GCR158

Overview
NameGCR158
Smed IDSMED30035110
Length (bp)1274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR158 (SMED30035110) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR158 (SMED30035110) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR158 (SMED30035110) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR158 (SMED30035110) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035110

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30035110h1SMcG0014929 dd_Smed_v4_10399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035110h1SMcG0014929 dd_Smed_v4_10399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035110h1SMcG0014929 GCR158smed_ncbi_20240424PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR158 vs. TrEMBL
Match: A0A193KUF9 (GCR158 OS=Schmidtea mediterranea OX=79327 GN=gcr158 PE=2 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 8.682e-152
Identity = 302/305 (99.02%), Postives = 305/305 (100.00%), Query Frame = 3
Query:  141 MLSNSTTDANIKEGEAXXXXXXXXXXXXXXXXXXXXXXXVMKKNYFKFDQQSIHYLFQMLIVCXXXXXXXXXXXXXVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGLISILNPINSRQFWNLSNIKRIFITYXXXXXXXXXXXXXXXXXXXDSNVKQNINYAIKFGLXXXXXXXXXXXXXXXXXXXCLIYRRQMDRCDKSMKRKQCLKSQSTETEENFSDDESGRNKITVKRWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI 1055
            MLSNSTTDANIKEGEAIIFSIFIIIFLLSVFLNSILLYLVMKKNYFKFDQQSIHYLFQMLIVCDLLISILILPDILVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGL+SILNPINSRQFWNLSNIKRIFITYLSVIVVLLLVKSILLLSNLDSNVKQNINYAIKFGLSLIGMIFIVMIIIIYSYLFCLIYRRQMDRCDKSMKRKQCLKSQSTETEENFS+DESGRNKITVK+WNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI
Sbjct:    1 MLSNSTTDANIKEGEAIIFSIFIIIFLLSVFLNSILLYLVMKKNYFKFDQQSIHYLFQMLIVCDLLISILILPDILVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGLVSILNPINSRQFWNLSNIKRIFITYLSVIVVLLLVKSILLLSNLDSNVKQNINYAIKFGLSLIGMIFIVMIIIIYSYLFCLIYRRQMDRCDKSMKRKQCLKSQSTETEENFSEDESGRNKITVKQWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI 305          
BLAST of GCR158 vs. Planmine SMEST
Match: SMESG000012028.1 (SMESG000012028.1)

HSP 1 Score: 442.195 bits (1136), Expect = 2.415e-155
Identity = 302/305 (99.02%), Postives = 305/305 (100.00%), Query Frame = 3
Query:  141 MLSNSTTDANIKEGEAXXXXXXXXXXXXXXXXXXXXXXXVMKKNYFKFDQQSIHYLFQMLIVCXXXXXXXXXXXXXVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGLISILNPINSRQFWNLSNIKRIFITYXXXXXXXXXXXXXXXXXXXDSNVKQNINYAIKFGLXXXXXXXXXXXXXXXXXXXCLIYRRQMDRCDKSMKRKQCLKSQSTETEENFSDDESGRNKITVKRWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI 1055
            MLSNSTTDANIKEGEAIIFSIFIIIFLLSVFLNSILLYLVMKKNYFKFDQQSIHYLFQMLIVCDLLISILILPDILVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGL+SILNPINSRQFWNLSNIKRIFITYLSVIVVLLLVKSILLLSNLDSNVKQNINYAIKFGLSLIGMIFIVMIIIIYSYLFCLIYRRQMDRCDKSMKRKQCLKSQSTETEENFS+DESGRNKITVK+WNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI
Sbjct:    1 MLSNSTTDANIKEGEAIIFSIFIIIFLLSVFLNSILLYLVMKKNYFKFDQQSIHYLFQMLIVCDLLISILILPDILVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGLVSILNPINSRQFWNLSNIKRIFITYLSVIVVLLLVKSILLLSNLDSNVKQNINYAIKFGLSLIGMIFIVMIIIIYSYLFCLIYRRQMDRCDKSMKRKQCLKSQSTETEENFSEDESGRNKITVKQWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI 305          
BLAST of GCR158 vs. Planmine SMEST
Match: SMESG000012027.1 (SMESG000012027.1)

HSP 1 Score: 177.563 bits (449), Expect = 4.890e-52
Identity = 129/267 (48.31%), Postives = 183/267 (68.54%), Query Frame = 3
Query:  258 VMKKNYFKFDQQSIHYLFQMLIVCXXXXXXXXXXXXXVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGLISILNPINSRQFWNLSNIKRIFITYXXXXXXXXXXXXXXXXXXXDSNVKQNINYAIKFGLXXXXXXXXXXXXXXXXXXXCLIYRRQMDRCDKSMKRKQCLKSQSTETEE-NFSDDESGRNKITVKRWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFLFI 1055
            V K+NYF FD+Q+ H LFQ+LI  DL+ISILILP++L+K+   +   H AV +FR++RD++ISIQ+FLL+ IA+DGL+SIL PI +  FWNL++I + F +Y  VI ++ +VK ++   NL   + + IN   K  + +IG I +  I+ IY  LF LI+R+Q DR  K  K++          EE NF D  +  +K  +++   G++I+ MKFVKVLF VNLLM++SFLP  LYNSGLL++  + W  YLFY+HSLGDAIIFLF+
Sbjct:   44 VTKRNYFDFDKQASHKLFQILIALDLVISILILPNVLIKRFAKDPT-HLAVDVFRSVRDSVISIQVFLLLLIAVDGLVSILYPIQT--FWNLNSITKTFASYSVVISLIFIVKLVVFNVNLSCGLVKKINRYFKLTMGVIGGIIMATILSIYVCLFVLIFRQQFDRHVKFPKQRPTSPLPVRRNEERNFQDQRT--SKFGLEKLMLGQKILQMKFVKVLFLVNLLMVISFLPVSLYNSGLLRYSYFKWASYLFYIHSLGDAIIFLFV 305          
BLAST of GCR158 vs. Planmine SMEST
Match: SMESG000062328.1 (SMESG000062328.1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.951e-19
Identity = 103/280 (36.79%), Postives = 173/280 (61.79%), Query Frame = 3
Query:  258 VMKKNYFKFDQQSIHYLFQMLIVCXXXXXXXXXXXXXVKKTVTNGKYHPAVIL---FRAMRDALISIQIFLLVAIAIDGLISILNPINSRQFWNLSNIKRIFITYXXXXXXXXXXXXXXXXXXXDSNVKQNINYAIKFGLXXXXXXXXXXXXXXXXXXXCLIYRRQM-DRCD-------KSMKRKQCLKSQSTETEENFSDD------ESGRNKITVKRWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIF 1046
            V+KK+ F  +++S H LFQ+LI  DL+ISILILP+IL+K      K H   I+   + A+RD  IS Q+ +LV IAID L++ L P+++  FW +  + ++F  +  + ++   ++  LL  N++ ++K++I+  +K  + + G I +V+ +IIY  LF L+ RRQ+ +  D       KS+  K+ L+S+S    EN  +       +S  +++  K     ++I  +KFVKVLF VNLLMI+S+LP  LYN+  ++F +++ + YLF++H+LGD I+F
Sbjct:   51 VIKKDKFIHEKKSFHKLFQVLIFLDLIISILILPNILIK---MYSKDHDTFIVLDGYLAIRDFAISSQMIILVLIAIDRLLAFLLPLSN--FWRIGRVLKVFKIFFILTLLFYSIRFTLLTVNINCDIKKSIDSDVKLFIGIFGGILMVINLIIYCILFALLCRRQIFNHKDSLLSANFKSLNVKE-LESKSIPKIENKKNSSNAMLLQSDFSQVKFKVIPANRKIGSIKFVKVLFGVNLLMIISYLPAILYNAECIQFPSFSVY-YLFFLHALGDPILF 323          
BLAST of GCR158 vs. Planmine SMEST
Match: SMESG000062349.1 (SMESG000062349.1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.553e-18
Identity = 95/271 (35.06%), Postives = 159/271 (58.67%), Query Frame = 3
Query:  258 VMKKNYFKFDQQSIHYLFQMLIVCXXXXXXXXXXXXXVKKTVTNGKYHPAVILFRAMRDALISIQIFLLVAIAIDGLISILNPINSRQFWNLSNIKRIFITYXXXXXXXXXXXXXXXXXXXDSNVKQNINYAIKFGLXXXXXXXXXXXXXXXXXXXCLIYRRQMDRCDKSMKRKQCLKS-QSTETEENFSDDESGRNK------ITVKRWNFGKRIIHMKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIFL 1049
            V K   +  +++  H LFQ LI  DL+ISILILP+IL+K+   +   +  + +F A+RD  IS Q+  LV IAID L + +NP+++  +W L+ +  I    +  + +  + + ILL   +    K+ I+   K  + + G +F+++ ++IY  LF L+ +RQ+ R   S    +  ++ QS   +EN  ++E+   K      +  ++  F +RI  +KF KVL  +N+LMIVS+LPG LYN+  + F +Y+ + YLF++H+LGD IIFL
Sbjct:   43 VTKIESYAHEKRVFHKLFQFLIFLDLIISILILPNILIKRFTEDTDTNIFLDVFLAIRDLSISAQMITLVLIAIDRLFAFVNPLSN--YWVLNTVMWILKVLMLFLSLSYITRLILLSIGISCLNKKKIDKYGKIIIGISGGVFMLINLVIYVSLFSLLCQRQLVRQRNSFNSDKFYRAMQSKSYDENPEENETSITKSRRISSLNSRKLRFRRRIGSIKFAKVLLGINILMIVSYLPGVLYNNKFIPFPSYSVY-YLFFLHALGDPIIFL 310          
BLAST of GCR158 vs. Planmine SMEST
Match: SMESG000077660.1 (SMESG000077660.1)

HSP 1 Score: 58.151 bits (139), Expect = 4.338e-9
Identity = 26/52 (50.00%), Postives = 39/52 (75.00%), Query Frame = 3
Query:  891 MKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAIIF 1046
            ++F K LF +NLLMI+S+LP  LYN   + F +Y+ + YLF++H+LGD I+F
Sbjct:  261 IRFAKPLFAINLLMIISYLPAILYNVRFVGFHSYSVY-YLFFLHALGDPILF 311          
The following BLAST results are available for this feature:
BLAST of GCR158 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A193KUF98.682e-15299.02GCR158 OS=Schmidtea mediterranea OX=79327 GN=gcr15... [more]
back to top
BLAST of GCR158 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR158 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012028.12.415e-15599.02SMESG000012028.1[more]
SMESG000012027.14.890e-5248.31SMESG000012027.1[more]
SMESG000062328.11.951e-1936.79SMESG000062328.1[more]
SMESG000062349.11.553e-1835.06SMESG000062349.1[more]
SMESG000077660.14.338e-950.00SMESG000077660.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035110 ID=SMED30035110|Name=GCR158|organism=Schmidtea mediterranea sexual|type=transcript|length=1274bp
TCGATCTCGCTGTGATTCATCACTGAGATTCTACAGAGAGAGAATTTACA
TTCCAAACTTTGATTGAAAAGACTATTAAATTGAATAAAATATCAAATAC
TAATAAACAATTTTTCACAATTGGAATTTAATCTCTGAAAATGCTTTCAA
ATTCCACTACTGACGCAAATATCAAAGAAGGCGAAGCGATTATATTTTCC
ATTTTCATCATCATATTCCTGTTGTCTGTGTTTTTGAATTCGATTCTCCT
GTATTTGGTGATGAAAAAGAACTACTTTAAGTTTGATCAGCAATCAATTC
ATTATTTATTCCAAATGCTTATCGTTTGTGATCTGTTGATTTCGATTTTG
ATTTTGCCAGACATTCTTGTAAAGAAAACTGTAACCAACGGAAAATACCA
TCCGGCTGTCATTCTATTCCGAGCGATGCGAGATGCGTTAATTTCCATTC
AAATATTTCTATTGGTCGCTATTGCAATCGACGGATTGATATCGATTTTG
AATCCAATCAACTCCAGGCAATTCTGGAACCTTTCCAATATCAAGCGCAT
ATTCATCACATATTTGAGCGTCATCGTCGTATTACTATTGGTCAAATCAA
TTTTGCTTCTTTCCAACCTCGATTCAAACGTTAAACAGAATATTAATTAT
GCGATCAAATTTGGTTTGAGTCTGATAGGAATGATTTTTATTGTGATGAT
TATTATTATCTATTCATATTTGTTTTGTTTAATCTATCGCCGGCAAATGG
ATCGCTGTGACAAATCAATGAAGAGAAAACAATGCCTAAAATCTCAAAGC
ACAGAAACGGAGGAGAATTTCAGTGATGATGAAAGTGGGAGAAATAAAAT
CACTGTGAAACGATGGAACTTTGGGAAAAGGATAATTCATATGAAATTTG
TCAAGGTATTATTTTGGGTGAATCTTTTGATGATAGTTTCCTTTTTACCG
GGTTGCCTCTACAACTCGGGGCTGCTGAAATTCAAAGCTTACAATTGGTT
CATTTATTTATTCTACGTTCATTCTCTTGGAGACGCAATCATTTTCCTTT
TCATAAGGCTGGATTTAAGAAAAGACCTGACAAAACTTTTGAGACTTGGG
TAAACAATAAACAAAGATATCTGATAATAATTTCATGAACAAACAATTTT
CCTTTATTACTGCTATTTTTTTATTATTCTAAGCCTTTTCTGTGGGATTT
TAAAGATTTTTAGATTTCTTTCTATTTTGATTGGTTGCTTTTGTTTCAAA
TATAATAAATAATTTTCTTTCATT
back to top

protein sequence of SMED30035110-orf-1

>SMED30035110-orf-1 ID=SMED30035110-orf-1|Name=SMED30035110-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=321bp
MLSNSTTDANIKEGEAIIFSIFIIIFLLSVFLNSILLYLVMKKNYFKFDQ
QSIHYLFQMLIVCDLLISILILPDILVKKTVTNGKYHPAVILFRAMRDAL
ISIQIFLLVAIAIDGLISILNPINSRQFWNLSNIKRIFITYLSVIVVLLL
VKSILLLSNLDSNVKQNINYAIKFGLSLIGMIFIVMIIIIYSYLFCLIYR
RQMDRCDKSMKRKQCLKSQSTETEENFSDDESGRNKITVKRWNFGKRIIH
MKFVKVLFWVNLLMIVSFLPGCLYNSGLLKFKAYNWFIYLFYVHSLGDAI
IFLFIRLDLRKDLTKLLRLG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 17..41
score: 18.13
coord: 284..310
score: 19.49
coord: 53..74
score: 23.01
coord: 97..119
score: 22.8
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 33..271
e-value: 3.3E-11
score: 43.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 7..320
e-value: 1.1E-22
score: 82.4
NoneNo IPR availablePANTHERPTHR24246OLFACTORY RECEPTOR AND ADENOSINE RECEPTORcoord: 12..316
NoneNo IPR availablePANTHERPTHR24246:SF27ADENOSINE RECEPTOR, ISOFORM Acoord: 12..316
NoneNo IPR availableCDDcd150537tmA_D2-like_dopamine_Rcoord: 50..140
e-value: 7.7522E-4
score: 38.4809
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 12..318
NoneNo IPR availableTMHMMTMhelixcoord: 53..75
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 18..40
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 32..270
score: 12.468