Protein kinase

Overview
NameProtein kinase
Smed IDSMED30035101
Length (bp)1515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30035101) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30035101) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30035101) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30035101) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035101

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30035101SMESG000024804.1 dd_Smed_v4_3989_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30035101SMESG000024804.1 dd_Smed_v6_3989_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035101SMESG000024804.1 dd_Smed_v4_3989_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30035101SMESG000024804.1 dd_Smed_v4_3989_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 132.88 bits (333), Expect = 5.500e-33
Identity = 86/284 (30.28%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + +G YG +     S G ++ A+K++   T+ N +    +   L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYTKQIL+G+++LHEN ++H D+K  N++L      KL D GC+R +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P    H  +   D      +     ++ ++RP+A  LLK  F
Sbjct:  243 WTKGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTS-NKLAAEKEYRKLQEEVDLLKA---LKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRFGP-LPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL----------AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD-----FVRMCLTRDQHERPSALQLLKHSF 505          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 131.724 bits (330), Expect = 1.046e-31
Identity = 86/284 (30.28%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + +G YG +     S G ++ A+K++   T+ N +    +   L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYTKQIL+G+++LHEN ++H D+K  N++L      KL D GC+R +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P    H  +   D      +     ++ ++RP+A  LLK  F
Sbjct:  948 WTKGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTS-NKLAAEKEYRKLQEEVDLLKA---LKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL----------AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD-----FVRMCLTRDQHERPSALQLLKHSF 1210          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 128.642 bits (322), Expect = 1.183e-31
Identity = 88/285 (30.88%), Postives = 139/285 (48.77%), Query Frame = 1
Query:  646 EFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            EFS       GR  K+     S G ++ A+K++   T+ N +    +   L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYTKQIL+G+++LHEN ++H D+K  N++L      KL D GC+R +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P    H  +   D      +     ++ ++RP+A  LLK  F
Sbjct:  192 EFSTSHMKYSGRSIKVYCGLTSQG-QLIAVKQVALDTS-NKLAAEKEYRKLQEEVDLLKA---LKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL----------AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD-----FVRMCLTRDQHERPSALQLLKHSF 455          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 131.339 bits (329), Expect = 1.215e-31
Identity = 86/284 (30.28%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + +G YG +     S G ++ A+K++   T+ N +    +   L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYTKQIL+G+++LHEN ++H D+K  N++L      KL D GC+R +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P    H  +   D      +     ++ ++RP+A  LLK  F
Sbjct: 1061 WTKGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTS-NKLAAEKEYRKLQEEVDLLKA---LKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL----------AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD-----FVRMCLTRDQHERPSALQLLKHSF 1323          
BLAST of Protein kinase vs. Ensembl Human
Match: MAP3K19 (mitogen-activated protein kinase kinase kinase 19 [Source:HGNC Symbol;Acc:HGNC:26249])

HSP 1 Score: 131.339 bits (329), Expect = 1.215e-31
Identity = 86/284 (30.28%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + +G YG +     S G ++ A+K++   T+ N +    +   L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYTKQIL+G+++LHEN ++H D+K  N++L      KL D GC+R +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P    H  +   D      +     ++ ++RP+A  LLK  F
Sbjct: 1061 WTKGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTS-NKLAAEKEYRKLQEEVDLLKA---LKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL----------AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD-----FVRMCLTRDQHERPSALQLLKHSF 1323          
BLAST of Protein kinase vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 115.931 bits (289), Expect = 5.976e-28
Identity = 84/298 (28.19%), Postives = 140/298 (46.98%), Query Frame = 1
Query:  619 FCLTSICFNEFSEGQF-----IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F L S   N+  E  F     +  G YG + K        + AIKK+   T+L ++I    KE  +++   +KY        + KYYG+  K   ++I M++   GSI +++    + L ++ +    +  L+GL +LH+ + IH D+K+ NILL+T+   KL D G + +  +++ K +                 +  GT   MAPE+I+ + YD KADIWS   T  EM +G+P ++       +  +     P +KK    E    +    + S  IK+P +R TA  L +  F
Sbjct:   20 FKLDSSALNKPPEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAIKKVPVDTDLQEII----KEISIMQQCKSKY--------VVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRN-----------------TVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKK---PEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTF 285          
BLAST of Protein kinase vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 115.931 bits (289), Expect = 1.446e-27
Identity = 84/298 (28.19%), Postives = 140/298 (46.98%), Query Frame = 1
Query:  619 FCLTSICFNEFSEGQF-----IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F L S   N+  E  F     +  G YG + K        + AIKK+   T+L ++I    KE  +++   +KY        + KYYG+  K   ++I M++   GSI +++    + L ++ +    +  L+GL +LH+ + IH D+K+ NILL+T+   KL D G + +  +++ K +                 +  GT   MAPE+I+ + YD KADIWS   T  EM +G+P ++       +  +     P +KK    E    +    + S  IK+P +R TA  L +  F
Sbjct:   20 FKLDSSALNKPPEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAIKKVPVDTDLQEII----KEISIMQQCKSKY--------VVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRN-----------------TVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKK---PEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTF 285          
BLAST of Protein kinase vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 115.546 bits (288), Expect = 1.653e-27
Identity = 84/298 (28.19%), Postives = 140/298 (46.98%), Query Frame = 1
Query:  619 FCLTSICFNEFSEGQF-----IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F L S   N+  E  F     +  G YG + K        + AIKK+   T+L ++I    KE  +++   +KY        + KYYG+  K   ++I M++   GSI +++    + L ++ +    +  L+GL +LH+ + IH D+K+ NILL+T+   KL D G + +  +++ K +                 +  GT   MAPE+I+ + YD KADIWS   T  EM +G+P ++       +  +     P +KK    E    +    + S  IK+P +R TA  L +  F
Sbjct:   20 FKLDSSALNKPPEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAIKKVPVDTDLQEII----KEISIMQQCKSKY--------VVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRN-----------------TVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKK---PEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTF 285          
BLAST of Protein kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 112.849 bits (281), Expect = 3.459e-26
Identity = 82/284 (28.87%), Postives = 141/284 (49.65%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYT-KQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F++ + I RG +G++ K   +   R+ AIK I+ +    D IE++++E  ++    ++Y        +TKY+G+ +KG K++I M++  GGS  +L  +   G  DE  +    ++IL+GL +LH  R IH D+K+ N+L+    + K+ D G + +  E++ K                   +  G+   MAPE+I+  SYD KADIWS   T  E+ +G+P  +      VL  + K   P  +  +  +         ++    K+P  RP+A  LLK  F
Sbjct:   34 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLE-QAEDEIEDIQQEIQVLSQCDSQY--------VTKYFGSFLKGSKLWIIMEYLGGGSALDLTKS---GKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRI-----------------TFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSK----PFKEFVEMCLNKDPENRPSASTLLKHQF 284          
BLAST of Protein kinase vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 113.235 bits (282), Expect = 3.526e-26
Identity = 82/284 (28.87%), Postives = 141/284 (49.65%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYT-KQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F++ + I RG +G++ K   +   R+ AIK I+ +    D IE++++E  ++    ++Y        +TKY+G+ +KG K++I M++  GGS  +L  +   G  DE  +    ++IL+GL +LH  R IH D+K+ N+L+    + K+ D G + +  E++ K                   +  G+   MAPE+I+  SYD KADIWS   T  E+ +G+P  +      VL  + K   P  +  +  +         ++    K+P  RP+A  LLK  F
Sbjct:  184 FTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLE-QAEDEIEDIQQEIQVLSQCDSQY--------VTKYFGSFLKGSKLWIIMEYLGGGSALDLTKS---GKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRI-----------------TFVGSPFWMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQGSQWSK----PFKEFVEMCLNKDPENRPSASTLLKHQF 434          
BLAST of Protein kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 114.39 bits (285), Expect = 1.437e-26
Identity = 75/277 (27.08%), Postives = 133/277 (48.01%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G YG + K      S I AIK +  +++L+++I    KE  +++   + Y        + +YYG+  K Y ++I M++   GS+ +++    + L ++ +       L+GL +LH  R IH D+K+ NILL+TE   KL D G + +  +++ K +                 +  GT   MAPE+I+ + YD  ADIWS   T  EM +G+P +        +  + +   P +++    +    + I  +    +KEP+ R TA  LL+  F
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEII----KEISIMQQCDSPY--------VVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRN-----------------TVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFRE---PDRWSTEFIDFVSKCLVKEPDDRATATELLEHEF 292          
BLAST of Protein kinase vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 114.39 bits (285), Expect = 1.437e-26
Identity = 75/277 (27.08%), Postives = 133/277 (48.01%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G YG + K      S I AIK +  +++L+++I    KE  +++   + Y        + +YYG+  K Y ++I M++   GS+ +++    + L ++ +       L+GL +LH  R IH D+K+ NILL+TE   KL D G + +  +++ K +                 +  GT   MAPE+I+ + YD  ADIWS   T  EM +G+P +        +  + +   P +++    +    + I  +    +KEP+ R TA  LL+  F
Sbjct:   48 LGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEII----KEISIMQQCDSPY--------VVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRN-----------------TVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFRE---PDRWSTEFIDFVSKCLVKEPDDRATATELLEHEF 292          
BLAST of Protein kinase vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 113.62 bits (283), Expect = 1.966e-26
Identity = 81/282 (28.72%), Postives = 140/282 (49.65%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F++ + I +G +G++ K   +   ++ AIK I+ +    D I+++++E +++    + Y        +TKYYG+ +KG K++I M++  GGS  +L+        +  +    +++L+GL +LH  R +H D+K+ N+LL  + + KL D G +  +   N  S+++              +  GT   MAPE+I+   YD KADIWS   T  E+  G+P  +      VL  + K   P       K   D      +++   K+P  RPTAK LLK  F
Sbjct:   13 FTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLE-EAEDEIDDIQQEIMVLSQCDSPY--------VTKYYGSFLKGTKLWIIMEYLGGGSALDLMKA--GSFEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQL--TNTTSKRN--------------TFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQLTGSYTKSFKD-----FVEACLNKDPENRPTAKELLKYPF 262          
BLAST of Protein kinase vs. Ensembl Fly
Match: mbt (gene:FBgn0025743 transcript:FBtr0074285)

HSP 1 Score: 105.145 bits (261), Expect = 1.386e-23
Identity = 72/278 (25.90%), Postives = 132/278 (47.48%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLG-CSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYK-KHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            I  G  G +         R  A+KK+       D+ +  ++E L  E+ I +   +  H  I + Y + +   ++++ M++  GG++ +++      + +E++    KQ L+ L++LH   +IH D+KS +ILL  +   KL+D G C++  + L K                  +S  GT   M+PE+I  L Y  + DIWS    + EM DG+P F  +     + ++   + P+ K  H++      ++ S +D M +++P +R TA  LL   F
Sbjct:  374 IGEGSTGTVCIATDKSTGRQVAVKKM-------DLRKQQRRELLFNEVVIMR---DYHHPNIVETYSSFLVNDELWVVMEYLEGGALTDIVTH--SRMDEEQIATVCKQCLKALAYLHSQGVIHRDIKSDSILLAADGRVKLSDFGFCAQVSQELPKR-----------------KSLVGTPYWMSPEVISRLPYGPEVDIWSLGIMVIEMVDGEPPFFNEPPLQAMRRIRDMQPPNLKNAHKVSP----RLQSFLDRMLVRDPAQRATAAELLAHPF 618          
BLAST of Protein kinase vs. Ensembl Fly
Match: Slik (gene:FBgn0035001 transcript:FBtr0072363)

HSP 1 Score: 103.99 bits (258), Expect = 5.975e-23
Identity = 85/283 (30.04%), Postives = 135/283 (47.70%), Query Frame = 1
Query:  676 GRYGKISKIFQSGGSRIFAIK--KINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYS-QKHSKAGIQMKHKELPQSKFGTANNMAPEMI-----QGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHR--IKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G +GK+ K       R  A K  ++  + NL+D          MVEI+I    SE+ H  I + Y A     K+++ +++  GG++  ++  L + L + ++    K + EGL+FLH N++IH DLK+ N+LL  E   KL D G S    + NK++ QKH              +  GT   MAPE++     +   YD K DIWS   T+ E+   +P  +      VL+K+ K E P  ++     KE  D      +    +K+P  RPT  +L++  F
Sbjct:   46 GAFGKVYKAQHKEQKRFAAAKMCQLEDEENLSD---------HMVEIDI---LSEIKHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLHRNKVIHRDLKAGNVLLTMEGGVKLADFGVS----AKNKHTMQKHD-------------TFIGTPYWMAPELVLCETFRDNPYDHKVDIWSLGITLIELAQMEPPNSEMSPMRVLLKIQKSEPPKLEQPSRWSKEFND-----FLKKSLVKDPQVRPTTDVLMQHAF 294          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 128.642 bits (322), Expect = 2.896e-31
Identity = 90/282 (31.91%), Postives = 144/282 (51.06%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   + +   R  A+K++ +  +  +  + +   AL  EI + K    L HERI +YYG +   ++  + IFM++  GGSI + L +    L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G SR ++++       S  GI        +S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A     P    H    +  C+    +  +F+ E  +RP A+ LL+  F
Sbjct:  365 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVS--ALECEIQLLK---NLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSY-GALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICL-----SGTGI--------KSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLPPH---VSDHCR--DFLKRIFV-ETKQRPAAEDLLRHTF 621          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 128.642 bits (322), Expect = 2.965e-31
Identity = 90/282 (31.91%), Postives = 144/282 (51.06%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   + +   R  A+K++ +  +  +  + +   AL  EI + K    L HERI +YYG +   ++  + IFM++  GGSI + L +    L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G SR ++++       S  GI        +S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A     P    H    +  C+    +  +F+ E  +RP A+ LL+  F
Sbjct:  357 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVS--ALECEIQLLK---NLFHERIVQYYGCLRDTHEKTLSIFMEYMPGGSIKDQLKSY-GALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICL-----SGTGI--------KSVTGTPYWMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLPPH---VSDHCR--DFLKRIFV-ETKQRPAAEDLLRHTF 613          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 122.865 bits (307), Expect = 4.301e-31
Identity = 85/284 (29.93%), Postives = 146/284 (51.41%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + +G YG +     S G ++ A+K++    + +++ E  + + L  E+++ K    L H  I  + G  +    + IFM++  GGSI  +L      LP++  + Y++QILEG+++LH NR+IH DLK  NI+L      KL D GC+R +  L   +   SK        +L +S  GT   MAPE+I    +  K+DIWS   T++EM  G+P  A   +   L  +   +G +P         +TD K    + +   ++  +RP+A+ LL+  F
Sbjct:   21 WTKGEVLGKGAYGTVYCGLTSQG-QLIAVKQVALDASTSEIAEK-EYDRLEREVDLLK---NLKHTNIVGFLGTALSENIVSIFMEYIPGGSISNILGQFGP-LPEKVFVLYSQQILEGVAYLHANRVIHRDLKGNNIMLMPTGVVKLIDFGCARRLSCLQ--TSTGSKG-------DLLKSVHGTPYWMAPEVINETGHGRKSDIWSIGCTVFEMATGKPPLAHMNKMAALYYIGARRGLMPSLSD---DFSTDAK--DFVQACLTRDQRQRPSAEELLRHPF 284          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 22 [Source:ZFIN;Acc:ZDB-GENE-070928-11])

HSP 1 Score: 127.872 bits (320), Expect = 4.602e-31
Identity = 91/284 (32.04%), Postives = 140/284 (49.30%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGY--KMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + +G+ + RG +G +   +     R  A K++ +     +  + +   AL  EI + K    L HERI +YYG +      K+ IF++F  GGSI + L      L ++   +YT+QIL+G+ +LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        +S  GT   M+PE+I G  Y  KADIWS A T+ EM   +P +A  +    + K+A        K  + E         +  +F++E   RPTA+ LL   F
Sbjct:  360 WRQGKLLGRGAFGVVYLCYDVDTGRELAAKQVPFDPECQETSKEVN--ALECEIQLLK---NLHHERIVQYYGCLRDPVQKKLSIFVEFMPGGSIKDQLKAY-GALTEKVTRRYTRQILQGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC-----MSGTGI--------KSVTGTPYWMSPEVINGEGYGRKADIWSVACTVVEMLTQKPPWAEYEAMAAIFKIAT----QPTKPNLPEGVSDACRDFLRQIFVEE-KWRPTAEGLLSHPF 619          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 125.176 bits (313), Expect = 3.770e-30
Identity = 89/285 (31.23%), Postives = 143/285 (50.18%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   +     R  A K++++     +  + +   AL  EI + K    L HERI +YYG +    +  + IFM++  GGS+ + L      L +    KYT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++       S  G+        +S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A     P    H I E+T       +  +F+ E   RP+A+ LL+  F
Sbjct:  344 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEVS--ALECEIQLLK---NLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAY-GALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM-----SSTGV--------RSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPSH-ISEHTR----DFLRCIFV-EAKYRPSAEELLRHPF 603          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 133.265 bits (334), Expect = 1.201e-32
Identity = 89/281 (31.67%), Postives = 143/281 (50.89%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + RG +G++   +     R  A+K++ +  +  +  + +   AL  EI + K      HERI +YYG +      K+ IF+++  GGSI + L      L +    +YT+QIL+G+S+LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P ++  +    + K+A        K R+ +         M  +F++E  +RPTA+ LL+  F
Sbjct:  364 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVN--ALECEIQLLKLHR---HERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAY-GALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTIC-----MSGTGI--------KSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPT----KPRLPDTVSDACRDFMKQIFVEE-KRRPTAEELLRHLF 620          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 132.88 bits (333), Expect = 1.315e-32
Identity = 89/281 (31.67%), Postives = 143/281 (50.89%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + RG +G++   +     R  A+K++ +  +  +  + +   AL  EI + K      HERI +YYG +      K+ IF+++  GGSI + L      L +    +YT+QIL+G+S+LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P ++  +    + K+A        K R+ +         M  +F++E  +RPTA+ LL+  F
Sbjct:  357 GKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEVN--ALECEIQLLKLHR---HERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAY-GALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTIC-----MSGTGI--------KSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPT----KPRLPDTVSDACRDFMKQIFVEE-KRRPTAEELLRHLF 613          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 127.102 bits (318), Expect = 1.032e-30
Identity = 92/283 (32.51%), Postives = 146/283 (51.59%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKK-EALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   + +   R  A+K++ +     D +E  K+  AL  EI + K    L+HERI +YYG +    +  + IFM++  GGSI + L      L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G S+ ++++         +G  MK      S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A     P    H + E+  C+    +  +F+ E   RP+++ LL+  F
Sbjct:  342 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDP---DSLETSKEVNALECEIQLLK---NLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAY-GALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTI-------CLSGTGMK------SVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPAH-VSEH--CR--DFLKRIFV-EAKVRPSSEELLRHTF 598          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 126.716 bits (317), Expect = 1.668e-30
Identity = 92/283 (32.51%), Postives = 146/283 (51.59%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKK-EALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   + +   R  A+K++ +     D +E  K+  AL  EI + K    L+HERI +YYG +    +  + IFM++  GGSI + L      L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G S+ ++++         +G  MK      S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A     P    H + E+  C+    +  +F+ E   RP+++ LL+  F
Sbjct:  370 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDP---DSLETSKEVNALECEIQLLK---NLLHERIVQYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAY-GALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTI-------CLSGTGMK------SVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPAH-VSEH--CR--DFLKRIFV-EAKVRPSSEELLRHTF 626          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 125.561 bits (314), Expect = 4.361e-30
Identity = 87/284 (30.63%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAII-KGYK-MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   +     R  A K++ +  +  +  + +   AL  EI + K    L H+RI +YYG++  KG K + IFM++  GGS+ + L      L +    +YT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A          ++  NT  +    +  + + E  +RPTA+ L++  F
Sbjct:  347 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEVS--ALECEIQLLK---NLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAY-GALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTIC-----MSGTGI--------RSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIAT----QPTNPQLPPNTSEQCRDFVKRILV-EARQRPTAEELIRHPF 606          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 125.946 bits (315), Expect = 1.082e-30
Identity = 84/284 (29.58%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + RG YG +     S G ++ A+K++   T+     E   ++ L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYT+QIL+G+++LH+N ++H D+K  N++L      KL D GC++          + + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P       +   D   + L      ++ ++RP+A  LLK  F
Sbjct:  248 WTKGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRK-LQEEVDLLKA---LKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAK----------RLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCL-----TRDQHERPSALQLLKHSF 510          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 126.331 bits (316), Expect = 1.868e-30
Identity = 88/285 (30.88%), Postives = 142/285 (49.82%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   +     R  A K++ +  +  +  + +   AL  EI + K    L HERI +YYG +    +  + IFM++  GGS+ + L      L +    KYT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A     P    H  +   D      +  +F+ E  +RP+A+ LL  +F
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVS--ALECEIQLLK---NLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAY-GALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM-----SGTGI--------RSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRD-----FLRRIFV-EARQRPSAEELLTHHF 621          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 125.561 bits (314), Expect = 3.131e-30
Identity = 90/282 (31.91%), Postives = 140/282 (49.65%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   +     R  A+K++ +     +  + +   AL  EI + K    L+HERI +YYG +    +  + IFM++  GGSI + L      L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G S+ ++++         +G  MK      S  GT   M+PE+I G  Y  KADIWS A T+ EM   +P +A  +    + K+A     P    H      D      +  +F+ E   RP+A+ LL+  F
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEVN--ALECEIQLLK---NLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAY-GALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTI-------CLSGTGMK------SVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRD-----FLKRIFV-EAKLRPSAEELLRHMF 615          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 124.405 bits (311), Expect = 1.728e-29
Identity = 113/410 (27.56%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  298 GYLPLHIASQGSNHEVLKFLLGQNCNIES------KDSNGWRPIHFAVLNKNMNNIKLLFGFGCE---LSMNDEILQDLINRPDYQDVKNIITTAIKNYQVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G +   I   G N E+   LLG  C +E       KD+N  + +      KN+N +    G   E       D  LQ  IN     D +N +T+  K     K ++        H+  +       +++G+ + RG YG +     S G ++ A+K++   T+     E   ++ L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYT+QIL+G+++LH+N ++H D+K  N++L      KL D GC++ +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P       +   D   + L      ++ ++RP+A  LLK  F
Sbjct: 1138 GKISQEILDPGKNEELTDELLG--CLVEELLALDEKDNNSCQIMTNEADAKNLNLVFSRRGNTIEELGRETTDVKLQRCINGFRIYDEENFLTSNEKKTLSDKSLN--------HEEAIF------WTKGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRK-LQEEVDLLKA---LKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRL----------AWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCL-----TRDQHERPSALQLLKHSF 1510          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 123.635 bits (309), Expect = 2.799e-29
Identity = 113/410 (27.56%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  298 GYLPLHIASQGSNHEVLKFLLGQNCNIES------KDSNGWRPIHFAVLNKNMNNIKLLFGFGCE---LSMNDEILQDLINRPDYQDVKNIITTAIKNYQVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G +   I   G N E+   LLG  C +E       KD+N  + +      KN+N +    G   E       D  LQ  IN     D +N +T+  K     K ++        H+  +       +++G+ + RG YG +     S G ++ A+K++   T+     E   ++ L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYT+QIL+G+++LH+N ++H D+K  N++L      KL D GC++ +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P       +   D   + L      ++ ++RP+A  LLK  F
Sbjct:  934 GKISQEILDPGKNEELTDELLG--CLVEELLALDEKDNNSCQIMTNEADAKNLNLVFSRRGNTIEELGRETTDVKLQRCINGFRIYDEENFLTSNEKKTLSDKSLN--------HEEAIF------WTKGEILGRGAYGTVYCGLTSLG-QLIAVKQVALDTSDKLATEKEYRK-LQEEVDLLKA---LKHVNIVAYLGTCLEENTLSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGIIKLIDFGCAKRL----------AWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPARFSEPAADFVRLCL-----TRDQHERPSALQLLKHSF 1306          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q54R82|MKKA_DICDI (Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 3.512e-32
Identity = 98/295 (33.22%), Postives = 146/295 (49.49%), Query Frame = 1
Query:  646 EFSEGQFIDRGRYGKISKIFQSGGSRIFAIKK-----INWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLK-YTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMK--LAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDINI 1506
            ++ +GQ + RG YG +          +FA+K+     IN    L ++I +  KE       I   RS L H+ I +Y G  +    + +F+++  GGSI  LL     G   E ++K YTKQIL+GLSFLH N IIH D+K  NIL+DT+   KL+D GCS+            S +GI  + K +     GT   MAPE+I+   +   +DIWS    I EM   QP ++   E   +M    +   +P+   H  +E  D      ++  F ++P +RP A  LLK  F +N+
Sbjct:  169 KWQKGQILGRGGYGSVYLGLNKDTGELFAVKQLEIVDINSDPKLKNMILSFSKE-------IEVMRS-LRHDNIVRYLGTSLDQSFLSVFLEYIPGGSISSLLGKF--GAFSENVIKVYTKQILQGLSFLHANSIIHRDIKGANILIDTKGIVKLSDFGCSK------------SFSGIVSQFKSMQ----GTPYWMAPEVIKQTGHGRSSDIWSLGCVIVEMATAQPPWSNITELAAVMYHIASSNSIPNIPSHMSQEAFD-----FLNLCFKRDPKERPDANQLLKHPFIMNL 432          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q56UN5|M3K19_HUMAN (Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens OX=9606 GN=MAP3K19 PE=2 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 5.834e-31
Identity = 86/284 (30.28%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + +G YG +     S G ++ A+K++   T+ N +    +   L  E+++ K    L H  I  Y G  ++   + IFM+F  GGSI  ++N     LP+    KYTKQIL+G+++LHEN ++H D+K  N++L      KL D GC+R +          + AG+   H ++ +S  GT   MAPE+I    Y  K+DIWS   T++EM  G+P  A       +  +   +G +P    H  +   D      +     ++ ++RP+A  LLK  F
Sbjct: 1061 WTKGEILGKGAYGTVYCGLTSQG-QLIAVKQVALDTS-NKLAAEKEYRKLQEEVDLLKA---LKHVNIVAYLGTCLQENTVSIFMEFVPGGSISSIINRF-GPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRL----------AWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMAAMFYIGAHRGLMPPLPDHFSENAAD-----FVRMCLTRDQHERPSALQLLKHSF 1323          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 1.126e-29
Identity = 87/285 (30.53%), Postives = 142/285 (49.82%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   +     R  A K++ +  +  +  + +   AL  EI + K    L HERI +YYG +    +  + IFM++  GGS+ + L      L +    KYT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++         +G  M+      S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A     P    H  +   D      +  +F+ E  +RP+A+ LL  +F
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVS--ALECEIQLLK---NLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAY-GALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTI-------CMSGTGMR------SVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRD-----FLRRIFV-EARQRPSAEELLTHHF 621          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.307e-29
Identity = 88/285 (30.88%), Postives = 142/285 (49.82%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   +     R  A K++ +  +  +  + +   AL  EI + K    L HERI +YYG +    +  + IFM++  GGS+ + L      L +    KYT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A     P    H  +   D      +  +F+ E  +RP+A+ LL  +F
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVS--ALECEIQLLK---NLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAY-GALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM-----SGTGI--------RSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRD-----FLRRIFV-EARQRPSAEELLTHHF 621          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 1.784e-29
Identity = 90/282 (31.91%), Postives = 140/282 (49.65%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   +     R  A+K++ +  +  +  + +   AL  EI + K    L+HERI +YYG +   +   + IFM++  GGSI + L      L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G S+ ++++         +G  MK      S  GT   M+PE+I G  Y  KADIWS A T+ EM   +P +A  +    + K+A     P    H      D      +  +F+ E   RP+A  LL+  F
Sbjct:  359 GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVN--ALECEIQLLK---NLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAY-GALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTI-------CLSGTGMK------SVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRD-----FLKRIFV-EAKLRPSADELLRHMF 615          
BLAST of Protein kinase vs. TrEMBL
Match: A0A0H3YJG2 (Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc42a-1 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 4.513e-45
Identity = 146/479 (30.48%), Postives = 226/479 (47.18%), Query Frame = 1
Query:  190 LDSKRYSAF------IESLKYGDLPTVEQEFQPIFLN-QPDSSGYLPLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDEILQ----------------------------DLINRPDYQ-----DVKNIITTAIKNYQV----GKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDER----LLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLL 1482
            L+ +RYS F      I+++K G +  V++ +    L  +  S    P+  A +  + +++K+ + Q CN++S D    R +H+AV++ N + +KLL   G  +++ D +L                             D + R   Q     D +N+I   IK  Q+      EM LKC   C+HKFC TS    +    + I  G YG +    +SG  R FA+KKI  K N+          A  +E NIN +++ L HERI K++GA  K    YIFM++         L+TL +    ++    LL + KQILE LSFLHE  IIH D+K +N+LLD + N KL+D G S  + S+ +  QK  +               GT    APE++    Y    DIWS  AT+ ++  GQP +    +  ++  ++     +YK   + E     I +L+D M  K+  KR +AK LL
Sbjct:  496 LEYERYSEFEKFGQLIKAIKDGSIEDVKKYYSRRILEIKLGSYSRSPILYACKYGHRKIVKYFIKQKCNVDSFDCEFRRALHYAVISNNNDIVKLLIESGAAINVPDSLLMMPIHLACKVNNIEAAQLLMENNCDMVTLDKLKRSPLQIAETGDFENMIKL-IKECQIIREIAAEMQLKCGKLCNHKFCYTSFQRKKIKNRKCIASGSYGTVFLYNESGTDRKFAVKKIP-KQNI---------RARYIEANINDFKNLLCHERIVKHFGAFHKKENHYIFMEY---------LDTLQKKKYQKKSPGDLLLFAKQILEALSFLHERSIIHRDIKPENVLLDIDGNLKLSDFGLSLLLSSVAEDIQKEGRCC-------------GTYCYAAPEILNAELYTCSVDIWSLGATMIQLCTGQPPYHNLGDGAIITVISTTREIEYK---LPEYMPKYISNLIDHMLEKDQYKRLSAKKLL 938          
BLAST of Protein kinase vs. TrEMBL
Match: D2VYH3 (Predicted protein OS=Naegleria gruberi OX=5762 GN=NAEGRDRAFT_53261 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 3.879e-34
Identity = 100/280 (35.71%), Postives = 145/280 (51.79%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFA--GKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLL 1482
            + +G FI  G  GK+   +     + FAIK+  + +   D++E LK E+L  EIN+ K   EL HE I +YYGA + G  + IF+++  GGS+  LL      L ++ +  YT QIL+GL +LHENRI+H D+K  NIL+  E   KL D G SR I+ +   S +              +S  GT + MAPE+I    +   ADIWS   T+ EM+ G+P F        V+    A  E+P + +  + E   CK    +   FI++PN R T   LL
Sbjct:  399 YKKGDFIGSGASGKVFLGYNLDDGKFFAIKECTFDSVPEDILE-LKLESLQREINLMK---ELCHENIVQYYGAEVTGTTLNIFLEYVPGGSVSSLLRRYGR-LSEDVVRHYTTQILKGLKYLHENRIVHRDIKGANILVSVEGAIKLADFGASRKIQDIMTLSTEF-------------KSLLGTPHFMAPEVIMQTGHGRSADIWSIGCTVVEMYTGKPPFTEFTTAAAVMFHIAASTEMPSFPEF-VSEG--CK--KFLYKCFIRDPNLRATVDDLL 655          
BLAST of Protein kinase vs. TrEMBL
Match: A0A5B8MXT0 (Mitogen-activated protein kinase OS=Chloropicon primus OX=1764295 GN=A3770_17p78750 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 9.907e-34
Identity = 123/408 (30.15%), Postives = 187/408 (45.83%), Query Frame = 1
Query:  289 DSSGYLPLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDEILQDLINRPDYQDVKNIITTAIKNYQVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKG--YKMYIFMDFYHGGSIYELLNTLPEGLPDERLLK-YTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQ-PLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            D   + PLH A    +    + +L Q  +I ++   G  P+  A    + + ++ LF         +E    +  RP  +D  ++   + K  + G EM                    E+ +G+ +  G YG++         +I A+K+I    + +   +NLK  AL  EI   K    L HE I +YYGA +    + MY+F+++  GGSI  +L     G   E L K YTKQIL GL FLHEN+ IH D+K  NIL+  E + KL D G S R++ + N      S +G+        +S  G+   MAPE+++G  +  KADIWS   T+ EM  G+ P          + ++AK E  P   K+  K+  +      +   F  +P KRPTA  LL T F
Sbjct:  317 DQDAFTPLHHACAEGHARCAEVVLSQGASIRARTKGGLTPLQLA----STDGVRDLFNPSSRSRKAEEEDGGVPERPRGRDSNSMFRESSKRIESG-EM--------------------EWKKGELLGEGAYGRVYAGLNHETGQIMAVKQIAVDMDNDKHTDNLK--ALEREIEFYK---TLKHEHIVEYYGAFLDKDQHLMYVFLEYVSGGSISSMLKRF--GPFSEALTKIYTKQILRGLLFLHENKTIHRDVKGANILITQEGSAKLADFGASKRYVNAEN------SGSGLSNS-----KSITGSVYWMAPEVMKGTGHGRKADIWSLGCTVVEMLTGKHPWKEYDNTWTAMFQIAKSESGPGLPKNISKDARE-----FLQLCFQLDPTKRPTALDLLGTQF 676          
BLAST of Protein kinase vs. TrEMBL
Match: T1G1N2 (Protein kinase domain-containing protein OS=Helobdella robusta OX=6412 GN=20214980 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.070e-33
Identity = 90/285 (31.58%), Postives = 145/285 (50.88%), Query Frame = 1
Query:  640 FNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            FN + +G+ +  G +G++   +        A+K++N      D+ + ++  AL  EI   K   +L + RI +YYG+  + + + IFM+F  GGS+ + +      L +    +YTKQ+LEGL FLH   I+H D+K  NIL D E N KLTD G ++ + S+   +   SK     K      +  GT   M+PE+I+G  Y  K DIWS   T+ EM  G P +   +    + K+A    P YK   +  +T  ++   +   F ++P +RP+AK+L    F
Sbjct:    3 FN-WKKGKILGAGGFGQVYLCYDVDTGVELAVKQVNVYCQSEDISKEVR--ALQSEI---KLLQDLSNPRIVQYYGSQKEPHMLSIFMEFVPGGSVKDQIQDYGP-LTESVTKRYTKQVLEGLEFLHSLMIVHRDIKGANILRDHEGNIKLTDFGAAKRLSSIVNKTADVSKNLTGAK------TMTGTPYYMSPEIIEGKRYGRKVDIWSLGCTVVEMLTGHPPWHEYEGVAAIFKIATQPHPSYK---LPPDTSLQVKDFLSCCFERDPERRPSAKILYNHMF 271          
BLAST of Protein kinase vs. TrEMBL
Match: A0A210PFZ5 (Mitogen-activated protein kinase kinase kinase 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24565 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 9.946e-33
Identity = 94/310 (30.32%), Postives = 154/310 (49.68%), Query Frame = 1
Query:  574 GKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELL---NTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G ++D   +   D  F  +    + + +G  +  G +G++   +     R  A+K++N    LN +     KE   +E  I   R+   HERI  Y+G       + IFM++  GGSI + L     L EG+      KYT+Q+LEGL+FLH+N I+H D+K+ N+L D + N KL D G S+ + ++       S  G         +S  GT + MAPE+I G  Y  KAD+WS   T+ EM  G+P ++  +    + K+A  E P+++  +       + + L    F + P +RP+++ LL+  F
Sbjct:  105 GNDLDSPIHNYSDLTFSKSPRAPSNWKKGHRLGSGSFGEVFVCYDKDSGRELAVKQVN----LNQMNAETSKEVRALENEIQLLRN-FQHERIVSYFGCHQDHSILSIFMEYMPGGSIKDELAKYGPLTEGV----TRKYTRQMLEGLAFLHKNVIVHRDIKAANVLRDLQGNIKLADFGASKRLHTIC------SATGF--------KSFVGTPHYMAPEVINGEGYGRKADVWSLGCTVVEMISGKPPWSELESMAAIYKIATAERPEFELPQRSSEFSREFLRL---TFRRNPLERPSSEDLLRHRF 388          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 125.176 bits (313), Expect = 3.694e-32
Identity = 87/284 (30.63%), Postives = 147/284 (51.76%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFA--GKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +++G+ + RG YG +     S G ++ A+K++    + ++  E   KE   +E  ++  ++ L H  I  + G  +    + IFM++  GGSI  +LN     LP++    YT+Q+LEG+++LHENR+IH DLK  N++L      KL D GC+R +  L      HS       + +L +S  GT   MAPE+I    +  K+D+WS   T++EM  G+P  A  GK   +  +   KG +P      + ++   +  S + +  I +  +RP+A  LL+  F
Sbjct:   16 WAKGEVLGRGAYGTVYCGLTSQG-QLIAVKQVLLDVSTSETAE---KEYSRLEREVDLLKN-LEHPNIVGFLGTALTDNVISIFMEYVPGGSISSVLNRFGP-LPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGVVKLIDFGCARRLNRLT-----HSGG-----NSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATGKPPLAHMGKMAALFYIGARKGLMPP-----LPDDFSEEAKSFVKACLINQ-KQRPSAADLLRHPF 277          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 130.568 bits (327), Expect = 5.030e-32
Identity = 89/284 (31.34%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + +G+ + RG +G++   + +   R  A+K++ +    ++  + +   AL  EI + K    L HERI +YYG +   +  K+ IF++F  GGSI + L      L ++   +YT+QIL+G+ +LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        ++  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P +A  +    + K+A        K  + E         +  +F++E   RPTA+ LL   F
Sbjct:  357 WRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVN--ALECEIQLLK---NLRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAY-GALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC-----MSGTGI--------KTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIAT----QPTKPNLPEGVSDACRDFLRQVFVEE-KWRPTAEGLLSHPF 616          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 130.183 bits (326), Expect = 6.375e-32
Identity = 89/284 (31.34%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + +G+ + RG +G++   + +   R  A+K++ +    ++  + +   AL  EI + K    L HERI +YYG +   +  K+ IF++F  GGSI + L      L ++   +YT+QIL+G+ +LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        ++  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P +A  +    + K+A        K  + E         +  +F++E   RPTA+ LL   F
Sbjct:  354 WRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEVN--ALECEIQLLK---NLRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAY-GALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC-----MSGTGI--------KTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIAT----QPTKPNLPEGVSDACRDFLRQVFVEE-KWRPTAEGLLSHPF 613          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 128.642 bits (322), Expect = 2.654e-31
Identity = 90/282 (31.91%), Postives = 142/282 (50.35%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   + +   R  A+K++ +  +  +  + +   AL  EI + K    L HERI +YYG +   ++  + IFM++  GGSI + L +    L +    KYT+QILEG+ +LH N I+H D+K  NIL D+  N KL D G SR ++++       S  GI        +S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A     P    H      D      +  +F+ E  +RP A+ LL+  F
Sbjct:  362 GKLLGQGAFGRVFLCYDADTGRELAVKQVQFDPDSPETSKEVS--ALECEIQLLK---NLFHERIVQYYGCLRDTHERTLSIFMEYMPGGSIKDQLKSY-GALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICL-----SGTGI--------KSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAIFKIATQPTNPALPAHVSDHCRD-----FLKRIFV-ETKQRPAAEELLRHIF 618          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 123.25 bits (308), Expect = 1.585e-29
Identity = 86/285 (30.18%), Postives = 140/285 (49.12%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   +     R  A K++ +    +       KE   +E  I   ++ L HERI +YYG +    +  + IFM++  GGS+ + L      L +    KYT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++       S  G+        +S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A     P    H  ++  D      +  +F+ E   RP+A+ LL+  F
Sbjct:  356 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQF----DPASPETSKEVSTLECEIQLLKN-LHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAY-GALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM-----SSTGV--------RSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPILPSHTSEQTRD-----FIRRIFV-EAKHRPSAEELLRHPF 615          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 127.872 bits (320), Expect = 9.266e-32
Identity = 91/285 (31.93%), Postives = 143/285 (50.18%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGEL-PDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G++   + +   R  A+K++ +  +   V  + +  AL  EI + K    L HERI +Y+G +    +  + IFM++  GGSI + L      L +    KYT+QILEG+SFLH N I+H D+K  NIL D+  N KL D G S+ ++++          G  M+      S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A     P    H  +   D     L+  +F+ E   RP+A+ LL+  F
Sbjct:  359 WQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQF--DPGSVETSKEVNALECEIQLLK---NLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAY-GALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTI-------CSQGTAMR------SVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLHASEHARD-----LLRRIFV-EAKLRPSAEDLLRHPF 618          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 108.612 bits (270), Expect = 6.722e-27
Identity = 68/225 (30.22%), Postives = 110/225 (48.89%), Query Frame = 1
Query:  829 SELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA--KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + L H  + +Y G  ++G +  IFM+F  GG++ E +      L +     Y  Q+  GL++LH + ++HGD+K  N ++      KL D GC+ R   +L+     H   G+   H        GTA  MAPE+I G  Y  +AD+WS   T++EM  G+P FA       L+ +    G +P   +   KE  +      ++  FI++  KRP+++ LL   F
Sbjct:   76 TTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGP-LGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSC----HENGGLHSVH--------GTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQE-----FVEQCFIRDKLKRPSSQELLSHPF 282          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 109.383 bits (272), Expect = 3.465e-26
Identity = 86/302 (28.48%), Postives = 148/302 (49.01%), Query Frame = 1
Query:  607 CDHKFCLTSICFNE---FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLK--SQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKF-GTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            C H     + C +    F++ + I +G +G++ K   +    + AIK I+ +   +++ +  ++  ++ + + + Y        +T Y+G+ +KG K++I M++  GGS  +L+   P  L + ++    ++IL+GL +LH  R IH D+K  + N+LL  + + KL D G                 AG Q+   ++ ++ F GT   MAPE+I+  +YD KADIWS   T  E+  G+P  +      VL  + K   P      ++ N        +DS   K+P  RPTAK LLK  F
Sbjct:    9 CPHPRPPQNSCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCD-SPY--------VTHYFGSYLKGTKLWIIMEYLGGGSALDLIKPGP--LEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGV----------------AG-QLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPT-----LEGNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKF 277          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007848.1 (pep scaffold:Pmarinus_7.0:GL476358:287782:303246:1 gene:ENSPMAG00000007083.1 transcript:ENSPMAT00000007848.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 4.139e-25
Identity = 79/280 (28.21%), Postives = 135/280 (48.21%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDN-CKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENV-------VLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLL 1482
            + RGR+G +        S  FA+K+++    ++   EN        E++I    S L   R+ + YGA+ +G ++ +FM    GG++  +++   + LP +  + YT Q+LE L +LH+N ++HGD+K+ NIL+  + N   L D G S+ +   +K   K              Q   GT  +MAPE+     +D KAD+WSA   +  M +G+  + G+   V       V  +    E P++        T C ++ ++ S   K+   RPTA +LL
Sbjct:   40 LGRGRFGNVFVGRDLCTSFHFAVKQLS----VDKFSEN--------ELSI---WSRLDSLRLVQLYGAVREGPRLSLFMQVAEGGTLDVMISDNKQ-LPQDLAMHYTCQVLEALEYLHQNNVLHGDVKADNILMSADGNQVWLCDFGFSQLLPPGSKVLPKD-------------QQPRGTQTHMAPEVAASAGHDCKADVWSACCVLLHMLNGRHPWMGRFAGVKVLYFVIVQQEAPVSEAPEW-------CTSC-VLDVLRSGLQKDAAARPTASLLL 282          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 7.739e-22
Identity = 69/274 (25.18%), Postives = 124/274 (45.26%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGL-PDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLF-AGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLL 1482
            I  G +GK   +       ++ IK+IN         +  +KE  ++        + + H  I  Y  +  +   +YI MD+  GG +++ +N     L  ++++L +  Q+   L  +H+ +I+H D+KSQNI L      +L D G +R + S                  EL ++  GT   ++PE+ +   Y+ K+D+W+    +YEM   +  F AG  +N+VL K+ +G  P    H   E     + S +  +  ++P  RP   +LL
Sbjct:   10 IGEGSFGKAMLVKSKADGHLYVIKEINISRMSPKERDEARKEVCVL--------ANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTT----------------ELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVL-KIIRGSFPPVSAHYSSE-----LRSTLSGLLRRDPRARPPVAVLL 253          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 112.849 bits (281), Expect = 7.712e-27
Identity = 82/277 (29.60%), Postives = 124/277 (44.77%), Query Frame = 1
Query:  661 QFIDRGRYGKISKIFQSGGSRIFAIKKINWKTN--LNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLK 1485
            Q I RG YG + K       ++ AIK++ ++ +  LND+         M EI++ K    L H  I KY+G I K Y++YI +++   GS+  L++    GL +     Y  Q L GL +LH   +IH D+K+ NILL  ++  KL D G S  + S          + + +          GT N MAPE++        +DIWS  AT+ EM    P +    +  +   +       Y      E     +   +   F+K   KRPTA  LLK
Sbjct:   29 QVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDI---------MAEISLLK---NLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNS----------SALTLA---------GTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY--YPPSSFSE----PLKDFLSKCFVKNMYKRPTADQLLK 268          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 111.694 bits (278), Expect = 1.867e-26
Identity = 83/255 (32.55%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  751 KTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLK-YTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLK-TYFDINIL 1509
            KTN N  I     +AL  E+N+ K   EL HE I  YYGA  +G  + IF+++  GGS+  +LN    G  +E L+  +T+QIL G+++LH+  IIH D+K  NIL+D +   K+TD G S+ +  LNK   K  +A +Q           G+   M+PE+++  +   KADIWS    + EMF G+  F    +   + K+     P+       E  +      +   F  +   RP+A  LL+  + D +I+
Sbjct:  488 KTNQN--IHRKMVDALQHEMNLLK---ELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNY--GPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNK--RASLQ-----------GSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKN-----FLRKAFELDYQYRPSALELLQHPWLDAHII 717          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 106.686 bits (265), Expect = 2.880e-25
Identity = 88/283 (31.10%), Postives = 126/283 (44.52%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELL-NTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMI--QGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDINI 1506
            I RG +G + K        I AIK +N + +  D IE L +E   +        +EL    IT Y   +++   M+I M++  GGS  +LL  +   GLP+E++     ++  GL +LHE R IH D+K+ NILL+ E   KL D G S  I S  K                   +  GT   MAPE++  +   Y+ KADIWS   T YE+  G P  +      V+  L K + P  +        D      +    +K P  RP+A  LL   F  NI
Sbjct:   24 IGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDED-IELLAQEIFFL--------AELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTLKR-----------------DTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKD-----FVAGCLVKTPADRPSAYNLLSFEFVKNI 275          
BLAST of Protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 105.916 bits (263), Expect = 1.819e-24
Identity = 92/298 (30.87%), Postives = 147/298 (49.33%), Query Frame = 1
Query:  640 FNEFS--EGQFIDRGRYGKISKIFQSGGSRIFAIKKINWK--TNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKY-TKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMI---QGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIIS-----LMDSMFIKEPNKRPTAKMLLKTYF 1494
            + EF+  +G+ I +G +G +          + A+K++     ++ N+ I +   EAL  E++  K   +L H  I +Y G   K     +F+++  GGS+  L+     G  DE L+K+ T Q+L+GL++LH   I+H D+K+ N+LLD +  CK++D G SR      K    +S + + M+         GT   MAPEM+   QG  Y  K DIWS    + EMF G+  ++  +    + K+ K +        I E+T   +IS      +D+ F   P KRPTA  LL   F
Sbjct: 1170 YKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTV-EALRSEVSTLK---DLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMY--GRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISR------KSKDIYSNSDMTMR---------GTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSK----SAPPIPEDT-LPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439          
BLAST of Protein kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 105.531 bits (262), Expect = 2.155e-24
Identity = 84/288 (29.17%), Postives = 144/288 (50.00%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKE----ALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYT-KQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMI-QGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            F   + I RG++G + K +     R++AIK +N  ++ +D +E++++E    A + +I+            IT+YYG+ +K   ++I M+   GGS+  LL     G  DE+ +    +++L  L  +H++ +IH D+K+ N+L+  E N KL D G +     +N+ S +              Q+  GT   MAPE+I +G+ YD K DIWS   T YE+  G P +    E +  M+L     P   + R    +  + I+L      ++P +R +A  LLK+ F
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSD-SDEVEDVQREIQFLASLKQIS-----------NITRYYGSYLKDTSLWIIMEHCAGGSLRSLLR---PGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVA---AQVNQTSLRR-------------QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYC-DVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIAL---CLDEDPKERLSADDLLKSKF 275          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 131.724 bits (330), Expect = 5.355e-35
Identity = 97/293 (33.11%), Postives = 140/293 (47.78%), Query Frame = 1
Query:  640 FNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLL-KYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLA----KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDIN 1503
             N + +G+ +  G +G++         R  A+K+I     LN   +N  K AL  EI   K      +ERI +YYG       +YIFM++  GGSI+E +     G  +E L  KY++QILEG+ +LH NRI+H D+K  NIL D   N KL D G S+ ++++       SK G +  H        GT   MAPE+I G  Y  KAD+WS   T+ EM   +P +A  +    L K+A    + ELP         +     +  + S        RP+A  LL+  F  N
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIE-TGQLNSSTKNEVK-ALEGEIEFMK---AFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQ--HGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTI------RSKTGFRSVH--------GTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPS--------DLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTN 264          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 117.857 bits (294), Expect = 5.530e-30
Identity = 84/286 (29.37%), Postives = 137/286 (47.90%), Query Frame = 1
Query:  646 EFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGE-LPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            E+ +G  + +G +G +     + G  I A+K++    N  D  E  + E L  E+ + K    L H+ I +Y G  +   +  + IFM+F  GGSI + L        +    +YT+QIL+G+S+LH N +IH D+K  NI+L      KL D GC++          K    G  +    + +S  GT   MAPE+I+   +  K+DIWS   T++EM  GQP ++       +  +  G  +P     R+ E+     I  + S   ++ + RP+A  LL+  F
Sbjct:    4 EWQKGNVLGKGAFGTVFLGLVNTGELI-AVKQVELHPNNVDAAER-QYEKLQEEVGLLK---SLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRF-GAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGVIKLIDFGCAK----------KICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPWSNVPPLSAIFAIGNGSPVP-----RLDESFSAAAIDFVTSCMTRDQDTRPSADELLRHDF 268          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO35743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK8])

HSP 1 Score: 109.383 bits (272), Expect = 1.513e-27
Identity = 72/218 (33.03%), Postives = 109/218 (50.00%), Query Frame = 1
Query:  841 HERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQ-ILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDC--KIISLMDSMFIKEPNKRPTAKMLLK 1485
            HE + K YGA+    K+ IFM++  GGS+   L+    G  DE  +K   Q ILE L +LH   ++H DLK  N+L+D++   KL D G S  ++    +++             +P+   GT   M+PE+ +   +    DIWSAA T+Y+M  G+P +       +L ++A    P      I ++ +C  +I   M SMF   P  RPTA  LLK
Sbjct:    1 HENVVKLYGAVQTEQKIIIFMEYMDGGSVEMFLSN--NGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNVLMDSKGIVKLADFGASVHLDDTTTHTRNI-----------IPR---GTEAFMSPEVCRSEPFGRSTDIWSAACTLYQMLTGEPPWMQYSGGSILYQVAIATKPP----GIPDSLECSQEIKDFMASMFSFVPEDRPTAAELLK 198          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 111.309 bits (277), Expect = 3.310e-27
Identity = 79/277 (28.52%), Postives = 132/277 (47.65%), Query Frame = 1
Query:  667 IDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCS-RFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G YG + K       ++ AIK++   T+L ++I    KE  M++   + Y        + KYYG+  K   ++I M++   GS+ +L+    + L +E +    K  L+GL +LH  R IH D+K+ NILL++E + KL D G + +  +++ K +                 +  GT   MAPE+IQ + YD  ADIWS   T  EM +G+P +A       +  +     P ++    + + D K    +    +K P +R TA  LL+  F
Sbjct:   30 LGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEII----KEISMMQQCDSPY--------VVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRN-----------------TVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPG-QWSEDFK--DFVSKCLVKNPEERATATELLQHSF 274          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 106.686 bits (265), Expect = 6.949e-26
Identity = 79/288 (27.43%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  634 ICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAII--KGYKMYIFMDFYHGGSIYELLNTLPEGLP--DERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLK 1485
            +  + ++ G+ I +G YG++         + + +KK+       D+ +   +E    E+   K  S+L H  I  Y  +     G+ +YI M+F  GG +Y  L    +G+P  + +++++  QI   L ++HE  I+H DLK+QNI L      K+ DLG +R +ES                  ++  +  GT   M+PE+     Y+ K+D+W+    +YEM   +  F  K  + ++ K+ KG+ P   K   + +TD  + S++ SM  ++P+KRP+A  LL+
Sbjct:    1 MSLDRYTIGKCIGKGSYGEVFLSKHKKDKKQYVLKKV-------DLQKASVRERKAAELE-AKLLSQLRHPNIVSYRESFQDDTGF-LYIAMNFCEGGDLYSRLKA-QKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLES----------------SSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMSSLVYKILKGKTPPLPK---QYSTD--LCSIIKSMLDQDPDKRPSASRLLR 257          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 132.88 bits (333), Expect = 7.161e-33
Identity = 90/284 (31.69%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + +G+ + RG +G++   + +   R  A K++ +  +  +  + +   AL  EI + K    L H+RI +YYG +  +   K+ IF++F  GGSI + L      L ++   +YT+QIL+G+S+LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P +A  +    + K+A        K  + E         +  +F++E   RPTA +LL   F
Sbjct:  327 WRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVN--ALECEIQLLK---NLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAY-GALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC-----MSGTGI--------KSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIAT----QPTKPTLPEGVSDASRDFLRQVFVEE-KWRPTADILLNHPF 586          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 132.88 bits (333), Expect = 8.858e-33
Identity = 90/284 (31.69%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + +G+ + RG +G++   + +   R  A K++ +  +  +  + +   AL  EI + K    L H+RI +YYG +  +   K+ IF++F  GGSI + L      L ++   +YT+QIL+G+S+LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P +A  +    + K+A        K  + E         +  +F++E   RPTA +LL   F
Sbjct:  357 WRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVN--ALECEIQLLK---NLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAY-GALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC-----MSGTGI--------KSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIAT----QPTKPTLPEGVSDASRDFLRQVFVEE-KWRPTADILLNHPF 616          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 132.88 bits (333), Expect = 8.858e-33
Identity = 90/284 (31.69%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAI--IKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            + +G+ + RG +G++   + +   R  A K++ +  +  +  + +   AL  EI + K    L H+RI +YYG +  +   K+ IF++F  GGSI + L      L ++   +YT+QIL+G+S+LH N I+H D+K  NIL D+  N KL D G S+ I+++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS A T+ EM   +P +A  +    + K+A        K  + E         +  +F++E   RPTA +LL   F
Sbjct:  357 WRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEVN--ALECEIQLLK---NLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAY-GALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTIC-----MSGTGI--------KSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIAT----QPTKPTLPEGVSDASRDFLRQVFVEE-KWRPTADILLNHPF 616          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 127.872 bits (320), Expect = 4.406e-31
Identity = 91/285 (31.93%), Postives = 143/285 (50.18%), Query Frame = 1
Query:  658 GQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAK----GELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            G+ + +G +G++   + +   R  A+K++ +     +  + +   AL  EI + K    L HERI +YYG +    +  + IFM+   GGSI + L +    L +    +YT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G SR ++++       S  GI        +S  GT   M+PE+I G  Y  KADIWS   T+ EM   +P +A  +    + K+A      ELP +     +E         +  +F+ E  +RP+A  LL+  F
Sbjct:  392 GKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEVS--ALECEIQLLK---NLCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSY-GALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICL-----SGTGI--------KSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPELPVHVSDHCRE--------FLRRIFV-ETKQRPSADELLRHIF 648          
BLAST of Protein kinase vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 124.02 bits (310), Expect = 7.325e-30
Identity = 88/288 (30.56%), Postives = 142/288 (49.31%), Query Frame = 1
Query:  649 FSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYK--MYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGE----LPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            +  G+ + +G +G +   +     R  A K++ +  +  +  + +   AL  EI + K    L HERI +YYG +    +  + IFM++  GGS+ + L      L +    KYT+QILEG+S+LH N I+H D+K  NIL D+  N KL D G S+ ++++       S  GI        +S  GT   M+PE+I G  Y  KAD+WS   T+ EM   +P +A  +    + K+A       LP +   + ++   C        +F+ E   RP+A+ LL+  F
Sbjct:  353 WRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEVS--ALECEIQLLK---NLHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAY-GALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM-----SGTGI--------RSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPLLPSHTSDQARDFIHC--------IFV-EAKHRPSAEELLRHPF 612          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000024804.1 (SMESG000024804.1)

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 435/441 (98.64%), Postives = 437/441 (99.09%), Query Frame = 1
Query:  187 MLDSKRYSAFIESLKYGDLPTVEQEFQPIFLNQPDSSGYLPLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDEILQDLINRPDYQDVKNIITTAIKNYQVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDINIL 1509
            MLDSKRYSAFIESLKYGDLPTVEQEFQPIFLNQPDSSGYLPLHIASQGSN EVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDEILQDLINRP+YQDVKNIIT AIKNYQVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFI+RGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVE NINKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNT PEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDINIL
Sbjct:    1 MLDSKRYSAFIESLKYGDLPTVEQEFQPIFLNQPDSSGYLPLHIASQGSNLEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDEILQDLINRPNYQDVKNIITNAIKNYQVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFIERGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVETNINKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTFPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDINIL 441          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000016834.1 (SMESG000016834.1)

HSP 1 Score: 201.445 bits (511), Expect = 3.625e-58
Identity = 138/404 (34.16%), Postives = 209/404 (51.73%), Query Frame = 1
Query:  307 PLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCEL-SMNDEILQDLINRPDYQDVKNIITTAIKNYQVGKE---MDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENV-VLMKLA---KGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYF 1494
            P+H+AS     E+LK L+   C++E       RPIHFA  N  +  +++L    C++ +  D  L  ++     +D+ N++  A++  Q+ ++   M L+CN +CDHK C  S+   +F  G+ I  G +G +     SG  R FAIK I++           K +   +E+NIN +   L + RI +Y+GAI    ++ IFM+F   GS+ + ++      PD  +++Y++QILEGL FLH  +IIH DLK  NIL+D E+N KL D G SR +   +         GI +  K L     GT N  APE++ G  Y++ ADIWS  ATI  M   QP +   +  + V+ K+    K ELP      I E     I+ L+      +P  RPTA  LLK+ F
Sbjct:  146 PVHLASAHGQAEILKVLIDNKCDLEICADKNLRPIHFACANDRVEVLQILIDHNCDIEACADFNLSPMVIAEGNKDLINMLNAAVEARQLRQQISAMGLQCNSQCDHKLCPISLESKKFHRGEEIGHGAFGTVFHCKGSGIDRSFAIKFISYT----------KFDKRNIELNINSFLPMLKNARIVQYFGAIKTESELCIFMEFLPLGSLNDKISRERSIKPD-NIIRYSRQILEGLEFLHGKKIIHRDLKPGNILMDDENNIKLADFGISRLLIRTD---------GISIDTKSLA----GTPNFTAPEIMSGDPYNVPADIWSLGATIINMITSQPPYHNLETPLAVVFKIGNEKKLELPS----DISEEMRIFILDLLQP----DPKDRPTAAELLKSKF 517          

HSP 2 Score: 54.299 bits (129), Expect = 1.517e-7
Identity = 35/146 (23.97%), Postives = 71/146 (48.63%), Query Frame = 1
Query:  178 TCLMLDSKRYSAFIESLKYGDLPTVEQEFQPIFLNQPDSSGYLPLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDEILQDLINRPDYQDVKNIIT---TAIKNYQVGKEMDLKCNLE 606
            +C  +D   +  FI++++   + +  + F+  +LN  D +  LP+HIA    + ++++ L+ + C++E+      RP+HFA    +++ +K+L    C +  +        N+  +Q V        T I  + +    D KCNLE
Sbjct:    6 SCSSID--EFELFIDAVERNSVKSFSEYFKSEYLNSKDKNSMLPIHIACYEGHTQMVQMLISKKCDLEACTKYNCRPVHFACARGHLDILKILVNQNCNIHSH--------NKDHWQPVHLACACGHTGILQFLI----DQKCNLE 137          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017215.1 (SMESG000017215.1)

HSP 1 Score: 196.052 bits (497), Expect = 2.599e-57
Identity = 140/415 (33.73%), Postives = 216/415 (52.05%), Query Frame = 1
Query:  307 PLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSM---NDEILQDLINRPDYQDVKNIIT------------TAIKNYQVGKEMDLKCNLECDHK-FCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSI-YELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKF-GTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKG---ELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKT 1488
            P+H+A    N  ++K L+ + CNIES D + W+PIH A    ++  ++LL    C+++    N +    L  +  YQ + +++                ++ ++ + M +KC L C HK  C  SI    F +G  +  G +G + K+  +G ++ FA+K IN        IE++++    +E  I+++   L H RI KY+GAI    K+ IFM+++   SI +++      G+ D  +++YTKQI+EGL FLH  +IIH DLK  NILL+ EDN KLTD G SR   SL K        GI      +P   F GTAN  APE+I    Y   ADIWS AA++  M  G+P + G +   VL K++     E+PD     +K          + SM   +P++RP+A  LLK+
Sbjct:   12 PMHLACDMGNIYIVKLLIDEKCNIESCDKDNWQPIHLACARGHVEIVRLLMQEKCDIAAVNRNGDSPMKLARKYQYQAIIDLLNERQSELERVWSLKTQESERLIEMMGVKCTLLCTHKQLCPNSIRSKTFPKGTKVGHGSFGDVCKMKGTGTNKEFALKYIN--------IEDIERR--YIEGRIDEFIPVLDHPRIIKYFGAIETEKKLCIFMEYFPNNSIQHKIKEEGCIGITD--VVRYTKQIIEGLEFLHGKKIIHRDLKPDNILLNNEDNIKLTDFGLSR---SLIK------TGGIT-----IPARTFVGTANFTAPEIINSEPYREPADIWSVAASMINMITGKPPYHGFQSVTVLFKISSTKTIEMPDSISDEMK--------GFILSMLNPDPSERPSATNLLKS 392          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000017215.1 (SMESG000017215.1)

HSP 1 Score: 192.971 bits (489), Expect = 2.373e-56
Identity = 139/414 (33.57%), Postives = 215/414 (51.93%), Query Frame = 1
Query:  310 LHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSM---NDEILQDLINRPDYQDVKNIIT------------TAIKNYQVGKEMDLKCNLECDHK-FCLTSICFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSI-YELLNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKF-GTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKG---ELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKT 1488
            +H+A    N  ++K L+ + CNIES D + W+PIH A    ++  ++LL    C+++    N +    L  +  YQ + +++                ++ ++ + M +KC L C HK  C  SI    F +G  +  G +G + K+  +G ++ FA+K IN        IE++++    +E  I+++   L H RI KY+GAI    K+ IFM+++   SI +++      G+ D  +++YTKQI+EGL FLH  +IIH DLK  NILL+ EDN KLTD G SR   SL K        GI      +P   F GTAN  APE+I    Y   ADIWS AA++  M  G+P + G +   VL K++     E+PD     +K          + SM   +P++RP+A  LLK+
Sbjct:    1 MHLACDMGNIYIVKLLIDEKCNIESCDKDNWQPIHLACARGHVEIVRLLMQEKCDIAAVNRNGDSPMKLARKYQYQAIIDLLNERQSELERVWSLKTQESERLIEMMGVKCTLLCTHKQLCPNSIRSKTFPKGTKVGHGSFGDVCKMKGTGTNKEFALKYIN--------IEDIERR--YIEGRIDEFIPVLDHPRIIKYFGAIETEKKLCIFMEYFPNNSIQHKIKEEGCIGITD--VVRYTKQIIEGLEFLHGKKIIHRDLKPDNILLNNEDNIKLTDFGLSR---SLIK------TGGIT-----IPARTFVGTANFTAPEIINSEPYREPADIWSVAASMINMITGKPPYHGFQSVTVLFKISSTKTIEMPDSISDEMK--------GFILSMLNPDPSERPSATNLLKS 380          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000022974.1 (SMESG000022974.1)

HSP 1 Score: 193.356 bits (490), Expect = 3.857e-55
Identity = 131/403 (32.51%), Postives = 206/403 (51.12%), Query Frame = 1
Query:  307 PLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSM---NDEILQDLINRPDYQDVKNIITTAIKNY---QVGKEMDLKCNLECDHKFCLTSICFNEFSEGQFIDRGRYGKI--SKIFQSGGSRIFAIKKINWKTNLNDVIENLKKEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYELLNTLPEGLPDER--LLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNCKLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQGLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKHRIKENTDCKIISLMDSMFIKEPNKRPTAKMLLK 1485
            P+HI+ +  +  ++K L+  NCNIE++D + WRPIH+A    N+   +LL    C L M   N++   ++  +  Y DV  +I   +K     ++ +   +  +   D    + S C N+F++ + I RG +GK+   K+ +SG    F +K    +T+          ++ M+E NIN+Y   L HERI  YYG + K  K YI M++   GS   LLN + + +   R  ++  +KQI+EG+ FLH N+IIH D+   NILLD   N KLTD G SR ++            G Q       ++  GT N +APE+I    Y   ADIWS  ATI+ M  G+ LF  K    ++  + K +  D+K   +      ++ +++  M   +P+ RPTA  LLK
Sbjct:  130 PIHISCRYGHTNIVKLLIENNCNIEARDYSKWRPIHWACYVGNVEVARLLITNKCTLDMLTKNNKTPINIAEQYRYTDVMKVIQDELKRQLFDRISRAFQVSNDFNLDQD--IYSKCSNDFAKVRCIGRGSFGKVILYKLLKSGHE--FVVKSTYIETD----------DSRMIENNINRYIDLLNHERIVSYYGVVQKAKKFYILMEYMPQGS---LLNCIEKTMSILRKQIINVSKQIIEGVEFLHGNQIIHRDITPSNILLDANLNIKLTDFGFSRVVKD----------TGTQ----NCAKTFCGTINYLAPEIISDQQYSFPADIWSVGATIFHMLLGRELFHEKSICEIVTFILKNKKIDFKPLELSSR---RMSTIVKEMLNYKPSNRPTAASLLK 498          

HSP 2 Score: 62.003 bits (149), Expect = 4.835e-10
Identity = 31/92 (33.70%), Postives = 52/92 (56.52%), Query Frame = 1
Query:  217 IESLKYGDLPTVEQEFQPIFLNQPDSSGYLPLHIASQGSNHEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMNDE 492
            +  +K G +  V+  F P +LN+ D +   P+H+A +  + EV+KFL+ +   IES    GWRPI FA  N + + + +L    CE++  D+
Sbjct:    1 MSKVKLGIIDEVKISFMPEYLNKIDMNFDEPIHVACENGHEEVVKFLIDKGAKIESHRKFGWRPIFFACFNCHKDVLMILIKNRCEINALDQ 92          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K195.500e-3330.28mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K191.046e-3130.28mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K191.183e-3130.88mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K191.215e-3130.28mitogen-activated protein kinase kinase kinase 19 ... [more]
MAP3K191.215e-3130.28mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cst-25.976e-2828.19Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
cst-11.446e-2728.19Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-11.653e-2728.19Serine/threonine-protein kinase cst-1 Serine/threo... [more]
gck-13.459e-2628.87Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-13.526e-2628.87Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpo1.437e-2627.08gene:FBgn0261456 transcript:FBtr0331920[more]
hpo1.437e-2627.08gene:FBgn0261456 transcript:FBtr0086500[more]
GckIII1.966e-2628.72gene:FBgn0266465 transcript:FBtr0083399[more]
mbt1.386e-2325.90gene:FBgn0025743 transcript:FBtr0074285[more]
Slik5.975e-2330.04gene:FBgn0035001 transcript:FBtr0072363[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.896e-3131.91mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k22.965e-3131.91mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k194.301e-3129.93mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k224.602e-3132.04mitogen-activated protein kinase kinase kinase 22 ... [more]
map3k33.770e-3031.23mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dennd1a1.201e-3231.67DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a1.315e-3231.67DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
MAP3K21.032e-3032.51mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K21.668e-3032.51mitogen-activated protein kinase kinase kinase 2 [... [more]
samd84.361e-3030.63sterile alpha motif domain containing 8 [Source:Xe... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k191.082e-3029.58mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k31.868e-3030.88mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k23.131e-3031.91mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k191.728e-2927.56mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k192.799e-2927.56mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54R82|MKKA_DICDI3.512e-3233.22Mitogen-activated protein kinase kinase kinase A O... [more]
sp|Q56UN5|M3K19_HUMAN5.834e-3130.28Mitogen-activated protein kinase kinase kinase 19 ... [more]
sp|Q99759|M3K3_HUMAN1.126e-2930.53Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61084|M3K3_MOUSE1.307e-2930.88Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN1.784e-2931.91Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJG24.513e-4530.48Slc42a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
D2VYH33.879e-3435.71Predicted protein OS=Naegleria gruberi OX=5762 GN=... [more]
A0A5B8MXT09.907e-3430.15Mitogen-activated protein kinase OS=Chloropicon pr... [more]
T1G1N22.070e-3331.58Protein kinase domain-containing protein OS=Helobd... [more]
A0A210PFZ59.946e-3330.32Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k193.694e-3230.63mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k225.030e-3231.34mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k226.375e-3231.34mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k22.654e-3131.91mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k31.585e-2930.18mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k29.266e-3231.93mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k196.722e-2730.22mitogen-activated protein kinase kinase kinase 19 ... [more]
stk25a3.465e-2628.48serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000007848.14.139e-2528.21pep scaffold:Pmarinus_7.0:GL476358:287782:303246:1... [more]
ENSPMAT00000007414.17.739e-2225.18pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC157.712e-2729.60Protein kinase of the Mitotic Exit Network; locali... [more]
STE111.867e-2632.55Signal transducing MEK kinase; involved in pheromo... [more]
SPS12.880e-2531.10Putative protein serine/threonine kinase; localize... [more]
BCK11.819e-2430.87MAPKKK acting in the protein kinase C signaling pa... [more]
KIC12.155e-2429.17Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414105.355e-3533.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478215.530e-3029.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357431.513e-2733.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428453.310e-2728.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496906.949e-2627.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k227.161e-3331.69mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k228.858e-3331.69mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k228.858e-3331.69mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k24.406e-3131.93mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k37.325e-3030.56mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024804.10.000e+098.64SMESG000024804.1[more]
SMESG000016834.13.625e-5834.16SMESG000016834.1[more]
SMESG000017215.12.599e-5733.73SMESG000017215.1[more]
SMESG000017215.12.373e-5633.57SMESG000017215.1[more]
SMESG000022974.13.857e-5532.51SMESG000022974.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035101 ID=SMED30035101|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1515bp
GCAACAGGTATATAATATTCATTGTAACTGATAATCTATTGTGTAACTGA
GTCTGAACAAGTTGTGCTTGTGTAAATTTGTACACCGTCCGGTTGCAATA
CATTTCAAGCCTACACAATTATATTGATTTCTTTTCATATTGCACAAATA
TCAGATTGATTTTCATCTTCAATCTTTACTTGTTTAATGTTGGATTCCAA
GAGATATTCAGCATTCATTGAGTCTCTCAAGTATGGAGATCTTCCTACAG
TTGAACAGGAGTTCCAGCCAATTTTCCTCAATCAACCTGATAGTTCGGGA
TATTTACCACTCCACATTGCCAGTCAGGGCAGCAACCATGAAGTCTTGAA
ATTCCTATTGGGACAAAATTGCAATATTGAATCAAAGGATTCGAATGGAT
GGCGACCGATTCATTTTGCTGTGCTAAACAAAAACATGAATAATATAAAA
TTGTTATTTGGATTTGGCTGTGAATTGTCAATGAACGACGAAATATTGCA
GGACCTGATCAACCGACCAGACTACCAAGATGTTAAGAACATAATTACAA
CTGCAATAAAAAATTATCAAGTCGGTAAAGAAATGGACTTGAAGTGCAAT
CTTGAATGCGATCATAAATTTTGTTTGACATCCATTTGTTTTAATGAATT
CTCAGAAGGCCAATTCATAGATAGGGGAAGATATGGTAAGATATCAAAAA
TTTTTCAGTCGGGTGGTAGTCGAATATTTGCTATTAAAAAGATAAACTGG
AAGACAAATTTAAATGATGTCATTGAAAACTTAAAAAAGGAGGCGTTAAT
GGTTGAAATAAATATTAATAAATACCGATCAGAGCTGGTTCATGAGAGGA
TCACAAAATACTATGGAGCCATTATCAAGGGTTACAAAATGTACATTTTT
ATGGATTTTTACCATGGAGGTTCAATTTATGAACTACTAAACACATTGCC
TGAAGGATTACCGGACGAAAGATTATTGAAATACACCAAGCAAATTCTCG
AAGGGCTCAGTTTTCTGCATGAAAACAGAATTATTCATGGAGATCTTAAA
AGTCAGAATATCCTTCTGGATACGGAGGATAACTGTAAACTTACTGATCT
AGGATGTAGCCGATTCATAGAGTCTTTAAATAAATACAGTCAAAAACATT
CCAAGGCAGGTATCCAAATGAAGCATAAAGAATTACCGCAATCTAAATTT
GGTACCGCAAATAATATGGCACCGGAAATGATTCAGGGATTAAGTTATGA
CTTAAAAGCGGATATCTGGTCAGCTGCAGCCACCATATATGAAATGTTTG
ACGGTCAGCCACTCTTTGCAGGAAAGAAGGAGAATGTAGTGTTGATGAAA
TTAGCCAAAGGGGAATTGCCGGATTATAAAAAGCATCGGATTAAAGAAAA
TACTGATTGCAAAATAATCTCCCTGATGGATTCCATGTTTATCAAAGAGC
CAAATAAACGCCCGACCGCTAAGATGTTGCTTAAAACATATTTTGATATT
AATATACTTTAGAAA
back to top

protein sequence of SMED30035101-orf-1

>SMED30035101-orf-1 ID=SMED30035101-orf-1|Name=SMED30035101-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=442bp
MLDSKRYSAFIESLKYGDLPTVEQEFQPIFLNQPDSSGYLPLHIASQGSN
HEVLKFLLGQNCNIESKDSNGWRPIHFAVLNKNMNNIKLLFGFGCELSMN
DEILQDLINRPDYQDVKNIITTAIKNYQVGKEMDLKCNLECDHKFCLTSI
CFNEFSEGQFIDRGRYGKISKIFQSGGSRIFAIKKINWKTNLNDVIENLK
KEALMVEININKYRSELVHERITKYYGAIIKGYKMYIFMDFYHGGSIYEL
LNTLPEGLPDERLLKYTKQILEGLSFLHENRIIHGDLKSQNILLDTEDNC
KLTDLGCSRFIESLNKYSQKHSKAGIQMKHKELPQSKFGTANNMAPEMIQ
GLSYDLKADIWSAAATIYEMFDGQPLFAGKKENVVLMKLAKGELPDYKKH
RIKENTDCKIISLMDSMFIKEPNKRPTAKMLLKTYFDINIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR000719Prot_kinase_dom
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0016301kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 189..216
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 133..439
e-value: 2.3E-59
score: 202.8
NoneNo IPR availablePFAMPF13637Ank_4coord: 40..90
e-value: 1.7E-7
score: 31.6
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 17..439
e-value: 8.2E-36
score: 121.2
NoneNo IPR availablePANTHERPTHR24348:SF44SERINE/THREONINE-PROTEIN KINASE DDB_G0278901-RELATEDcoord: 150..434
NoneNo IPR availablePANTHERPTHR24348SERINE/THREONINE-PROTEIN KINASE UNC-51-RELATEDcoord: 150..434
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 155..436
e-value: 9.7E-57
score: 204.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 157..434
e-value: 2.5E-48
score: 164.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 155..436
score: 36.81
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 37..66
e-value: 0.027
score: 23.6
coord: 70..99
e-value: 22.0
score: 14.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 70..102
score: 9.831
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 37..69
score: 11.701
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 7..129
e-value: 3.6E-15
score: 57.9
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 3..106
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 282..294
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 37..102
score: 20.022
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 147..434