     F YI+  C  +F +++F+RF+  P +++F+ + I +I+I++++ ++VD F        E+ + +E+  F  ++ ++R+F      K+ R+ SGL +L++T R+S K+L+L++ F+ V  + F+ L+Y+ +       N F SIP G WW+I+TMTTVGYGD+ PK + G +VG+ C++ GVL ++  VP++V++F ++YSH Q+
Sbjct:    1 MSIADHRVI-LNIGGFRHETYKATLKKIPATRLSRLTEALANYDPILNEFFFDRHPAVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDANQVEPCCWMTYTQYRNTQETLQILDDIEVDPDGSSEDRYIKFGLEEKYRNNTLKWWHRVKVQTWTMFEEPYSSTSAKMVAVISISFIIFSILSFCLKTAPRFRI--PTISNKSLTVILNDAHRSNLTTWYLVNSFYQSHKYFSYIEAICNSWFIIEIFVRFVSAPTKLEFIKSPINIIDILALVSFFVDTFLSNTELLSEKFHNLEVLEFFSIIRIMRLF------KLTRHISGLNILLHTFRASMKELILLVFFLIVFIVIFAALMYYAERFQHNKYNDFNSIPQGLWWAIVTMTTVGYGDMVPKTYMGMMVGALCAITGVLTISLPVPVIVSNFSMFYSHTQA 429          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000025883.1 (SMESG000025883.1)

HSP 1 Score: 259.225 bits (661), Expect = 7.580e-79
Identity = 167/423 (39.48%), Postives = 245/423 (57.92%), Query Frame = 2
Query:  293 DDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWG-MPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPN---DNCCRTWTKYLWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXES--HPKF-----------KSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGV---LRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVDDQN--VFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQ 1495
            D   TV +NV G  FE L STL K+P+ + A + +  +Y R  L+EYFFDRDP++FK +LNY R+GELH+P  ICGP+  KEL  WG M    IE CC +       +  +L  F+N F E + E     D   R +  ++W   ++P+SS  A+IYAII+ + V+ S+F FI +S  HP F           K    +    E++   N  +  N      I    I      F + D+  R + T     F+ N  T+I+I+S+IP+Y ++          I ++ F +   ++R+  +   LR  +ILR+Y GLQVL+YT++ S  DLLLM+ FI +AT+ FSTL+++V+++    FT+IP  FWW I+T+TT GYGD+ P    GY++   C+L GVLV+AFTVPILVN+F+LYY+HA 
Sbjct:   15 DPDSTVIVNVRGKRFELLWSTLKKLPDLENA-IRIRGIY-RKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVR-FRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRT-IQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSLSIGLRCFRILRHYRGLQVLLYTIKVSSFDLLLMMIFISLATIIFSTLMFYVENKTNPKFTNIPRAFWWCIVTITTTGYGDMVPITGVGYLIAGLCALCGVLVIAFTVPILVNNFILYYTHAS 433          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 254.603 bits (649), Expect = 1.958e-76
Identity = 147/427 (34.43%), Postives = 244/427 (57.14%), Query Frame = 2
Query:  308 VRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWGMPEQIIEKCCWIHYIQLKSQKYSL-------VDFE-----NFFSEY--DDEPNDNCCRTWTKY---LWKTFNKPSSSKLAMIYXXXXXXXXXXXXXXXXXESHPKFK------SNQNTSSKVELIP--ALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGVLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD-----DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVAFTVPILVNSFMLYYSHAQS 1498
            V +NVGG   ET ++TL KIP ++L++L      Y   L EYFFDR P +F  +LNY+R G+LH P  +CGPL E+EL++WG+    +E CCW+ Y   +S + +L       +D E       +  +  ++E  DN    W K+   +W    +P SS LA + + I    +++SI +F  +++P +          N S   +L    +L+  E   H       F Y +  C  +FS++L +R + T +   F  +V+ +I+I +++ +Y+D+   Y    + IE S  ++ + +LRI   +R+ K+ R+ SGL++L+ T ++S K+L L++ F+ V    F+ LIY+ +     + N FTSIP G WW+I TMTTVGYGD+ PK + G +VG+ C++ GVL ++  VP++V++F ++YSH Q+
Sbjct:    8 VILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWGLDSNQVEPCCWMTYTAHRSTQDTLQILDRIDIDTERTSESELYKRFGLEEEFEDNELSFWQKWRPRIWSVLEEPYSSVLAKLVSGIGISIILISIISFCMKTYPGYSIPLILNHTYNVSIGGDLFQSWSLSQKEIQPH-----TVFFYTECICNAWFSIELILRMIVTASCRSFFHDVLNIIDIFALLSFYIDVSFVY----FNIEKSHLIEFMSILRI---MRLFKLTRHISGLKILILTFKASAKELSLLVFFLVVFIAVFAALIYYAEKFTKNELNDFTSIPNGLWWAICTMTTVGYGDMVPKTYPGMLVGALCAVTGVLTISLPVPVIVSNFSMFYSHTQA 422          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC49.524e-7933.78potassium voltage-gated channel subfamily C member... [more]
KCNC41.225e-7833.78potassium voltage-gated channel subfamily C member... [more]
KCNC41.225e-7833.78potassium voltage-gated channel subfamily C member... [more]
KCNC41.327e-7833.78potassium voltage-gated channel subfamily C member... [more]
KCNB23.914e-7735.60potassium voltage-gated channel subfamily B member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-16.801e-7633.03SHaW family of potassium channels [Source:UniProt... [more]
shw-16.801e-7633.03SHaW family of potassium channels [Source:UniProt... [more]
shw-19.074e-7633.03SHaW family of potassium channels [Source:UniProt... [more]
shw-19.685e-7633.03SHaW family of potassium channels [Source:UniProt... [more]
shw-11.006e-7533.03SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw2.950e-7832.48gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw2.969e-7832.48gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw3.299e-7732.48gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw3.898e-7732.48gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw5.744e-7731.94gene:FBgn0003386 transcript:FBtr0289989[more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc45.987e-8133.99potassium voltage-gated channel, Shaw-related subf... [more]
kcnc48.709e-8133.99potassium voltage-gated channel, Shaw-related subf... [more]
kcnc48.709e-8133.99potassium voltage-gated channel, Shaw-related subf... [more]
kcnb26.618e-8035.83potassium voltage-gated channel, Shab-related subf... [more]
kcnb21.644e-7935.83potassium voltage-gated channel, Shab-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC41.413e-8335.45potassium channel, voltage gated Shaw related subf... [more]
KCNB22.499e-7735.15potassium channel, voltage gated Shab related subf... [more]
tamm416.664e-7534.60TAM41 mitochondrial translocator assembly and main... [more]
tamm417.006e-7534.60TAM41 mitochondrial translocator assembly and main... [more]
tamm418.878e-7534.60TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc43.174e-7833.70potassium voltage gated channel, Shaw-related subf... [more]
Kcnb23.929e-7835.37potassium voltage gated channel, Shab-related subf... [more]
Kcnb23.929e-7835.37potassium voltage gated channel, Shab-related subf... [more]
Kcnc47.194e-7833.70potassium voltage gated channel, Shaw-related subf... [more]
Kcnb19.123e-7735.83potassium voltage gated channel, Shab-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03721|KCNC4_HUMAN5.885e-7833.78Potassium voltage-gated channel subfamily C member... [more]
sp|Q63734|KCNC4_RAT6.448e-7833.92Potassium voltage-gated channel subfamily C member... [more]
sp|Q8R1C0|KCNC4_MOUSE2.220e-7733.70Potassium voltage-gated channel subfamily C member... [more]
sp|A6H8H5|KCNB2_MOUSE2.748e-7735.37Potassium voltage-gated channel subfamily B member... [more]
sp|P17972|KCNAW_DROME2.976e-7732.48Potassium voltage-gated channel protein Shaw OS=Dr... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q86MY42.159e-15954.69Potassium channel Kv3.2 OS=Notoplana atomata OX=22... [more]
K1Q1865.280e-9439.24Potassium voltage-gated channel protein Shaw OS=Cr... [more]
A0A1S3KDT67.255e-9140.57potassium voltage-gated channel protein Shaw OS=Li... [more]
A0A2C9JUN92.264e-9038.30BTB domain-containing protein OS=Biomphalaria glab... [more]
A0A2C9JUN61.279e-8938.46BTB domain-containing protein OS=Biomphalaria glab... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc26.286e-8133.86potassium voltage-gated channel, Shaw-related subf... [more]
kcnc23.596e-8033.86potassium voltage-gated channel, Shaw-related subf... [more]
kcnb21.313e-7935.83potassium voltage-gated channel subfamily B member... [more]
ENSAMXT00000048024.12.126e-7733.33potassium voltage-gated channel subfamily C member... [more]
kcnc1b2.742e-7731.96potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a2.514e-8233.93potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000004235.15.995e-7734.17pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
KCNA32.132e-5629.79potassium voltage-gated channel subfamily A member... [more]
kcnf1b6.992e-5630.32potassium voltage-gated channel, subfamily F, memb... [more]
ENSPMAT00000006566.11.261e-5329.55pep scaffold:Pmarinus_7.0:GL476463:190204:191544:-... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382379.409e-7634.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427243.036e-7133.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398042.102e-7032.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318037.716e-6934.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451724.455e-6432.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007744.21.429e-8434.82potassium voltage-gated channel subfamily C member... [more]
kcnb12.215e-7935.37potassium voltage-gated channel subfamily B member... [more]
kcnc29.919e-7933.63potassium voltage-gated channel subfamily C member... [more]
kcnb12.588e-7834.92potassium voltage-gated channel subfamily B member... [more]
kcnb13.382e-7834.83potassium voltage-gated channel subfamily B member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069015.10.000e+0100.00SMESG000069015.1[more]
SMESG000058857.17.583e-8033.26SMESG000058857.1[more]
SMESG000058857.17.701e-8033.56SMESG000058857.1[more]
SMESG000025883.17.580e-7939.48SMESG000025883.1[more]
SMESG000054802.11.958e-7634.43SMESG000054802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035114 ID=SMED30035114|Name=Potassium voltage-gated channel protein Shaw|organism=Schmidtea mediterranea sexual|type=transcript|length=1793bp
TTTCAGTTGGGATTTTTAATACAATTACCGCTTTATAACAAATGCTATCC
ATTTGAGAAGACTTCTTTAAAAACGAAGTTTTAAAGACGTCATGTCAAGA
CATTACGTCAACAGTATCAAAATTCCTTTGCCGAAATCTTGGAAAAATAG
AGATAAAGATACAATTTATGATTTACACAGAAATATAAAAAAAAGAAATT
CGAACATTTTGAAAAAGACCAGGTCCTTTCTCCACCCAAATGATGCAAAT
TTAAACATCGAAAACGGTGATATTAACGAAAATTTAAACATGGACGACAT
TAGAACAGTTCGCATCAATGTCGGAGGAACAATTTTCGAAACCCTAGAAT
CCACTCTCCATAAAATTCCAGAGTCTAAACTTGCTCAATTAAATGTTCAT
TCGGTGTATTACCGCTCGCAATTAAAAGAGTATTTTTTTGATCGAGATCC
AGAAATTTTCAAAGTAGTTTTGAATTACCATAGGATTGGAGAATTACATT
TGCCACTCCATATTTGTGGACCGTTATTGGAAAAGGAACTTCAGTATTGG
GGAATGCCTGAACAAATTATTGAAAAATGCTGTTGGATACATTATATTCA
GTTGAAATCACAAAAATATTCCCTAGTTGATTTTGAGAATTTCTTTTCAG
AATATGACGATGAACCAAATGATAATTGCTGTCGTACATGGACAAAATAT
CTTTGGAAAACTTTCAATAAGCCATCATCTTCAAAATTAGCTATGATTTA
TGCTATTATTGTATCTATTTTTGTTATTCTTTCAATTTTTGCTTTCATTG
CCGAATCACATCCTAAGTTCAAATCCAATCAAAATACCTCATCAAAGGTT
GAACTGATCCCAGCCTTAAATAACAATGAATTTGCCAACCATGGAAACTC
TATGTGGATCGGATTTCAATACATAGACTTTTGTTGTGTTGGATTTTTCT
CAGTTGATTTGTTTATTCGGTTCTTGTGTACTCCGAATCGAATGAAATTT
CTCAGTAATGTTATTACAGTAATCGAAATTATATCAGTCATTCCATACTA
TGTTGACATTTTCGGGCATTATATAGAAAGAATCTATAAAATTGAATTAT
CAGGTTTTCTAAAAGTTGTCCACGTTTTAAGAATTTTTGGAGTTTTGCGG
ATTTTAAAAATTCTCCGATACTACAGTGGACTGCAGGTTTTGGTATATAC
CCTTCGATCAAGCTATAAAGACCTTCTGTTGATGTTGACCTTTATCGGAG
TTGCGACATTATTTTTTTCTACTTTAATCTACCATGTTGACGATCAAAAT
GTGTTCACTAGCATTCCGGCGGGATTTTGGTGGTCAATTATCACAATGAC
AACTGTGGGATACGGAGATATTTACCCAAAGTACTTTGGTGGTTACATAG
TTGGATCTGCTTGTTCATTAGTTGGCGTATTAGTAGTAGCTTTCACAGTT
CCGATATTGGTAAACAGTTTCATGTTATACTATTCTCACGCTCAAAGCAT
ATTAATGATTCGTCAAGAAGATAATCTTAACTCAATGACAGATGACGAAC
GGATCTATCTAAATCACACATTCAAAACCTTAAAAAGAATGTCATTTTAC
AGTTTCCTGCCGGAGTTTGATAGCTTATCGTCGAAAAAACGAGTTTCTAA
TTTCCCCGCGGAAAATATGAGACGGAATTCACCTATTGGAGAATGCAAGG
AAGATTCGTTAATTTTTAAAAAACCTTCAAACAATGAAATTGAGAAAACA
AATGATATTAGATCTCACTCAATGAATCACAGACCAAGGACAC
back to top

protein sequence of SMED30035114-orf-1

>SMED30035114-orf-1 ID=SMED30035114-orf-1|Name=SMED30035114-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=567bp
MSRHYVNSIKIPLPKSWKNRDKDTIYDLHRNIKKRNSNILKKTRSFLHPN
DANLNIENGDINENLNMDDIRTVRINVGGTIFETLESTLHKIPESKLAQL
NVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKEL
QYWGMPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPNDNCCRTW
TKYLWKTFNKPSSSKLAMIYAIIVSIFVILSIFAFIAESHPKFKSNQNTS
SKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNR
MKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFG
VLRILKILRYYSGLQVLVYTLRSSYKDLLLMLTFIGVATLFFSTLIYHVD
DQNVFTSIPAGFWWSIITMTTVGYGDIYPKYFGGYIVGSACSLVGVLVVA
FTVPILVNSFMLYYSHAQSILMIRQEDNLNSMTDDERIYLNHTFKTLKRM
SFYSFLPEFDSLSSKKRVSNFPAENMRRNSPIGECKEDSLIFKKPSNNEI
EKTNDIRSHSMNHRPRT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR027359Volt_channel_dom_sf
IPR003968K_chnl_volt-dep_Kv
IPR003974K_chnl_volt-dep_Kv3
IPR028325VG_K_chnl
IPR000210BTB/POZ_dom
IPR005821Ion_trans_dom
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0051260protein homooligomerization
GO:0006810transport
GO:0034765regulation of ion transmembrane transport
GO:0071805potassium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 348..374
score: 45.28
coord: 405..427
score: 71.31
coord: 434..460
score: 50.48
coord: 113..132
score: 50.77
coord: 277..300
score: 28.65
coord: 377..400
score: 26.55
coord: 211..239
score: 33.1
coord: 303..323
score: 30.14
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 361..467
e-value: 6.3E-23
score: 82.5
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 67..180
e-value: 3.3E-37
score: 129.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 536..567
NoneNo IPR availablePANTHERPTHR11537:SF252SHAW-LIKE, ISOFORM Ccoord: 72..470
NoneNo IPR availableCDDcd18379BTB_POZ_Kv3_KCNCcoord: 73..172
e-value: 1.80531E-36
score: 129.437
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 215..461
NoneNo IPR availableTMHMMTMhelixcoord: 435..457
NoneNo IPR availableTMHMMTMhelixcoord: 403..425
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 274..296
NoneNo IPR availableTMHMMTMhelixcoord: 216..238
NoneNo IPR availableTMHMMTMhelixcoord: 378..396
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 129..144
score: 56.6
coord: 114..127
score: 56.35
coord: 147..168
score: 48.74
IPR003968Potassium channel, voltage dependent, KvPRINTSPR01491KVCHANNELcoord: 113..123
score: 69.85
coord: 445..456
score: 52.22
coord: 353..361
score: 43.7
coord: 377..391
score: 21.56
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 71..171
e-value: 3.4E-7
score: 39.9
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 73..163
e-value: 6.9E-25
score: 87.2
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 219..467
e-value: 1.4E-26
score: 93.2
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 189..360
e-value: 5.1E-35
score: 122.4
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 72..470
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 72..170