Phospholipid-transporting ATPase

Overview
NamePhospholipid-transporting ATPase
Smed IDSMED30035079
Length (bp)3776
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phospholipid-transporting ATPase (SMED30035079) t-SNE clustered cells

Violin plots show distribution of expression levels for Phospholipid-transporting ATPase (SMED30035079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phospholipid-transporting ATPase (SMED30035079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phospholipid-transporting ATPase (SMED30035079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30035079SMESG000061014.1 dd_Smed_v4_2913_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035079SMESG000061014.1 dd_Smed_v4_2913_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30035079SMESG000061014.1 dd_Smed_v4_2913_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035079SMESG000061014.1 dd_Smed_v4_2913_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP9B (ATPase phospholipid transporting 9B (putative) [Source:HGNC Symbol;Acc:HGNC:13541])

HSP 1 Score: 1341.64 bits (3471), Expect = 0.000e+0
Identity = 660/1092 (60.44%), Postives = 845/1092 (77.38%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE----------SGAT----MPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+NE + +H   R +    K   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+EVN   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQ+L     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  V LS++M+ L+GF G WY+ L+RF LLFSYIIP++LRVNLD+ K V  +++M+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   ++  Y           +G+T          KVRK+ + R+ EAV+AI LCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTLV+RDL SMQL+T +G +L++ ILQ+FPFTSE+KRM +I++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFESRY QAKLS+ DR+ KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +H+F+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE +SL  YV SL  L +YFD  F+ T++F+WKV+A+T +SC+PL++LKY+R KL PP + KL
Sbjct:   62 FENEESDYHTLPRARIMQRKRGLEWFVCDG---------WKFLCT--SCCGWL--INICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYE---SRAGVTEETEFAEADQDFSD--ENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAEFLSLGCYVSSLAFLNEYFDVAFITTVTFLWKVSAITVVSCLPLYVLKYLRRKLSPPSYCKL 1134          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP9B (ATPase phospholipid transporting 9B (putative) [Source:HGNC Symbol;Acc:HGNC:13541])

HSP 1 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 660/1103 (59.84%), Postives = 845/1103 (76.61%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE----------SGAT----MPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+NE + +H   R +    K   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+EVN   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQ+L     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  V LS++M+ L+GF G WY+ L+RF LLFSYIIP++LRVNLD+ K V  +++M+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   ++  Y           +G+T          KVRK+ + R+ EAV+AI LCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTLV+RDL SMQL+T +G +L++ ILQ+FPFTSE+KRM +I++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFESRY QAKLS+ DR+ KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +H+F+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE +SL  YV SL  L +YF           D  F+ T++F+WKV+A+T +SC+PL++LKY+R KL PP + KL
Sbjct:   62 FENEESDYHTLPRARIMQRKRGLEWFVCDG---------WKFLCT--SCCGW--LINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYE---SRAGVTEETEFAEADQDFSD--ENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAEFLSLGCYVSSLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLRRKLSPPSYCKL 1145          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP9A (ATPase phospholipid transporting 9A (putative) [Source:HGNC Symbol;Acc:HGNC:13540])

HSP 1 Score: 1272.3 bits (3291), Expect = 0.000e+0
Identity = 625/1040 (60.10%), Postives = 799/1040 (76.83%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVD------TKVRKTGAIRVLEAVQAIALCHNVIPVRE---IEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
             CC W  C        E   R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N+ FL++ACSQF+P +++G LYTYW PLGFV+ VT+ REAV++IR + RD+EVN   Y +L   G  + + SS I+VGD+IIV+KNQR+PADM+FL+T+EK+G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA TV+A+G  VG+V+YTG E R+VMN+S PRSK GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  + RF LLFS IIP++LRVNLD+ KIV +++I RD +IP  +VR++TIPE+LGRISYL++DKTGTLTQNEM+FK+LHLGTV+YG DSMDE+   + S Y   +  PP        TKVR+T + RV EAV+AIALCHNV PV E   + D+  +     D                YQASSPDEVALV WTE+VGLTLV RD +SMQLRT    +LN+ ILQIFPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK + EEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLETLRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  +D G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L+YKTF +WVLISIYQG  IMYGALLLFE +FVH+V+I+FTSL+LTELLMVALTI+TWH LM +AE++SL  Y+ SL+ L ++ D  F+ T+SF+WKV+ +T +SC+PL++LKY+R +  PP ++KL
Sbjct:   23 GCCEWLRCCGG----GEARPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTVIREAVEEIRCYVRDKEVNSQVYSRLTARGTVK-VKSSNIQVGDLIIVEKNQRVPADMIFLRTSEKNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFVGTFTREDSDPPISESLSIENTLWAGTVVASGTVVGVVLYTGRELRSVMNTSNPRSKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQYED------------SCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQILNFTILQIFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLAEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKL 1045          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP9A (ATPase phospholipid transporting 9A (putative) [Source:HGNC Symbol;Acc:HGNC:13540])

HSP 1 Score: 1001.12 bits (2587), Expect = 0.000e+0
Identity = 496/819 (60.56%), Postives = 630/819 (76.92%), Query Frame = 2
Query:  953 CFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVD------TKVRKTGAIRVLEAVQAIALCHNVIPVRE---IEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            C+ R  EV         N+   + + A G  VG+V+YTG E R+VMN+S PRSK GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  + RF LLFS IIP++LRVNLD+ KIV +++I RD +IP  +VR++TIPE+LGRISYL++DKTGTLTQNEM+FK+LHLGTV+YG DSMDE+   + S Y   +  PP        TKVR+T + RV EAV+AIALCHNV PV E   + D+  +     D                YQASSPDEVALV WTE+VGLTLV RD +SMQLRT    +LN+ ILQIFPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK + EEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLETLRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  +D G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L+YKTF +WVLISIYQG  IMYGALLLFE +FVH+V+I+FTSL+LTELLMVALTI+TWH LM +AE++SL  Y+ SL+ L ++ D  F+ T+SF+WKV+ +T +SC+PL++LKY+R +  PP ++KL
Sbjct:  112 CYVRDKEV---------NSQVYSRLTARGTVVGVVLYTGRELRSVMNTSNPRSKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQYED------------SCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQILNFTILQIFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLAEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKL 909          

HSP 2 Score: 134.42 bits (337), Expect = 3.590e-31
Identity = 65/128 (50.78%), Postives = 83/128 (64.84%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNG 676
             CC W  C        E   R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N+ FL++ACSQF+P +++G LYTYW PLGFV+ VT+ REAV++IR + RD+EVN   Y +L   G
Sbjct:    8 GCCEWLRCCGG----GEARPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTVIREAVEEIRCYVRDKEVNSQVYSRLTARG 131          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Match: ATP9B (ATPase phospholipid transporting 9B (putative) [Source:HGNC Symbol;Acc:HGNC:13541])

HSP 1 Score: 458.759 bits (1179), Expect = 6.554e-149
Identity = 235/424 (55.42%), Postives = 312/424 (73.58%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGT 1423
            F+NE + +H   R +    K   E F             +K+LC+  SCC    I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+EVN   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQ+L     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  V LS++M+ L+GF G WY+ L+RF LLFSYIIP++LRVNLD+ K V  +++M+DE IP  +VRT+TIPEELGR+ YL++DKTG 
Sbjct:   10 FENEESDYHTLPRARIMQRKRGLEWFVCDG---------WKFLCT--SCC-GWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGA 420          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-5 (Phospholipid-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EE81])

HSP 1 Score: 1136.71 bits (2939), Expect = 0.000e+0
Identity = 571/1034 (55.22%), Postives = 751/1034 (72.63%), Query Frame = 2
Query:  317 CIKKCKRQKEYFARIVTIGRPPRVQK----FPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAED-PLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSM----QLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLA-TIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTG-CRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            C     R++   +R V +G  P        F  N + NQKYN  +F+P+VLF+QF  FLN+ FL+MACSQFIPA++IG   TYWGPLGFV+ +TL REA DD  R+ RDR++N  +Y KL ++G +  I S+ IEVGD+II+ K++R+PAD+V L+TT+KSG CFIRTDQLDGETDWKLRI VP TQ L     I ++  ++YAEKP K+IH F G    TD+   +D  L+VEN LWANTV+A+G AVG+V+YTG ETR+VMN++ P SK GL+D E+NNLTKLLF   +VLS +M+ +KG    WY+YL RF LLFSYIIP++LRVNLD+AK+  ++ I RD+ IP+ ++R++TIPEELGRIS+L+SDKTGTLT+NEM FKK+HLGTV++ +D+ +E+ + ++S Y           K++         AV+AIALCHNV P+ E               +G+         ++YQA+SPDEVALV WTETVG+ L +RDL++M    QL     L+  ++IL +FPFTSETKRM II+KDE T E++L MKGAD VM+ MV + DWLDEE  NMAREGLRTLVV +K +++ +   F+  YH AK+SISDR+  +A  +   +ERDL LLCLTGVED+LQ+ V  +LE LRNAGI++WMLTGDKLETA  IAKSS L SR+ ++HVF  V  R +AH ELN  R+++D ALV+ G +L  CL++YE E  +L   C AVV CRCSP QKA IV+LLR +    R+AAIGDGGNDVSMI AA  GIGI   EG+QASLA+DFS+ QF+HV +L LVHGR  YK +  LSQFV+HRG+IIS MQAIFS +FYF ++ L+ G LMV Y+T +TM PVFSLV+D+DVT   ALTYPELYK L KGR L+YKTF +WVLIS+YQG +IMYGALL+F+ DF+HVVSI+F++L++TEL+MVA+T+ TWH  ML+A+ +SL +Y++SLI+   YFD  F+ +  F+ K  A+TA+SC+PL+I+K +R K  PP + K+ 
Sbjct:   70 CRSLFSRRRVLHSRTVRVGYGPVGHDANVTFTPNTVCNQKYNIFSFVPIVLFQQFKFFLNLYFLLMACSQFIPAIQIGAPITYWGPLGFVLTITLIREAFDDFVRYLRDRDLNSEKYEKLTRDGTRIEIRSADIEVGDVIIMHKDRRVPADVVLLRTTDKSGACFIRTDQLDGETDWKLRIPVPHTQHLPNEADIMELNCEVYAEKPQKDIHAFVGTLKITDDDNVQDGSLNVENVLWANTVVASGTAVGIVVYTGRETRSVMNTTLPESKVGLLDLEVNNLTKLLFCFVLVLSSVMVAMKGLDNLWYRYLMRFILLFSYIIPISLRVNLDMAKLFYSWQIGRDKHIPETVIRSSTIPEELGRISFLLSDKTGTLTKNEMHFKKIHLGTVAFSSDAFEEVGQHVRSAYAGRLAKHSFSAKLQN--------AVEAIALCHNVTPIFE---------------NGE---------ISYQAASPDEVALVKWTETVGVRLASRDLHAMSLSVQLPNGQTLMKQFQILYVFPFTSETKRMGIIVKDETTDEVTLLMKGADTVMSGMVQYNDWLDEECSNMAREGLRTLVVARKPLSQAELEAFDRAYHAAKMSISDRSQNMANVVNRMLERDLQLLCLTGVEDRLQDQVTTSLELLRNAGIKIWMLTGDKLETAICIAKSSGLFSRSDNIHVFGNVHNRTDAHNELNNLRRKTDVALVMPGSALNVCLQYYEAEVAELVCACTAVVCCRCSPEQKAQIVQLLRKYRAPLRVAAIGDGGNDVSMIQAAHAGIGIDANEGKQASLAADFSITQFSHVCRLLLVHGRFCYKRSCALSQFVMHRGLIISTMQAIFSCVFYFASVSLYQGVLMVAYSTCYTMLPVFSLVVDRDVTATNALTYPELYKELGKGRSLSYKTFCIWVLISLYQGAVIMYGALLVFDADFIHVVSISFSALIVTELIMVAMTVHTWHWAMLLAQALSLGLYMISLILFDQYFDRQFVLSWVFISKTTAITAVSCLPLYIVKALRRKFSPPSYAKVN 1071          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-5 (Phospholipid-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EE81])

HSP 1 Score: 1135.55 bits (2936), Expect = 0.000e+0
Identity = 571/1034 (55.22%), Postives = 751/1034 (72.63%), Query Frame = 2
Query:  317 CIKKCKRQKEYFARIVTIGRPPRVQK----FPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAED-PLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSM----QLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLA-TIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTG-CRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            C     R++   +R V +G  P        F  N + NQKYN  +F+P+VLF+QF  FLN+ FL+MACSQFIPA++IG   TYWGPLGFV+ +TL REA DD  R+ RDR++N  +Y KL ++G +  I S+ IEVGD+II+ K++R+PAD+V L+TT+KSG CFIRTDQLDGETDWKLRI VP TQ L     I ++  ++YAEKP K+IH F G    TD+   +D  L+VEN LWANTV+A+G AVG+V+YTG ETR+VMN++ P SK GL+D E+NNLTKLLF   +VLS +M+ +KG    WY+YL RF LLFSYIIP++LRVNLD+AK+  ++ I RD+ IP+ ++R++TIPEELGRIS+L+SDKTGTLT+NEM FKK+HLGTV++ +D+ +E+ + ++S Y           K++         AV+AIALCHNV P+ E               +G+         ++YQA+SPDEVALV WTETVG+ L +RDL++M    QL     L+  ++IL +FPFTSETKRM II+KDE T E++L MKGAD VM+ MV + DWLDEE  NMAREGLRTLVV +K +++ +   F+  YH AK+SISDR+  +A  +   +ERDL LLCLTGVED+LQ+ V  +LE LRNAGI++WMLTGDKLETA  IAKSS L SR+ ++HVF  V  R +AH ELN  R+++D ALV+ G +L  CL++YE E  +L   C AVV CRCSP QKA IV+LLR +    R+AAIGDGGNDVSMI AA  GIGI   EG+QASLA+DFS+ QF+HV +L LVHGR  YK +  LSQFV+HRG+IIS MQAIFS +FYF ++ L+ G LMV Y+T +TM PVFSLV+D+DVT   ALTYPELYK L KGR L+YKTF +WVLIS+YQG +IMYGALL+F+ DF+HVVSI+F++L++TEL+MVA+T+ TWH  ML+A+ +SL +Y++SLI+   YFD  F+ +  F+ K  A+TA+SC+PL+I+K +R K  PP + K+ 
Sbjct:   73 CRSLFSRRRVLHSRTVRVGYGPVGHDANVTFTPNTVCNQKYNIFSFVPIVLFQQFKFFLNLYFLLMACSQFIPAIQIGAPITYWGPLGFVLTITLIREAFDDFVRYLRDRDLNSEKYEKLTRDGTRIEIRSADIEVGDVIIMHKDRRVPADVVLLRTTDKSGACFIRTDQLDGETDWKLRIPVPHTQHLPNEADIMELNCEVYAEKPQKDIHAFVGTLKITDDDNVQDGSLNVENVLWANTVVASGTAVGIVVYTGRETRSVMNTTLPESKVGLLDLEVNNLTKLLFCFVLVLSSVMVAMKGLDNLWYRYLMRFILLFSYIIPISLRVNLDMAKLFYSWQIGRDKHIPETVIRSSTIPEELGRISFLLSDKTGTLTKNEMHFKKIHLGTVAFSSDAFEEVGQHVRSAYAGRLAKHSFSAKLQN--------AVEAIALCHNVTPIFE---------------NGE---------ISYQAASPDEVALVKWTETVGVRLASRDLHAMSLSVQLPNGQTLMKQFQILYVFPFTSETKRMGIIVKDETTDEVTLLMKGADTVMSGMVQYNDWLDEECSNMAREGLRTLVVARKPLSQAELEAFDRAYHAAKMSISDRSQNMANVVNRMLERDLQLLCLTGVEDRLQDQVTTSLELLRNAGIKIWMLTGDKLETAICIAKSSGLFSRSDNIHVFGNVHNRTDAHNELNNLRRKTDVALVMPGSALNVCLQYYEAEVAELVCACTAVVCCRCSPEQKAQIVQLLRKYRAPLRVAAIGDGGNDVSMIQAAHAGIGIDANEGKQASLAADFSITQFSHVCRLLLVHGRFCYKRSCALSQFVMHRGLIISTMQAIFSCVFYFASVSLYQGVLMVAYSTCYTMLPVFSLVVDRDVTATNALTYPELYKELGKGRSLSYKTFCIWVLISLYQGAVIMYGALLVFDADFIHVVSISFSALIVTELIMVAMTVHTWHWAMLLAQALSLGLYMISLILFDQYFDRQFVLSWVFISKTTAITAVSCLPLYIVKALRRKFSPPSYAKVN 1074          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-5 (Phospholipid-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EE81])

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 571/1034 (55.22%), Postives = 751/1034 (72.63%), Query Frame = 2
Query:  317 CIKKCKRQKEYFARIVTIGRPPRVQK----FPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAED-PLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSM----QLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLA-TIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTG-CRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            C     R++   +R V +G  P        F  N + NQKYN  +F+P+VLF+QF  FLN+ FL+MACSQFIPA++IG   TYWGPLGFV+ +TL REA DD  R+ RDR++N  +Y KL ++G +  I S+ IEVGD+II+ K++R+PAD+V L+TT+KSG CFIRTDQLDGETDWKLRI VP TQ L     I ++  ++YAEKP K+IH F G    TD+   +D  L+VEN LWANTV+A+G AVG+V+YTG ETR+VMN++ P SK GL+D E+NNLTKLLF   +VLS +M+ +KG    WY+YL RF LLFSYIIP++LRVNLD+AK+  ++ I RD+ IP+ ++R++TIPEELGRIS+L+SDKTGTLT+NEM FKK+HLGTV++ +D+ +E+ + ++S Y           K++         AV+AIALCHNV P+ E               +G+         ++YQA+SPDEVALV WTETVG+ L +RDL++M    QL     L+  ++IL +FPFTSETKRM II+KDE T E++L MKGAD VM+ MV + DWLDEE  NMAREGLRTLVV +K +++ +   F+  YH AK+SISDR+  +A  +   +ERDL LLCLTGVED+LQ+ V  +LE LRNAGI++WMLTGDKLETA  IAKSS L SR+ ++HVF  V  R +AH ELN  R+++D ALV+ G +L  CL++YE E  +L   C AVV CRCSP QKA IV+LLR +    R+AAIGDGGNDVSMI AA  GIGI   EG+QASLA+DFS+ QF+HV +L LVHGR  YK +  LSQFV+HRG+IIS MQAIFS +FYF ++ L+ G LMV Y+T +TM PVFSLV+D+DVT   ALTYPELYK L KGR L+YKTF +WVLIS+YQG +IMYGALL+F+ DF+HVVSI+F++L++TEL+MVA+T+ TWH  ML+A+ +SL +Y++SLI+   YFD  F+ +  F+ K  A+TA+SC+PL+I+K +R K  PP + K+ 
Sbjct:   34 CRSLFSRRRVLHSRTVRVGYGPVGHDANVTFTPNTVCNQKYNIFSFVPIVLFQQFKFFLNLYFLLMACSQFIPAIQIGAPITYWGPLGFVLTITLIREAFDDFVRYLRDRDLNSEKYEKLTRDGTRIEIRSADIEVGDVIIMHKDRRVPADVVLLRTTDKSGACFIRTDQLDGETDWKLRIPVPHTQHLPNEADIMELNCEVYAEKPQKDIHAFVGTLKITDDDNVQDGSLNVENVLWANTVVASGTAVGIVVYTGRETRSVMNTTLPESKVGLLDLEVNNLTKLLFCFVLVLSSVMVAMKGLDNLWYRYLMRFILLFSYIIPISLRVNLDMAKLFYSWQIGRDKHIPETVIRSSTIPEELGRISFLLSDKTGTLTKNEMHFKKIHLGTVAFSSDAFEEVGQHVRSAYAGRLAKHSFSAKLQN--------AVEAIALCHNVTPIFE---------------NGE---------ISYQAASPDEVALVKWTETVGVRLASRDLHAMSLSVQLPNGQTLMKQFQILYVFPFTSETKRMGIIVKDETTDEVTLLMKGADTVMSGMVQYNDWLDEECSNMAREGLRTLVVARKPLSQAELEAFDRAYHAAKMSISDRSQNMANVVNRMLERDLQLLCLTGVEDRLQDQVTTSLELLRNAGIKIWMLTGDKLETAICIAKSSGLFSRSDNIHVFGNVHNRTDAHNELNNLRRKTDVALVMPGSALNVCLQYYEAEVAELVCACTAVVCCRCSPEQKAQIVQLLRKYRAPLRVAAIGDGGNDVSMIQAAHAGIGIDANEGKQASLAADFSITQFSHVCRLLLVHGRFCYKRSCALSQFVMHRGLIISTMQAIFSCVFYFASVSLYQGVLMVAYSTCYTMLPVFSLVVDRDVTATNALTYPELYKELGKGRSLSYKTFCIWVLISLYQGAVIMYGALLVFDADFIHVVSISFSALIVTELIMVAMTVHTWHWAMLLAQALSLGLYMISLILFDQYFDRQFVLSWVFISKTTAITAVSCLPLYIVKALRRKFSPPSYAKVN 1035          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-6 (Phospholipid-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:P91203])

HSP 1 Score: 1087.4 bits (2811), Expect = 0.000e+0
Identity = 542/1028 (52.72%), Postives = 746/1028 (72.57%), Query Frame = 2
Query:  335 RQKEYFARIVTIGRPP----RVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRT-DEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQL--RTSNG--LLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLAT-IERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTG-CRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            RQ+   +R V IG  P      + FP N ++NQKYN  +F+P+VLF++F  FLN+ FL+MA SQ +P  KIG L TYW PLGF++ +TL REA++D  R+ RDRE+N  +Y KL ++G +  I S+ I+VGD+I++ K++R+PAD+V L+T++KS +CFIRTDQLDGETDWKL+I +P TQ L     I ++  ++YAEKP K+I++F G    T D+   E  L VEN LWANTV+++G A+G+V+YTG ETR+VMN++ P  K GL+D EINNLTKLLF   ++L+ +M+++KG +  WY YL RF LLFSYIIP++LR N+D+AK+  ++ I  D  IP+ +VR++TIPEELGRIS+L+SDKTGTLT+NEM FKK+HLGTV++  D+++E+ + +KS Y+S     P   K++         AV+++ALCHNV PV E               +G+         ++YQA+SPDEVALV WTETVG+ L +RDL++M L  + SNG  + + ++IL +FPFTSE KRM II+K+E +GE++L++KGAD VM+ MV + DWLDEE  NMAREGLRTLV  KK+++  +   F+  YH AK+SI++R   +A  +   +ERDL L+CLTGVED+LQ+ V  +LE LRNAGI++WMLTGDKLETA  IAKSS L S++  +HVF  V  R +A+ EL+  R +++ ALV+ G SL  CL++YE E  +L     AVV CRCSP QKA IV+LLR +    R+AAIGDGGNDVSMI AA  GIGI   EG+QASLA+DFS+ QF+H+ +L LVHGR +YK + TL+QF++HRG++IS++QAIFS +FYFVA+ L+ G LMV + + +T+ PVFSL+ D+DVT   ALTYPELYK L KGR L+YKTFF+WV ISIYQG +IMYGALL+F+ D +H+VSI+F++L+ TEL+MVALT+ TWH LML+A+ +SL +YVVSLI L  +FD  F+ +  F+ K  A+T +S +PL+ +K +R K  PP   K++
Sbjct:   69 RQRALHSRTVRIGYGPIDHDSPRTFPPNTVRNQKYNIFSFVPVVLFQEFKFFLNLYFLIMAFSQLVPIFKIGALVTYWFPLGFILTITLIREAIEDFARFLRDRELNSEKYEKLTRDGTRVEIKSADIKVGDVIVMHKDRRVPADVVLLRTSDKSSSCFIRTDQLDGETDWKLKIPIPFTQHLANESEIMELNCEVYAEKPQKDIYSFVGTVKITADDKIHEGSLDVENVLWANTVVSSGTAIGVVVYTGCETRSVMNTTVPEYKVGLLDLEINNLTKLLFCFVLLLASVMVLMKGPTSLWYLYLARFILLFSYIIPISLRTNVDMAKLFYSWQIGHDHHIPETVVRSSTIPEELGRISFLLSDKTGTLTKNEMHFKKIHLGTVAFSGDALEEVEQHVKSAYDSALVKHPFSAKLKN--------AVESLALCHNVTPVLE---------------NGE---------LSYQAASPDEVALVKWTETVGVKLAHRDLHTMTLDVQPSNGTTVPIQFQILHVFPFTSERKRMGIIVKEETSGEVTLYIKGADTVMSDMVQYNDWLDEECTNMAREGLRTLVFAKKILSRAELEAFDQAYHAAKMSITNRTQNMANVVKNMLERDLQLICLTGVEDRLQDQVTTSLELLRNAGIKIWMLTGDKLETAICIAKSSGLFSKSDHIHVFGSVQTRTDAYNELDNLRNKTNIALVMPGSSLNICLQYYEEEVAELVCASTAVVCCRCSPEQKAQIVQLLRKYRAPLRVAAIGDGGNDVSMIQAAHAGIGIDANEGKQASLAADFSITQFSHICRLLLVHGRFSYKRSCTLAQFIMHRGLLISIVQAIFSCVFYFVAVSLYQGVLMVAFTSCYTLLPVFSLIADRDVTATNALTYPELYKELVKGRTLSYKTFFIWVFISIYQGAVIMYGALLIFDTDILHIVSISFSALIATELIMVALTVHTWHWLMLVAQALSLGLYVVSLITLDQFFDRKFVFSWVFITKTTAITVVSSLPLYFIKTLRRKFSPPSFAKVK 1064          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Match: tat-1 (Phospholipid-transporting ATPase tat-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U280])

HSP 1 Score: 421.009 bits (1081), Expect = 1.080e-127
Identity = 295/930 (31.72%), Postives = 477/930 (51.29%), Query Frame = 2
Query:  383 RVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIML----ILKG--FSGSWY----------KYLW---RFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQV------IVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTF-------TDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDS--------ALVITGQSLQTCLEF-YEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL-DKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISI 3043
              Q+F SN I   KYN  +F+P  L+EQF  + N+ FL +A  Q IP +     YT   P   ++ V+  +E  +D++R + D +VN    V+++ +G         + VGD I +D +   PAD++ L ++E+ G  +I T  LDGET+ K++ A+  T  + + E + + +++I  E P+++++ F G               ++  L     L N   + G VIYTG +++ +MNS +   K G ID + N     LF   V L+LI      I +G     +WY           +LW    FF+L++ +IP++L+V L++ +   A  I  D E+  V      I RT+ + EELG++ ++MSDKTGTLT+N M FK+L +G+ +YG +  DE A+   S  E        D +     +  +LE ++ +A+CH V+P                         N +  + YQ+SSPDE ALV    +  ++   R    + +    G     +IL +  FTS+ KRMS+I++D   G+I L+ KGAD V+ + +          ++  E   + A  G RTL    + +TE++Y  +   Y +A L+I +RA  +A     +ER++ L+  T +EDKLQE V  T++ L  A IRVWMLTGDK ETA +IA S  L   N  L +        E + +L  F  R+          A+VI G+SL   L       F  LA++C AVV CR SP QKA++V ++R      + AIGDG NDV+MI AA+VG+GI G+EG QA+ ASD+++ +F+ + +L LVHG   +  +  +  +  ++ + + +++  F+    +    +F  + +  +  +FT +P   L L D  V  +  + YP LY S  + R  +   F +W+ ++I
Sbjct:   24 HAQRFCSNRISTCKYNGFSFLPRFLYEQFRRYNNIFFLAIALLQQIPDVSPTGRYTTAVPFLIILSVSALKEIFEDVKRRRSDNKVNAFS-VEILVDGHWIEKQWKDVSVGDFIRIDNDSLFPADLLLLASSEQQGMAYIETSNLDGETNLKIKQALDITSTMTSPEKLSQFESEITCEPPSRHVNEFNGNIEINGVARH---FGIDQLLLRGARLKNTAWIFGAVIYTGHDSKLLMNSKRAPLKSGTIDVQTNYRIIFLFFVLVALALISATGSEIWRGNNIPQAWYLSFLEHDPKGSFLWGVLTFFILYNNLIPISLQVTLEVVRFFQAIYINNDIEMYDVNSDSCAIARTSNLNEELGQVKFIMSDKTGTLTRNVMKFKRLSIGSRNYGNNEDDEFAD--ASLIE--------DYRQGDEHSTSILEVLKMMAVCHTVVP------------------------ENKDGQLIYQSSSPDEAALVRGAASQSVSFHTRQPQKV-ICNVFGEDETIEILDVIDFTSDRKRMSVIVRDGAGGDIKLYTKGADTVIFERLEHGKEQEEAVEYCTEHLEDYASFGYRTLCFSMRHLTEQEYSQWAPEYKKAILAIDNRAKLLADAAEKLERNMILVGATAIEDKLQEWVPETIQALMAADIRVWMLTGDKRETAINIAHSCALCHTNTELLIVDKTT-YEETYQKLEQFVARAIELEKQEKGFAMVIDGKSLLHALTGEARKHFGDLALRCHAVVCCRMSPMQKAEVVEMVRKLAKHVVLAIGDGANDVAMIQAANVGVGISGEEGLQAASASDYAIPRFHFLRRLLLVHGAWNHDRSVKVILYSFYKNICLYIIELWFAMFSAWSGQTIFERWTIGMFNVIFTAWPPVVLGLFDHPVPAEQIMKYPALYASF-QNRAFSIGNFSLWIGLAI 912          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: CG31729 (gene:FBgn0051729 transcript:FBtr0080461)

HSP 1 Score: 1239.94 bits (3207), Expect = 0.000e+0
Identity = 622/1084 (57.38%), Postives = 820/1084 (75.65%), Query Frame = 2
Query:  230 IFFGSNRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNG--DKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYES----------------GATMPPV-DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILS---NLEQTVT------YQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTS-----NGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +F+  NRR ++       +C L   C  SC +K  R +E  AR V +GR    +KFP N I+NQKYNFITF+PLVLFEQF  FLN+ FL+MA SQFIP ++IGY YTYWGPLGFV+ VT+CREAVDD+RR +RD EVN  +Y +L          + SSK++VGD+IIV+KN+R+PAD++ L+T+++SG+ F+RTDQLDGETDWK R+AVP TQ+L     +  I A  Y EKP  +IH+F   F   D  E +  LSVENTLWANTV+A G A G+VIYTG ETR+VMN+SQPRSK GL+D EIN LTK+LF   + LSL+M++LKGF G WY+Y++RF LLFSYIIP++LRVNLD+ K   ++ +  D  I   +VR+TTIPEELGRISY+++DKTGTLTQNEM+FKK+HLG VS+ AD+   I + ++    +                 +T P +   ++R+    R  EAV+A+ALCHNV PV + ED  S    S   G  ++      N+E   +      YQA+SPDE+ALV WTE VGLTL+ RDLN+M L+       N +LL+Y+ILQ+FPFTSE+KRM II+++ +TG+I+ ++KGAD+VM+ +V + DWL EE+GNMAREGLRTLVV KKV+TEEQY DFE+RY+ A+LSI+DR AKVAA   ++ER+L+LLCLTGVED+LQE+VRPTLE LRNAG+RVWMLTGDKLETA  IAKSS+L+ RNQ LHV + V  R +AH ELN+FR++   ALVI+G+SL+ CL++Y  EF++LA   PAVV CRCSPTQKA +V L++ HTG R  A+GDGGNDVSMI  AD G+GI G+EGRQASLA DFS+ QF+H+AKL L+HGR +YK +A LSQFVIHRG+II+ +QA+FSA+FY  ++ L+ GFLMVGY+T++TMFPVFSLVLD+D+T + A+TYPELYK L+KGR L+YKTFF+WVLISIYQGG+IMYGAL+LF D+F+H+V+I+F++L++TEL+MVALT+RTWH LM++AE+ SL +Y++SL VL +YFD +F+ +  F+WKV+ +T +SC+PL+I+K++R K  PP + KL
Sbjct:  178 VFYQHNRRKSKSRSIGN-VCKL---CLCSCWRKWFRPRELRARTVNLGRV-NTEKFPPNEIRNQKYNFITFLPLVLFEQFRFFLNLYFLLMALSQFIPDIRIGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHEVNSQKYKRLSSTNISGYEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDRSGSVFVRTDQLDGETDWKPRLAVPYTQKLSRDSELHSIDASFYVEKPQNDIHSFIATFCMADGSE-DTGLSVENTLWANTVVAAGTATGIVIYTGCETRSVMNNSQPRSKVGLLDMEINGLTKVLFCAVLGLSLVMMMLKGFGGPWYRYMFRFVLLFSYIIPISLRVNLDMGKAFYSWQMQNDSNIQGTVVRSTTIPEELGRISYVLTDKTGTLTQNEMVFKKIHLGIVSHDADTFHHIGQMIQKLSGNILQQQQGSLSSSSSGGDSTKPMMFGNRMRRPEGWREWEAVRALALCHNVTPVSDDEDNRSVSTASTVTGGNNSPTKSVINIEAPGSTDTEHQYQAASPDEIALVKWTEQVGLTLIARDLNTMTLQVKTPSEDNDILLHYQILQLFPFTSESKRMGIIVRESKTGQITFYLKGADVVMSSIVQYNDWLSEESGNMAREGLRTLVVAKKVLTEEQYSDFETRYNAARLSITDRVAKVAAVTESLERELELLCLTGVEDRLQENVRPTLELLRNAGVRVWMLTGDKLETACCIAKSSQLIGRNQGLHVLRSVKTRTDAHQELNSFRRKQGHALVISGESLEVCLQYYRPEFLELATASPAVVCCRCSPTQKAQVVALIQKHTGKRTCAVGDGGNDVSMIQQADAGVGIEGREGRQASLAGDFSIPQFSHIAKLLLIHGRRSYKRSAALSQFVIHRGLIITTLQAVFSAVFYLSSVALYQGFLMVGYSTLYTMFPVFSLVLDQDITSETAVTYPELYKDLSKGRSLSYKTFFIWVLISIYQGGVIMYGALILFVDEFIHIVAISFSALIMTELIMVALTVRTWHRLMVLAELFSLALYLISLAVLHEYFDWEFIWSYDFLWKVSLITLVSCLPLYIIKFLRKKCSPPSYLKL 1255          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: CG31729 (gene:FBgn0051729 transcript:FBtr0080462)

HSP 1 Score: 1234.17 bits (3192), Expect = 0.000e+0
Identity = 620/1079 (57.46%), Postives = 815/1079 (75.53%), Query Frame = 2
Query:  245 NRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNG--DKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSF----------------YESGATMPPV-DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILS---NLEQTVT------YQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTS-----NGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            NR+ NR+ +F             SC +K  R +E  AR V +GR    +KFP N I+NQKYNFITF+PLVLFEQF  FLN+ FL+MA SQFIP ++IGY YTYWGPLGFV+ VT+CREAVDD+RR +RD EVN  +Y +L          + SSK++VGD+IIV+KN+R+PAD++ L+T+++SG+ F+RTDQLDGETDWK R+AVP TQ+L     +  I A  Y EKP  +IH+F   F   D  E +  LSVENTLWANTV+A G A G+VIYTG ETR+VMN+SQPRSK GL+D EIN LTK+LF   + LSL+M++LKGF G WY+Y++RF LLFSYIIP++LRVNLD+ K   ++ +  D  I   +VR+TTIPEELGRISY+++DKTGTLTQNEM+FKK+HLG VS+ AD+   I + ++                      +T P +   ++R+    R  EAV+A+ALCHNV PV + ED  S    S   G  ++      N+E   +      YQA+SPDE+ALV WTE VGLTL+ RDLN+M L+       N +LL+Y+ILQ+FPFTSE+KRM II+++ +TG+I+ ++KGAD+VM+ +V + DWL EE+GNMAREGLRTLVV KKV+TEEQY DFE+RY+ A+LSI+DR AKVAA   ++ER+L+LLCLTGVED+LQE+VRPTLE LRNAG+RVWMLTGDKLETA  IAKSS+L+ RNQ LHV + V  R +AH ELN+FR++   ALVI+G+SL+ CL++Y  EF++LA   PAVV CRCSPTQKA +V L++ HTG R  A+GDGGNDVSMI  AD G+GI G+EGRQASLA DFS+ QF+H+AKL L+HGR +YK +A LSQFVIHRG+II+ +QA+FSA+FY  ++ L+ GFLMVGY+T++TMFPVFSLVLD+D+T + A+TYPELYK L+KGR L+YKTFF+WVLISIYQGG+IMYGAL+LF D+F+H+V+I+F++L++TEL+MVALT+RTWH LM++AE+ SL +Y++SL VL +YFD +F+ +  F+WKV+ +T +SC+PL+I+K++R K  PP + KL
Sbjct:   23 NRQRNRWYLF-------------SCWRKWFRPRELRARTVNLGRV-NTEKFPPNEIRNQKYNFITFLPLVLFEQFRFFLNLYFLLMALSQFIPDIRIGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHEVNSQKYKRLSSTNISGYEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDRSGSVFVRTDQLDGETDWKPRLAVPYTQKLSRDSELHSIDASFYVEKPQNDIHSFIATFCMADGSE-DTGLSVENTLWANTVVAAGTATGIVIYTGCETRSVMNNSQPRSKVGLLDMEINGLTKVLFCAVLGLSLVMMMLKGFGGPWYRYMFRFVLLFSYIIPISLRVNLDMGKAFYSWQMQNDSNIQGTVVRSTTIPEELGRISYVLTDKTGTLTQNEMVFKKIHLGIVSHDADTFHHIGQMIQKLSGNILQQQQGSLSSSSSGGDSTKPMMFGNRMRRPEGWREWEAVRALALCHNVTPVSDDEDNRSVSTASTVTGGNNSPTKSVINIEAPGSTDTEHQYQAASPDEIALVKWTEQVGLTLIARDLNTMTLQVKTPSEDNDILLHYQILQLFPFTSESKRMGIIVRESKTGQITFYLKGADVVMSSIVQYNDWLSEESGNMAREGLRTLVVAKKVLTEEQYSDFETRYNAARLSITDRVAKVAAVTESLERELELLCLTGVEDRLQENVRPTLELLRNAGVRVWMLTGDKLETACCIAKSSQLIGRNQGLHVLRSVKTRTDAHQELNSFRRKQGHALVISGESLEVCLQYYRPEFLELATASPAVVCCRCSPTQKAQVVALIQKHTGKRTCAVGDGGNDVSMIQQADAGVGIEGREGRQASLAGDFSIPQFSHIAKLLLIHGRRSYKRSAALSQFVIHRGLIITTLQAVFSAVFYLSSVALYQGFLMVGYSTLYTMFPVFSLVLDQDITSETAVTYPELYKDLSKGRSLSYKTFFIWVLISIYQGGVIMYGALILFVDEFIHIVAISFSALIMTELIMVALTVRTWHRLMVLAELFSLALYLISLAVLHEYFDWEFIWSYDFLWKVSLITLVSCLPLYIIKFLRKKCSPPSYLKL 1086          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: CG31729 (gene:FBgn0051729 transcript:FBtr0344140)

HSP 1 Score: 1231.85 bits (3186), Expect = 0.000e+0
Identity = 615/1056 (58.24%), Postives = 807/1056 (76.42%), Query Frame = 2
Query:  314 SCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKN--GDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSF----------------YESGATMPPV-DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILS---NLEQTVT------YQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTS-----NGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            SC +K  R +E  AR V +GR    +KFP N I+NQKYNFITF+PLVLFEQF  FLN+ FL+MA SQFIP ++IGY YTYWGPLGFV+ VT+CREAVDD+RR +RD EVN  +Y +L          + SSK++VGD+IIV+KN+R+PAD++ L+T+++SG+ F+RTDQLDGETDWK R+AVP TQ+L     +  I A  Y EKP  +IH+F   F   D  E +  LSVENTLWANTV+A G A G+VIYTG ETR+VMN+SQPRSK GL+D EIN LTK+LF   + LSL+M++LKGF G WY+Y++RF LLFSYIIP++LRVNLD+ K   ++ +  D  I   +VR+TTIPEELGRISY+++DKTGTLTQNEM+FKK+HLG VS+ AD+   I + ++                      +T P +   ++R+    R  EAV+A+ALCHNV PV + ED  S    S   G  ++      N+E   +      YQA+SPDE+ALV WTE VGLTL+ RDLN+M L+       N +LL+Y+ILQ+FPFTSE+KRM II+++ +TG+I+ ++KGAD+VM+ +V + DWL EE+GNMAREGLRTLVV KKV+TEEQY DFE+RY+ A+LSI+DR AKVAA   ++ER+L+LLCLTGVED+LQE+VRPTLE LRNAG+RVWMLTGDKLETA  IAKSS+L+ RNQ LHV + V  R +AH ELN+FR++   ALVI+G+SL+ CL++Y  EF++LA   PAVV CRCSPTQKA +V L++ HTG R  A+GDGGNDVSMI  AD G+GI G+EGRQASLA DFS+ QF+H+AKL L+HGR +YK +A LSQFVIHRG+II+ +QA+FSA+FY  ++ L+ GFLMVGY+T++TMFPVFSLVLD+D+T + A+TYPELYK L+KGR L+YKTFF+WVLISIYQGG+IMYGAL+LF D+F+H+V+I+F++L++TEL+MVALT+RTWH LM++AE+ SL +Y++SL VL +YFD +F+ +  F+WKV+ +T +SC+PL+I+K++R K  PP + KL
Sbjct:   22 SCWRKWFRPRELRARTVNLGRV-NTEKFPPNEIRNQKYNFITFLPLVLFEQFRFFLNLYFLLMALSQFIPDIRIGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHEVNSQKYKRLSSTNISGYEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDRSGSVFVRTDQLDGETDWKPRLAVPYTQKLSRDSELHSIDASFYVEKPQNDIHSFIATFCMADGSE-DTGLSVENTLWANTVVAAGTATGIVIYTGCETRSVMNNSQPRSKVGLLDMEINGLTKVLFCAVLGLSLVMMMLKGFGGPWYRYMFRFVLLFSYIIPISLRVNLDMGKAFYSWQMQNDSNIQGTVVRSTTIPEELGRISYVLTDKTGTLTQNEMVFKKIHLGIVSHDADTFHHIGQMIQKLSGNILQQQQGSLSSSSSGGDSTKPMMFGNRMRRPEGWREWEAVRALALCHNVTPVSDDEDNRSVSTASTVTGGNNSPTKSVINIEAPGSTDTEHQYQAASPDEIALVKWTEQVGLTLIARDLNTMTLQVKTPSEDNDILLHYQILQLFPFTSESKRMGIIVRESKTGQITFYLKGADVVMSSIVQYNDWLSEESGNMAREGLRTLVVAKKVLTEEQYSDFETRYNAARLSITDRVAKVAAVTESLERELELLCLTGVEDRLQENVRPTLELLRNAGVRVWMLTGDKLETACCIAKSSQLIGRNQGLHVLRSVKTRTDAHQELNSFRRKQGHALVISGESLEVCLQYYRPEFLELATASPAVVCCRCSPTQKAQVVALIQKHTGKRTCAVGDGGNDVSMIQQADAGVGIEGREGRQASLAGDFSIPQFSHIAKLLLIHGRRSYKRSAALSQFVIHRGLIITTLQAVFSAVFYLSSVALYQGFLMVGYSTLYTMFPVFSLVLDQDITSETAVTYPELYKDLSKGRSLSYKTFFIWVLISIYQGGVIMYGALILFVDEFIHIVAISFSALIMTELIMVALTVRTWHRLMVLAELFSLALYLISLAVLHEYFDWEFIWSYDFLWKVSLITLVSCLPLYIIKFLRKKCSPPSYLKL 1075          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: CG31729 (gene:FBgn0051729 transcript:FBtr0344851)

HSP 1 Score: 1160.59 bits (3001), Expect = 0.000e+0
Identity = 578/994 (58.15%), Postives = 762/994 (76.66%), Query Frame = 2
Query:  500 MACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKN--GDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSF----------------YESGATMPPV-DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILS---NLEQTVT------YQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTS-----NGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            MA SQFIP ++IGY YTYWGPLGFV+ VT+CREAVDD+RR +RD EVN  +Y +L          + SSK++VGD+IIV+KN+R+PAD++ L+T+++SG+ F+RTDQLDGETDWK R+AVP TQ+L     +  I A  Y EKP  +IH+F   F   D  E +  LSVENTLWANTV+A G A G+VIYTG ETR+VMN+SQPRSK GL+D EIN LTK+LF   + LSL+M++LKGF G WY+Y++RF LLFSYIIP++LRVNLD+ K   ++ +  D  I   +VR+TTIPEELGRISY+++DKTGTLTQNEM+FKK+HLG VS+ AD+   I + ++                      +T P +   ++R+    R  EAV+A+ALCHNV PV + ED  S    S   G  ++      N+E   +      YQA+SPDE+ALV WTE VGLTL+ RDLN+M L+       N +LL+Y+ILQ+FPFTSE+KRM II+++ +TG+I+ ++KGAD+VM+ +V + DWL EE+GNMAREGLRTLVV KKV+TEEQY DFE+RY+ A+LSI+DR AKVAA   ++ER+L+LLCLTGVED+LQE+VRPTLE LRNAG+RVWMLTGDKLETA  IAKSS+L+ RNQ LHV + V  R +AH ELN+FR++   ALVI+G+SL+ CL++Y  EF++LA   PAVV CRCSPTQKA +V L++ HTG R  A+GDGGNDVSMI  AD G+GI G+EGRQASLA DFS+ QF+H+AKL L+HGR +YK +A LSQFVIHRG+II+ +QA+FSA+FY  ++ L+ GFLMVGY+T++TMFPVFSLVLD+D+T + A+TYPELYK L+KGR L+YKTFF+WVLISIYQGG+IMYGAL+LF D+F+H+V+I+F++L++TEL+MVALT+RTWH LM++AE+ SL +Y++SL VL +YFD +F+ +  F+WKV+ +T +SC+PL+I+K++R K  PP + KL
Sbjct:    1 MALSQFIPDIRIGYPYTYWGPLGFVLMVTICREAVDDLRRHQRDHEVNSQKYKRLSSTNISGYEMVPSSKLKVGDVIIVEKNERVPADLILLRTSDRSGSVFVRTDQLDGETDWKPRLAVPYTQKLSRDSELHSIDASFYVEKPQNDIHSFIATFCMADGSE-DTGLSVENTLWANTVVAAGTATGIVIYTGCETRSVMNNSQPRSKVGLLDMEINGLTKVLFCAVLGLSLVMMMLKGFGGPWYRYMFRFVLLFSYIIPISLRVNLDMGKAFYSWQMQNDSNIQGTVVRSTTIPEELGRISYVLTDKTGTLTQNEMVFKKIHLGIVSHDADTFHHIGQMIQKLSGNILQQQQGSLSSSSSGGDSTKPMMFGNRMRRPEGWREWEAVRALALCHNVTPVSDDEDNRSVSTASTVTGGNNSPTKSVINIEAPGSTDTEHQYQAASPDEIALVKWTEQVGLTLIARDLNTMTLQVKTPSEDNDILLHYQILQLFPFTSESKRMGIIVRESKTGQITFYLKGADVVMSSIVQYNDWLSEESGNMAREGLRTLVVAKKVLTEEQYSDFETRYNAARLSITDRVAKVAAVTESLERELELLCLTGVEDRLQENVRPTLELLRNAGVRVWMLTGDKLETACCIAKSSQLIGRNQGLHVLRSVKTRTDAHQELNSFRRKQGHALVISGESLEVCLQYYRPEFLELATASPAVVCCRCSPTQKAQVVALIQKHTGKRTCAVGDGGNDVSMIQQADAGVGIEGREGRQASLAGDFSIPQFSHIAKLLLIHGRRSYKRSAALSQFVIHRGLIITTLQAVFSAVFYLSSVALYQGFLMVGYSTLYTMFPVFSLVLDQDITSETAVTYPELYKDLSKGRSLSYKTFFIWVLISIYQGGVIMYGALILFVDEFIHIVAISFSALIMTELIMVALTVRTWHRLMVLAELFSLALYLISLAVLHEYFDWEFIWSYDFLWKVSLITLVSCLPLYIIKFLRKKCSPPSYLKL 993          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Match: ATP8A (gene:FBgn0259221 transcript:FBtr0303100)

HSP 1 Score: 445.277 bits (1144), Expect = 1.448e-136
Identity = 310/996 (31.12%), Postives = 507/996 (50.90%), Query Frame = 2
Query:  356 RIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGF------SGSWY------------KYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQ------VIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVM-----AQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPV---AGRAEAHLELNAFR----KRSDSALVITGQSLQTCLEF-YEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL-DKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLF----------EDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIA 3196
            RI+ +   P+  K+ +N I   KY+FI+F+P  LFEQF  + N  FL++A  Q IP +     YT   PL F++ V+  +E ++DI+R + D E+N  + ++ + +G   T+  S++ VGDII V  N   PAD++ L ++E    CFI T  LDGET+ K+R A+P T  L   + + +++ +I  E PN++++ F G    T +  A   L  +  L    +L N   V G+V+Y+G ET+ + NS+    K   +D+  N    +LF+  + L +I  +   F         WY              L  FF+L++ +IP++L+V L+L + + A  I  D E+         + RT+ + EELG + Y+ SDKTGTLTQN M FKK  +    Y A+   E ++ +++      T   ++            E ++ +++CH VIP R+   EN   GN                 + Y A+SPDE ALV   +  G     R    +++  + G+   Y++L +  FTS  KRMS+I++  +  +I LF KGAD V+      Q   F +         A +GLRTL +    +  + Y ++   + +A +++ +R +K+      IE +L LL  T +ED+LQ+ V  T+ +L +AGI +W+LTGDK ETA +I  S RL+S +  + +       A R   H     F+    K ++ ALVI G +L+  L      +F  L I C  V+ CR SP QKA++V ++   T     AIGDG NDV+MI  A+VGIGI G EG QA+ ASD+S+ QF ++ +L LVHG   Y   + L  +  ++ + + V++  F+    +    LF  + +  Y  +FT  P F++ L +K  T +  + YP LYK+    +  N K F++W+  ++     + +  L  +            D++ + ++ +T +++T  L   L   +W  L  +A
Sbjct:   34 RIINLN-GPQPTKYGNNRITTAKYSFISFLPAFLFEQFRRYSNCFFLLIAILQQIPEVSPTGRYTTLVPLMFILSVSAIKEIIEDIKRHRADNEINH-RSIERLDSGSWCTVRWSELTVGDIIKVGINTFFPADLILLSSSEPQAMCFIETANLDGETNLKIRQALPATAELLETKDLQRLEGRIECELPNRHLYEFNGVLRETGKPPA--ALGNDQVLQRGAILRNTAWVFGIVVYSGQETKLMKNSTSAPLKRSTVDKLTNTQILMLFMILISLCIISGLCNLFWTREHSETDWYLGLTDFKTKSLGYNLLTFFILYNNLIPISLQVTLELVRFLQAIFINYDIEMYHEESNTPAMARTSNLNEELGMVKYIFSDKTGTLTQNVMEFKKCSIAGYVYTAERTPEESQLVQNILGRHETSAVIE------------EFLELLSVCHTVIPERK---EN---GN-----------------MIYHAASPDERALVEGAQKFGYIFDTRTPKYVEI-NALGVRKRYEVLNVLEFTSSRKRMSLIVRTPE-NKIKLFCKGADTVIYERLAPQGQAFREQTLRHLEEFASDGLRTLCLAVADIRPDVYQEWSQTFDKASVALQNRESKLEDAANLIENNLRLLGATAIEDRLQDGVPETIASLLDAGIYIWVLTGDKQETAINIGYSCRLISHSMDIIILNEESLDATREVIHRHYGEFKSSSAKDANVALVIDGTTLKYALSCDLRNDFQDLCILCRVVICCRVSPMQKAEVVEMVTQSTNAVTLAIGDGANDVAMIQKANVGIGISGVEGLQAACASDYSIAQFRYLQRLLLVHGAWNYARISKLILYSFYKNVCLYVIELWFAVYSGWSGQILFERWTIGLYNVLFTAMPPFAMGLFEKFCTAETMIRYPMLYKTSQNAKLFNVKVFWIWIFNALLHSVFLFWLPLAAYTKEVIWSDGKTSDYLLMGNLVYTYVIVTVCLKAGLITNSWTWLTHLA 988          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp9b (ATPase phospholipid transporting 9B [Source:NCBI gene;Acc:568160])

HSP 1 Score: 1330.85 bits (3443), Expect = 0.000e+0
Identity = 658/1077 (61.10%), Postives = 833/1077 (77.34%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSR----TDEVEAEDP-------------------LSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMP-----PVDTKVRKTGAIRVLEAVQAIALCHNVIPVRE--IEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LCS  SCC    +  C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKLRI V  TQRL     +F I A +Y +KP  +IH+FEG F+R    + + E   P                   LS+ENTLWA+TV+A+G  +G+VIYTG E R+VMN+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   +   Y           S ++ P     P   KVRK+ + R+ EAV+AIALCHNV PV E  +   N+ P ++      D   S+  +T  YQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L Y ILQIFPFTSE+KRM II+++E TG+I+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFE+RY+QAKLSI DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LF+ +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++A+++SL  Y+ SL  L +YFD  F+ T  F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKVLCS--SCC-ECLVHTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNIVTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLRIGVACTQRLPALGDLFSISAYVYVQKPQLDIHSFEGNFTRISMKSKQTEMYKPTLMCDLCPQEDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKEMRSVMNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFLGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVSSAQSNGSSASSTPSRKPQPPAPKVRKSVSSRIHEAVKAIALCHNVTPVYESRVNGANAEPEST----EADQDFSDDNRT--YQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTYYILQIFPFTSESKRMGIIVREEATGDITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLTEEQYQDFENRYNQAKLSIHDRNLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHVFKPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFDQEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAQLISLACYLASLAFLNEYFDLSFITTRVFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1145          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp9b (ATPase phospholipid transporting 9B [Source:NCBI gene;Acc:568160])

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 658/1077 (61.10%), Postives = 833/1077 (77.34%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSR----TDEVEAEDP-------------------LSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMP-----PVDTKVRKTGAIRVLEAVQAIALCHNVIPVRE--IEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LCS  SCC    +  C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKLRI V  TQRL     +F I A +Y +KP  +IH+FEG F+R    + + E   P                   LS+ENTLWA+TV+A+G  +G+VIYTG E R+VMN+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   +   Y           S ++ P     P   KVRK+ + R+ EAV+AIALCHNV PV E  +   N+ P ++      D   S+  +T  YQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L Y ILQIFPFTSE+KRM II+++E TG+I+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFE+RY+QAKLSI DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LF+ +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++A+++SL  Y+ SL  L +YFD  F+ T  F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   40 WKVLCS--SCC-ECLVHTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNIVTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLRIGVACTQRLPALGDLFSISAYVYVQKPQLDIHSFEGNFTRISMKSKQTEMYKPTLMCDLCPQEDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKEMRSVMNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFLGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVSSAQSNGSSASSTPSRKPQPPAPKVRKSVSSRIHEAVKAIALCHNVTPVYESRVNGANAEPEST----EADQDFSDDNRT--YQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTYYILQIFPFTSESKRMGIIVREEATGDITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLTEEQYQDFENRYNQAKLSIHDRNLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHVFKPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFDQEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAQLISLACYLASLAFLNEYFDLSFITTRVFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1106          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: atp9b (ATPase phospholipid transporting 9B [Source:NCBI gene;Acc:568160])

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 657/1088 (60.39%), Postives = 831/1088 (76.38%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMP-----PVDTKVRKTGAIRVLEAVQAIALCHNVIPVRE--IEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPV---------------------------------AGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LCS  SCC    +  C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKLRI V  TQRL     +F I A +Y +KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG E R+VMN+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   +   Y           S ++ P     P   KVRK+ + R+ EAV+AIALCHNV PV E  +   N+ P ++      D   S+     TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L Y ILQIFPFTSE+KRM II+++E TG+I+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFE+RY+QAKLSI DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +HVF+PV                                 + R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LF+ +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++A+++SL  Y+ SL  L +YFD  F+ T  F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKVLCS--SCC-ECLVHTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNIVTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLRIGVACTQRLPALGDLFSISAYVYVQKPQLDIHSFEGNFTREDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKEMRSVMNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFLGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVSSAQSNGSSASSTPSRKPQPPAPKVRKSVSSRIHEAVKAIALCHNVTPVYESRVNGANAEPEST----EADQDFSD--DNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTYYILQIFPFTSESKRMGIIVREEATGDITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLTEEQYQDFENRYNQAKLSIHDRNLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHVFKPVGFKALVDLDLKINEFSVNTLWLNWKCFVFLWQVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFDQEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAQLISLACYLASLAFLNEYFDLSFITTRVFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1156          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: ATP9A (ATPase phospholipid transporting 9A (putative) [Source:NCBI gene;Acc:101886226])

HSP 1 Score: 1146.34 bits (2964), Expect = 0.000e+0
Identity = 582/1045 (55.69%), Postives = 758/1045 (72.54%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY-----ESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTV-----TYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALT----IRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            SCC W+ C        ++  R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N+ FL++ACSQF+  L++G LYTYW PLGFV+ +T+ REAV+++R + RD+EVN   Y KL   G  + + SS I+VGD+IIV+K   + +D+  L    + G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA+TV+A+G  VG+VIYTG E R+VMN+S PR K GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  ++RF LLFS I+P++LRVNLD+ K+V +++I +D +IP  +VR +TIPE+LGRISYL++DKTGTLTQNEM+F++LHLGTV+YG DSMDE+   + S Y     E  A+  P  TKVRKT + RV EAV+AIAL HNV PV E               +G T  +  EQ        YQASSPDEV+LV WTE+VGLTLV RD +SMQLRT +G +LN+ ILQIFPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLE LRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+PV  R+EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  AD G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L++KTF +WVLISIYQG   +     L      H+   T   L+  E L++ ++    +R W         +    Y        ++    F+ T+SF+WKV A+T ISC+PL+ILKY+R +  PP ++KL
Sbjct:   20 SCCPWSRCCGG----GDFRPRTVWLGHPEKREQRYPRNVINNQKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVNELRLGALYTYWVPLGFVLIITIVREAVEEVRCFLRDKEVNSQIYSKLSTRGTVK-VKSSGIQVGDLIIVEKVGFVLSDICLLC---RKGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSFVYAEEPNIDIHNFIGTFTREDGDPPVNESLSIENTLWASTVIASGTVVGVVIYTGKELRSVMNTSNPRHKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIFRFLLLFSNIVPISLRVNLDMGKMVFSWMIKKDSKIPGTVVRASTIPEQLGRISYLLTDKTGTLTQNEMVFRRLHLGTVAYGMDSMDEVQSHVFSAYTQVFPEFPASRAPGATKVRKTISSRVHEAVKAIALVHNVTPVYE--------------ANGVTDQAEAEQHYEDTCRVYQASSPDEVSLVQWTESVGLTLVGRDQSSMQLRTPSGQILNFTILQIFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLEILRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRPVTTRSEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQEADCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSFKTFLIWVLISIYQGKPTI---CFLHSYKVGHLYGYT---LIKWEWLVILMSLFEKLRCW---------LQTATYSQKNKTKYNWQYVYFIATLSFIWKVTAITLISCLPLYILKYLRRRFSPPSYSKL 1027          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Match: ATP9A (ATPase phospholipid transporting 9A (putative) [Source:NCBI gene;Acc:101886226])

HSP 1 Score: 1144.03 bits (2958), Expect = 0.000e+0
Identity = 580/1041 (55.72%), Postives = 750/1041 (72.05%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY-----ESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTV-----TYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
             CC W+ C        ++  R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N+ FL++ACSQF+  L++G LYTYW PLGFV+ +T+ REAV+++R + RD+EVN   Y KL   G  + + SS I+VGD+IIV+K   + +D+  L    + G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA+TV+A+G  VG+VIYTG E R+VMN+S PR K GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  ++RF LLFS I+P++LRVNLD+ K+V +++I +D +IP  +VR +TIPE+LGRISYL++DKTGTLTQNEM+F++LHLGTV+YG DSMDE+   + S Y     E  A+  P  TKVRKT + RV EAV+AIAL HNV PV E               +G T  +  EQ        YQASSPDEV+LV WTE+VGLTLV RD +SMQLRT +G +LN+ ILQIFPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLE LRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+PV  R+EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  AD G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L++KTF +WVLISIYQG   +          F+H+ +       LT    V+LT                              D  F+ T+SF+WKV A+T ISC+PL+ILKY+R +  PP ++KL
Sbjct:   23 GCCPWSRCCGG----GDFRPRTVWLGHPEKREQRYPRNVINNQKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVNELRLGALYTYWVPLGFVLIITIVREAVEEVRCFLRDKEVNSQIYSKLSTRGTVK-VKSSGIQVGDLIIVEKVGFVLSDICLLC---RKGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSFVYAEEPNIDIHNFIGTFTREDGDPPVNESLSIENTLWASTVIASGTVVGVVIYTGKELRSVMNTSNPRHKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIFRFLLLFSNIVPISLRVNLDMGKMVFSWMIKKDSKIPGTVVRASTIPEQLGRISYLLTDKTGTLTQNEMVFRRLHLGTVAYGMDSMDEVQSHVFSAYTQVFPEFPASRAPGATKVRKTISSRVHEAVKAIALVHNVTPVYE--------------ANGVTDQAEAEQHYEDTCRVYQASSPDEVSLVQWTESVGLTLVGRDQSSMQLRTPSGQILNFTILQIFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLEILRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRPVTTRSEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQEADCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSFKTFLIWVLISIYQGKPTIC---------FLHITA------ALTVCSCVSLT------------------------------DVYFIATLSFIWKVTAITLISCLPLYILKYLRRRFSPPSYSKL 996          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP9B (ATPase, class II, type 9B [Source:NCBI gene;Acc:100497381])

HSP 1 Score: 1343.18 bits (3475), Expect = 0.000e+0
Identity = 667/1081 (61.70%), Postives = 838/1081 (77.52%), Query Frame = 2
Query:  248 RRLNRFEIF----YKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY------------------ESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            RR    E F    +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K+P NAIKNQKYN  TFIP VL++QF  FLN+ FLV+ACSQF+ ALKIGYLYTYW PLGFV+ VT+ REA D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADMVFL+T+EK+G+CFIRTDQLDGETDWKL+IAV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+VMN+S P++K G++D E+N LTK LF+  V LS++M+ L+GF G WY+YL+RF LLFSYIIP++LRVNLD+ K    ++IMRDE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + S Y                    G +  P   KVRKT + RV EAV+AIALCHNV PV E     S  G + +    +      ++  TYQASSPDEVALV WTE+VGLTLVNRDL SMQL+T  G +L + ILQIFPFTSE+KRM II+++E +G+I+ +MKGAD+ MA +V + DWLDEE GNMAREGLRTLVV KK ++EEQY DFE+RY+QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +H+F+PV+ R+EAHLELNAFR++ D ALVI G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV+LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFVIHRG++IS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  + AL YPELYK LTKGR L++KTF +WVLISIYQGGI+M+GAL+LFE +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE+ SL  YV SL  L +YF           D  F+ T++F+WKV A+T +SC+PL+ILKY++ K  PP ++KL
Sbjct:  187 RRKKGLEWFLCGGWKFLCT--SCCEWL--INVCRRKKELKARTVWLGCPEKCEEKYPRNAIKNQKYNIFTFIPGVLYQQFKFFLNLYFLVVACSQFVSALKIGYLYTYWAPLGFVLAVTMVREAADEYRRFQRDKEMNSQLYSKLTIRG-KVQVKSSDIQVGDLIIVEKNQRIPADMVFLRTSEKTGSCFIRTDQLDGETDWKLKIAVSCTQRLPALGDLFSINAYVYAQKPQLDIHSFEGNFTREDTDPSIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVMNTSNPKNKVGMLDLELNQLTKALFLALVALSVVMVTLQGFVGPWYRYLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMRDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQNHIASSYSLVQPSQSCNNNTSATPSRKGQSSAP---KVRKTVSSRVHEAVKAIALCHNVTPVYE-----SRAGVNGETEYSEVDQDFCDENRTYQASSPDEVALVQWTESVGLTLVNRDLTSMQLKTPGGQILTFCILQIFPFTSESKRMGIIVREESSGDITFYMKGADVAMATIVQYNDWLDEECGNMAREGLRTLVVAKKSLSEEQYQDFENRYNQAKLSMHDRALKVAAVVESLEREMELLCLTGVEDQLQTDVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHIFRPVSNRSEAHLELNAFRRKHDCALVIAGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVIHRGLVISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPETALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMFGALVLFESEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAELFSLASYVASLAFLNEYFGLGRVSLGAFLDAAFITTLTFLWKVLAITVVSCLPLYILKYLKRKFSPPSYSKL 1254          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP9B (ATPase, class II, type 9B [Source:NCBI gene;Acc:100497381])

HSP 1 Score: 1338.55 bits (3463), Expect = 0.000e+0
Identity = 660/1060 (62.26%), Postives = 828/1060 (78.11%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE------------------SGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            SCC W   I  C+R+KE  AR V +G P + + K+P NAIKNQKYN  TFIP VL++QF  FLN+ FLV+ACSQF+ ALKIGYLYTYW PLGFV+ VT+ REA D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADMVFL+T+EK+G+CFIRTDQLDGETDWKL+IAV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+VMN+S P++K G++D E+N LTK LF+  V LS++M+ L+GF G WY+YL+RF LLFSYIIP++LRVNLD+ K    ++IMRDE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + S Y                    G +  P   KVRKT + RV EAV+AIALCHNV PV E     S  G + +    +      ++  TYQASSPDEVALV WTE+VGLTLVNRDL SMQL+T  G +L + ILQIFPFTSE+KRM II+++E +G+I+ +MKGAD+ MA +V + DWLDEE GNMAREGLRTLVV KK ++EEQY DFE+RY+QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +H+F+PV+ R+EAHLELNAFR++ D ALVI G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV+LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFVIHRG++IS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  + AL YPELYK LTKGR L++KTF +WVLISIYQGGI+M+GAL+LFE +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE+ SL  YV SL  L +YF           D  F+ T++F+WKV A+T +SC+PL+ILKY++ K  PP ++KL
Sbjct:  148 SCCEWL--INVCRRKKELKARTVWLGCPEKCEEKYPRNAIKNQKYNIFTFIPGVLYQQFKFFLNLYFLVVACSQFVSALKIGYLYTYWAPLGFVLAVTMVREAADEYRRFQRDKEMNSQLYSKLTIRG-KVQVKSSDIQVGDLIIVEKNQRIPADMVFLRTSEKTGSCFIRTDQLDGETDWKLKIAVSCTQRLPALGDLFSINAYVYAQKPQLDIHSFEGNFTREDTDPSIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVMNTSNPKNKVGMLDLELNQLTKALFLALVALSVVMVTLQGFVGPWYRYLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMRDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQNHIASSYSLVQPSQSCNNNTSATPSRKGQSSAP---KVRKTVSSRVHEAVKAIALCHNVTPVYE-----SRAGVNGETEYSEVDQDFCDENRTYQASSPDEVALVQWTESVGLTLVNRDLTSMQLKTPGGQILTFCILQIFPFTSESKRMGIIVREESSGDITFYMKGADVAMATIVQYNDWLDEECGNMAREGLRTLVVAKKSLSEEQYQDFENRYNQAKLSMHDRALKVAAVVESLEREMELLCLTGVEDQLQTDVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHIFRPVSNRSEAHLELNAFRRKHDCALVIAGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVIHRGLVISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPETALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMFGALVLFESEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAELFSLASYVASLAFLNEYFGLGRVSLGAFLDAAFITTLTFLWKVLAITVVSCLPLYILKYLKRKFSPPSYSKL 1196          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP9B (ATPase, class II, type 9B [Source:NCBI gene;Acc:100497381])

HSP 1 Score: 1306.97 bits (3381), Expect = 0.000e+0
Identity = 655/1084 (60.42%), Postives = 828/1084 (76.38%), Query Frame = 2
Query:  248 RRLNRFEIF----YKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE------------------SGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVW---VLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            RR    E F    +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K+P NAIKNQKYN  TFIP VL++QF  FLN+ FLV+ACSQF+ ALKIGYLYTYW PLGFV+ VT+ REA D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADMVFL+T+EK+G+CFIRTDQLDGETDWKL+IAV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+VMN+S P++K G++D E+N LTK LF+  V LS++M+ L+GF G WY+YL+RF LLFSYIIP++LRVNLD+ K    ++IMRDE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + S Y                    G +  P   KVRKT + RV EAV+AIALCHNV PV E     S  G + +    +      ++  TYQASSPDEVALV WTE+VGLTLVNRDL SMQL+T  G +L + ILQIFPFTSE+KRM II+++E +G+I+ +MKGAD+ MA +V + DWLDEE GNMAREGLRTLVV KK ++EEQY DFE+RY+QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +H+F+PV+ R+EAHLELNAFR++ D ALVI G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV+LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFVIHRG++IS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  + AL YPELYK LTK  +++   F V      +  + GGI+M+GAL+LFE +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE+ SL  YV SL  L +YF           D  F+ T++F+WKV A+T +SC+PL+ILKY++ K  PP ++KL
Sbjct:   64 RRKKGLEWFLCGGWKFLCT--SCCEWL--INVCRRKKELKARTVWLGCPEKCEEKYPRNAIKNQKYNIFTFIPGVLYQQFKFFLNLYFLVVACSQFVSALKIGYLYTYWAPLGFVLAVTMVREAADEYRRFQRDKEMNSQLYSKLTIRG-KVQVKSSDIQVGDLIIVEKNQRIPADMVFLRTSEKTGSCFIRTDQLDGETDWKLKIAVSCTQRLPALGDLFSINAYVYAQKPQLDIHSFEGNFTREDTDPSIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVMNTSNPKNKVGMLDLELNQLTKALFLALVALSVVMVTLQGFVGPWYRYLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMRDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQNHIASSYSLVQPSQSCNNNTSATPSRKGQSSAP---KVRKTVSSRVHEAVKAIALCHNVTPVYE-----SRAGVNGETEYSEVDQDFCDENRTYQASSPDEVALVQWTESVGLTLVNRDLTSMQLKTPGGQILTFCILQIFPFTSESKRMGIIVREESSGDITFYMKGADVAMATIVQYNDWLDEECGNMAREGLRTLVVAKKSLSEEQYQDFENRYNQAKLSMHDRALKVAAVVESLEREMELLCLTGVEDQLQTDVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHIFRPVSNRSEAHLELNAFRRKHDCALVIAGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVIHRGLVISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPETALLYPELYKDLTKWLNISKNAFTVLNKGFSLCFFLGGILMFGALVLFESEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAELFSLASYVASLAFLNEYFGLGRVSLGAFLDAAFITTLTFLWKVLAITVVSCLPLYILKYLKRKFSPPSYSKL 1134          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP9B (ATPase, class II, type 9B [Source:NCBI gene;Acc:100497381])

HSP 1 Score: 1295.8 bits (3352), Expect = 0.000e+0
Identity = 647/1070 (60.47%), Postives = 813/1070 (75.98%), Query Frame = 2
Query:  248 RRLNRFEIF----YKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE------------------SGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            RR    E F    +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K+P NAIKNQKYN  TFIP VL++QF  FLN+ FLV+ACSQF+ ALKIGYLYTYW PLGFV+ VT+ REA D+ RR++RD+E+N   Y KL   G K  + SS I+VG                         +CFIRTDQLDGETDWKL+IAV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+VMN+S P++K G++D E+N LTK LF+  V LS++M+ L+GF G WY+YL+RF LLFSYIIP++LRVNLD+ K    ++IMRDE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + S Y                    G +  P   KVRKT + RV EAV+AIALCHNV PV E     S  G + +    +      ++  TYQASSPDEVALV WTE+VGLTLVNRDL SMQL+T  G +L + ILQIFPFTSE+KRM II+++E +G+I+ +MKGAD+ MA +V + DWLDEE GNMAREGLRTLVV KK ++EEQY DFE+RY+QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +H+F+PV+ R+EAHLELNAFR++ D ALVI G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV+LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFVIHRG++IS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  + AL YPELYK LTKGR L++KTF +WVLISIYQGGI+M+GAL+LFE +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE+ SL  YV SL  L +YFD  F+ T++F+WKV A+T +SC+PL+ILKY++ K  PP ++KL
Sbjct:   50 RRKKGLEWFLCGGWKFLCT--SCCEWL--INVCRRKKELKARTVWLGCPEKCEEKYPRNAIKNQKYNIFTFIPGVLYQQFKFFLNLYFLVVACSQFVSALKIGYLYTYWAPLGFVLAVTMVREAADEYRRFQRDKEMNSQLYSKLTIRG-KVQVKSSDIQVG-------------------------SCFIRTDQLDGETDWKLKIAVSCTQRLPALGDLFSINAYVYAQKPQLDIHSFEGNFTREDTDPSIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVMNTSNPKNKVGMLDLELNQLTKALFLALVALSVVMVTLQGFVGPWYRYLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMRDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQNHIASSYSLVQPSQSCNNNTSATPSRKGQSSAP---KVRKTVSSRVHEAVKAIALCHNVTPVYE-----SRAGVNGETEYSEVDQDFCDENRTYQASSPDEVALVQWTESVGLTLVNRDLTSMQLKTPGGQILTFCILQIFPFTSESKRMGIIVREESSGDITFYMKGADVAMATIVQYNDWLDEECGNMAREGLRTLVVAKKSLSEEQYQDFENRYNQAKLSMHDRALKVAAVVESLEREMELLCLTGVEDQLQTDVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHIFRPVSNRSEAHLELNAFRRKHDCALVIAGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVIHRGLVISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPETALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMFGALVLFESEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAELFSLASYVASLAFLNEYFDAAFITTLTFLWKVLAITVVSCLPLYILKYLKRKFSPPSYSKL 1081          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Match: ATP9B (ATPase, class II, type 9B [Source:NCBI gene;Acc:100497381])

HSP 1 Score: 1294.26 bits (3348), Expect = 0.000e+0
Identity = 646/1070 (60.37%), Postives = 812/1070 (75.89%), Query Frame = 2
Query:  248 RRLNRFEIF----YKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE------------------SGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            RR    E F    +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K+P NAIKNQKYN  TFIP VL++QF  FLN+ FLV+ACSQF+ ALKIGYLYTYW PLGFV+ VT+ REA D+ RR++RD+E+N   Y KL   G K  + SS I+VG                         +CFIRTDQLDGETDWKL+IAV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+VMN+S P++K G++D E+N LTK LF+  V LS++M+ L+GF G WY+YL+RF LLFSYIIP++LRVNLD+ K    ++IMRDE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + S Y                    G +  P   KVRKT + RV EAV+AIALCHNV PV E     S  G + +    +      ++  TYQASSPDEV LV WTE+VGLTLVNRDL SMQL+T  G +L + ILQIFPFTSE+KRM II+++E +G+I+ +MKGAD+ MA +V + DWLDEE GNMAREGLRTLVV KK ++EEQY DFE+RY+QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +H+F+PV+ R+EAHLELNAFR++ D ALVI G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV+LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFVIHRG++IS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  + AL YPELYK LTKGR L++KTF +WVLISIYQGGI+M+GAL+LFE +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE+ SL  YV SL  L +YFD  F+ T++F+WKV A+T +SC+PL+ILKY++ K  PP ++KL
Sbjct:   44 RRKKGLEWFLCGGWKFLCT--SCCEWL--INVCRRKKELKARTVWLGCPEKCEEKYPRNAIKNQKYNIFTFIPGVLYQQFKFFLNLYFLVVACSQFVSALKIGYLYTYWAPLGFVLAVTMVREAADEYRRFQRDKEMNSQLYSKLTIRG-KVQVKSSDIQVG-------------------------SCFIRTDQLDGETDWKLKIAVSCTQRLPALGDLFSINAYVYAQKPQLDIHSFEGNFTREDTDPSIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVMNTSNPKNKVGMLDLELNQLTKALFLALVALSVVMVTLQGFVGPWYRYLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMRDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQNHIASSYSLVQPSQSCNNNTSATPSRKGQSSAP---KVRKTVSSRVHEAVKAIALCHNVTPVYE-----SRAGVNGETEYSEVDQDFCDENRTYQASSPDEVTLVQWTESVGLTLVNRDLTSMQLKTPGGQILTFCILQIFPFTSESKRMGIIVREESSGDITFYMKGADVAMATIVQYNDWLDEECGNMAREGLRTLVVAKKSLSEEQYQDFENRYNQAKLSMHDRALKVAAVVESLEREMELLCLTGVEDQLQTDVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHIFRPVSNRSEAHLELNAFRRKHDCALVIAGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVIHRGLVISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPETALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMFGALVLFESEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAELFSLASYVASLAFLNEYFDAAFITTLTFLWKVLAITVVSCLPLYILKYLKRKFSPPSYSKL 1075          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp9b (ATPase, class II, type 9B [Source:MGI Symbol;Acc:MGI:1354757])

HSP 1 Score: 1344.72 bits (3479), Expect = 0.000e+0
Identity = 664/1092 (60.81%), Postives = 845/1092 (77.38%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMP--------PV------DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+N+ + +H   R +    K   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  VVLS++M+ L+GF+G WY+ L+RF LLFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + + Y    + P        P+        KV+K+ + R+ EAV+AIALCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTL++RDL SMQL+T +G +L Y ILQ+FPFTSE+KRM II++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV K+ +TEEQY DFESRY QAKLSI DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +HVF+PV  R EAHLELNAFR++ D ALVI+G SL+ CL +YE+E ++LA QCPAVV CRCSPTQKA IV LLR HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFED+FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE +SL  YV SL  L +YFD  F+ T++F+WKV+A+T +SC+PL++LKY++ KL PP ++KL
Sbjct:   61 FENDESDYHTLPRARITRRKRGLEWFVCGG---------WKFLCT--SCCDW--LINVCQRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVVSCSQFVPALKIGYLYTYWAPLGFVLAVTIAREAIDEFRRFQRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSISAYVYAQKPQLDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNQLTKALFLALVVLSVVMVTLQGFAGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHVLNSYLQVHSQPSGHNPSSAPLRRSQSSTPKVKKSVSSRIHEAVKAIALCHNVTPVYE---ARAGITGETEFAEADQDFSD--ENRTYQASSPDEVALVRWTESVGLTLISRDLASMQLKTPSGQVLTYCILQMFPFTSESKRMGIIVRDESTAEITFYMKGADVAMSTIVQYNDWLEEECGNMAREGLRTLVVAKRTLTEEQYQDFESRYSQAKLSIHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHELVELACQCPAVVCCRCSPTQKAHIVTLLRQHTRKRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAILYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFEDEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAEFLSLGCYVASLAFLNEYFDVAFITTVTFLWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKL 1133          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp9b (ATPase, class II, type 9B [Source:MGI Symbol;Acc:MGI:1354757])

HSP 1 Score: 1336.63 bits (3458), Expect = 0.000e+0
Identity = 664/1103 (60.20%), Postives = 845/1103 (76.61%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMP--------PV------DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+N+ + +H   R +    K   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  VVLS++M+ L+GF+G WY+ L+RF LLFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + + Y    + P        P+        KV+K+ + R+ EAV+AIALCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTL++RDL SMQL+T +G +L Y ILQ+FPFTSE+KRM II++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV K+ +TEEQY DFESRY QAKLSI DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +HVF+PV  R EAHLELNAFR++ D ALVI+G SL+ CL +YE+E ++LA QCPAVV CRCSPTQKA IV LLR HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFED+FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE +SL  YV SL  L +YF           D  F+ T++F+WKV+A+T +SC+PL++LKY++ KL PP ++KL
Sbjct:   61 FENDESDYHTLPRARITRRKRGLEWFVCGG---------WKFLCT--SCCDW--LINVCQRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVVSCSQFVPALKIGYLYTYWAPLGFVLAVTIAREAIDEFRRFQRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSISAYVYAQKPQLDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNQLTKALFLALVVLSVVMVTLQGFAGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHVLNSYLQVHSQPSGHNPSSAPLRRSQSSTPKVKKSVSSRIHEAVKAIALCHNVTPVYE---ARAGITGETEFAEADQDFSD--ENRTYQASSPDEVALVRWTESVGLTLISRDLASMQLKTPSGQVLTYCILQMFPFTSESKRMGIIVRDESTAEITFYMKGADVAMSTIVQYNDWLEEECGNMAREGLRTLVVAKRTLTEEQYQDFESRYSQAKLSIHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHELVELACQCPAVVCCRCSPTQKAHIVTLLRQHTRKRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAILYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFEDEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAEFLSLGCYVASLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKL 1144          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp9a (ATPase, class II, type 9A [Source:MGI Symbol;Acc:MGI:1330826])

HSP 1 Score: 1272.3 bits (3291), Expect = 0.000e+0
Identity = 624/1040 (60.00%), Postives = 800/1040 (76.92%), Query Frame = 2
Query:  296 PSCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPP------VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIED--ENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            P CC W  C        E   R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N  FL++ACSQF+P +++G LYTYW PLGFV+ VT+ REAV++IR + RD+E+N   Y +L   G  + + SS I+VGD+I+V+KNQR+PADM+FL+T+EK+G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA TV+A+G  VG+V+YTG E R+VMN+S PRSK GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  + RF LLFS IIP++LRVNLD+ KIV +++I RD +IP  +VR++TIPE+LGRISYL++DKTGTLTQNEM+FK+LHLGTV+YG DSMDE+   + S Y   +  PP      V TKVR+T + RV EAV+AIALCHNV PV E     + +     F+           +    YQASSPDEVALV WTE+VGLTLV RD +SMQLRT    +LN  ILQ+FPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLETLRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  +D G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L+YKTF +WVLISIYQG  IMYGALLLFE +FVH+V+I+FTSL+LTELLMVALTI+TWH LM +AE++SL  Y+ SL+ L ++ D  F+ T+SF+WKV+ +T +SC+PL++LKY+R +  PP ++KL
Sbjct:    6 PRCCEWLRCCGG----GEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPGVLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRGTVK-VKSSNIQVGDLILVEKNQRVPADMIFLRTSEKNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFLGTFTREDSDPPISESLSIENTLWAGTVIASGTVVGVVLYTGRELRSVMNTSDPRSKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMVFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFE-----------DSCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKL 1029          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp9a (ATPase, class II, type 9A [Source:MGI Symbol;Acc:MGI:1330826])

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 623/1038 (60.02%), Postives = 799/1038 (76.97%), Query Frame = 2
Query:  302 CC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPP------VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIED--ENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            CC W  C        E   R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N  FL++ACSQF+P +++G LYTYW PLGFV+ VT+ REAV++IR + RD+E+N   Y +L   G  + + SS I+VGD+I+V+KNQR+PADM+FL+T+EK+G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA TV+A+G  VG+V+YTG E R+VMN+S PRSK GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  + RF LLFS IIP++LRVNLD+ KIV +++I RD +IP  +VR++TIPE+LGRISYL++DKTGTLTQNEM+FK+LHLGTV+YG DSMDE+   + S Y   +  PP      V TKVR+T + RV EAV+AIALCHNV PV E     + +     F+           +    YQASSPDEVALV WTE+VGLTLV RD +SMQLRT    +LN  ILQ+FPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLETLRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  +D G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L+YKTF +WVLISIYQG  IMYGALLLFE +FVH+V+I+FTSL+LTELLMVALTI+TWH LM +AE++SL  Y+ SL+ L ++ D  F+ T+SF+WKV+ +T +SC+PL++LKY+R +  PP ++KL
Sbjct:   24 CCEWLRCCGG----GEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPGVLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRGTVK-VKSSNIQVGDLILVEKNQRVPADMIFLRTSEKNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFLGTFTREDSDPPISESLSIENTLWAGTVIASGTVVGVVLYTGRELRSVMNTSDPRSKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMVFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFE-----------DSCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKL 1045          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Match: Atp9a (ATPase, class II, type 9A [Source:MGI Symbol;Acc:MGI:1330826])

HSP 1 Score: 1269.22 bits (3283), Expect = 0.000e+0
Identity = 623/1038 (60.02%), Postives = 799/1038 (76.97%), Query Frame = 2
Query:  302 CC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPP------VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIED--ENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            CC W  C        E   R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N  FL++ACSQF+P +++G LYTYW PLGFV+ VT+ REAV++IR + RD+E+N   Y +L   G  + + SS I+VGD+I+V+KNQR+PADM+FL+T+EK+G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA TV+A+G  VG+V+YTG E R+VMN+S PRSK GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  + RF LLFS IIP++LRVNLD+ KIV +++I RD +IP  +VR++TIPE+LGRISYL++DKTGTLTQNEM+FK+LHLGTV+YG DSMDE+   + S Y   +  PP      V TKVR+T + RV EAV+AIALCHNV PV E     + +     F+           +    YQASSPDEVALV WTE+VGLTLV RD +SMQLRT    +LN  ILQ+FPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLETLRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  +D G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L+YKTF +WVLISIYQG  IMYGALLLFE +FVH+V+I+FTSL+LTELLMVALTI+TWH LM +AE++SL  Y+ SL+ L ++ D  F+ T+SF+WKV+ +T +SC+PL++LKY+R +  PP ++KL
Sbjct:   24 CCEWLRCCGG----GEPRPRTVWLGHPEKRDQRYPRNVINNQKYNFFTFLPGVLFSQFRYFFNFYFLLLACSQFVPEMRLGALYTYWVPLGFVLAVTIIREAVEEIRCYVRDKEMNSQVYSRLTSRGTVK-VKSSNIQVGDLILVEKNQRVPADMIFLRTSEKNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFLGTFTREDSDPPISESLSIENTLWAGTVIASGTVVGVVLYTGRELRSVMNTSDPRSKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIIRFLLLFSNIIPISLRVNLDMGKIVYSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMVFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTVTTKVRRTMSSRVHEAVKAIALCHNVTPVYESNGVTDQAEAEKQFE-----------DSCRVYQASSPDEVALVQWTESVGLTLVGRDQSSMQLRTPGDQVLNLTILQVFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLETLRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDIHVFRLVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQESDCGVGVEGKEGKQASLAADFSITQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSYKTFLIWVLISIYQGSTIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMTVAELLSLACYIASLVFLHEFIDVYFIATLSFLWKVSVITLVSCLPLYVLKYLRRRFSPPSYSKL 1045          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|A1A4J6|ATP9B_BOVIN (Probable phospholipid-transporting ATPase IIB OS=Bos taurus OX=9913 GN=ATP9B PE=2 SV=1)

HSP 1 Score: 1354.73 bits (3505), Expect = 0.000e+0
Identity = 669/1092 (61.26%), Postives = 849/1092 (77.75%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY---------ESGATMPPVDT-----KVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+N+ + +H   R +    K   E F             +K+LC+  SCC W   I  C+R++E  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FL+++CSQF+PALKIGYLYTYW PLGFV+ VT+ REAVD+ RR++RD+EVN   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  V LS++M+ L+GF+G WY+ L+RF LLFSYIIP++LRVNLD+ K    ++IMRDE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   L + Y          S A+ PP        KVR++ + RV EAV+A+ALCHNV PV E      + G + ++   D   S+  +T  YQASSPDEVALV WTE+VGLTLV+RDL SMQLRT  G +L Y ILQ FPFTSE+KRM +I++DE T EI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV K+ +TEEQY DFESRY+QAKLS+ DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q  HVF+PV  R EAHLELNAFR++ D ALVI+G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV+LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEGRQASLA+DFS+ +F HV +L +VHGR++YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYATV+TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF VWVLISIYQGGI+M+GAL+LFE +FVHVV+I+FT+LVLTELLMVALT+RTWH LM++A+++SL  YV SL  L +YFD  F+ T++FVWKV+A+T +SC+PL++LKY++ KL PP ++KL
Sbjct:   63 FENDESDYHTLPRARITRRKRGLEWFVCGG---------WKFLCT--SCCDW--LINICQRKRELKARTVWLGCPEKCEEKHPRNSIKNQKYNIFTFIPGVLYEQFKFFLNLYFLIVSCSQFVPALKIGYLYTYWAPLGFVLAVTIMREAVDEFRRFQRDKEVNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSINAYVYAQKPQLDIHSFEGTFTREDSDPPVHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNQLTKALFLALVALSVVMVTLQGFAGPWYRSLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMRDEHIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQNHLVNAYTQTQCQAGGSSAASTPPRKAPSSAPKVRRSVSSRVHEAVKAVALCHNVTPVYE---ARGAAGET-EVAEADQDFSDDNRT--YQASSPDEVALVQWTESVGLTLVSRDLTSMQLRTPGGQILTYCILQTFPFTSESKRMGVIVRDESTAEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKRALTEEQYQDFESRYNQAKLSLHDRTLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDTHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKAHIVKLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGRQASLAADFSITRFKHVGRLLMVHGRSSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATVYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLVWVLISIYQGGILMFGALVLFESEFVHVVAISFTALVLTELLMVALTVRTWHWLMVVAQLLSLGCYVASLAFLNEYFDVAFITTVTFVWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKL 1134          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|F1Q4S1|ATP9B_DANRE (Probable phospholipid-transporting ATPase IIB OS=Danio rerio OX=7955 GN=atp9b PE=3 SV=1)

HSP 1 Score: 1340.48 bits (3468), Expect = 0.000e+0
Identity = 657/1055 (62.27%), Postives = 832/1055 (78.86%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMP-----PVDTKVRKTGAIRVLEAVQAIALCHNVIPVRE--IEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LCS  SCC    +  C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKLRI V  TQRL     +F I A +Y +KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG E R+VMN+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   +   Y           S ++ P     P   KVRK+ + R+ EAV+AIALCHNV PV E  +   N+ P ++      D   S+  +T  YQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L Y ILQIFPFTSE+KRM II+++E TG+I+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFE+RY+QAKLSI DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSRNQ +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LF+ +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++A+++SL  Y+ SL  L +YFD  F+ T  F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKVLCS--SCC-ECLVHTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNIVTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLRIGVACTQRLPALGDLFSISAYVYVQKPQLDIHSFEGNFTREDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKEMRSVMNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFLGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVSSAQSNGSSASSTPSRKPQPPAPKVRKSVSSRIHEAVKAIALCHNVTPVYESRVNGANAEPEST----EADQDFSDDNRT--YQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTYYILQIFPFTSESKRMGIIVREEATGDITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLTEEQYQDFENRYNQAKLSIHDRNLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRNQDIHVFKPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFDQEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAQLISLACYLASLAFLNEYFDLSFITTRVFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1123          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|P98195|ATP9B_MOUSE (Probable phospholipid-transporting ATPase IIB OS=Mus musculus OX=10090 GN=Atp9b PE=1 SV=4)

HSP 1 Score: 1335.86 bits (3456), Expect = 0.000e+0
Identity = 665/1103 (60.29%), Postives = 844/1103 (76.52%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMP--------PV------DTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+N+ + +H   R +    K   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P +K GL+D E+N LTK LF+  VVLS++M+ L+GF+G WY+ L+RF LLFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + + Y    + P        P+        KV+K+ + R+ EAV+AIALCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTLV+RDL SMQL+T +G +L Y ILQ+FPFTSE+KRM II++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV K+ +TEEQY DFESRY QAKLSI DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +HVF+PV  R EAHLELNAFR++ D ALVI+G SL+ CL +YE+E ++LA QCPAVV CRCSPTQKA IV LLR HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFED+FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE +SL  YV SL  L +YF           D  F+ T++F+WKV+A+T +SC+PL++LKY++ KL PP ++KL
Sbjct:   61 FENDESDYHTLPRARITRRKRGLEWFVCGG---------WKFLCT--SCCDW--LINVCQRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVVSCSQFVPALKIGYLYTYWAPLGFVLAVTIAREAIDEFRRFQRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSISAYVYAQKPQLDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPNNKVGLLDLELNQLTKALFLALVVLSVVMVTLQGFAGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHVLNSYLQVHSQPSGHNPSSAPLRRSQSSTPKVKKSVSSRIHEAVKAIALCHNVTPVYE---ARAGITGETEFAEADQDFSD--ENRTYQASSPDEVALVRWTESVGLTLVSRDLASMQLKTPSGQVLTYCILQMFPFTSESKRMGIIVRDESTAEITFYMKGADVAMSTIVQYNDWLEEECGNMAREGLRTLVVAKRTLTEEQYQDFESRYSQAKLSIHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHVFRPVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHELVELACQCPAVVCCRCSPTQKAHIVTLLRQHTRKRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAILYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFEDEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAEFLSLGCYVASLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKL 1144          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|O43861|ATP9B_HUMAN (Probable phospholipid-transporting ATPase IIB OS=Homo sapiens OX=9606 GN=ATP9B PE=2 SV=4)

HSP 1 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 660/1103 (59.84%), Postives = 845/1103 (76.61%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYE----------SGAT----MPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+NE + +H   R +    K   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+EVN   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQ+L     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  V LS++M+ L+GF G WY+ L+RF LLFSYIIP++LRVNLD+ K V  +++M+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   ++  Y           +G+T          KVRK+ + R+ EAV+AI LCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTLV+RDL SMQL+T +G +L++ ILQ+FPFTSE+KRM +I++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV KK +TEEQY DFESRY QAKLS+ DR+ KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +H+F+ V  R EAHLELNAFR++ D ALVI+G SL+ CL++YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HTG R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGAL+LFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE +SL  YV SL  L +YF           D  F+ T++F+WKV+A+T +SC+PL++LKY+R KL PP + KL
Sbjct:   62 FENEESDYHTLPRARIMQRKRGLEWFVCDG---------WKFLCT--SCCGW--LINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYE---SRAGVTEETEFAEADQDFSD--ENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAEFLSLGCYVSSLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLRRKLSPPSYCKL 1145          
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Match: sp|D4ABB8|ATP9B_RAT (Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus OX=10116 GN=Atp9b PE=3 SV=1)

HSP 1 Score: 1325.84 bits (3430), Expect = 0.000e+0
Identity = 660/1103 (59.84%), Postives = 843/1103 (76.43%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCC-WASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY---------ESGATMP-----PVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            F+N+ + +H   R +    +   E F             +K+LC+  SCC W   I  C+R+KE  AR V +G P + + K P N+IKNQKYN  TFIP VL+EQF  FLN+ FLV++CSQF+PALKIGYLYTYW PLGFV+ VT+ REA+D+ RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIP+DMVFL+T+EK+G+CFIRTDQLDGETDWKL++AV  TQRL     +F I A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+T++A+G  +G+VIYTG ETR+VMN+S P++K GL+D E+N LTK LF+  VVLS++M+ L+GF+G WY+ L+RF LLFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI   + + Y          + ++ P         KV+K+ + R+ EAV+AIALCHNV PV E     +      +    D   S+  +  TYQASSPDEVALV WTE+VGLTLV+RDL SMQL+T +G +L Y ILQ+FPFTSE+KRM II++DE T EI+ +MKGAD+ M+ +V + DWL+EE GNMAREGLRTLVV K+ +TEEQY DFESRY QAKLSI DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR Q +H+F+PV  R EAHLELNAFR++ D ALVI+G SL+ CL +YE+E ++LA QCPAVV CRCSPTQKA IV LLR HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRG+IIS MQA+FS++FYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++A+ YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFE +FVHVV+I+FT+L+LTELLMVALTIRTWH LM++AE +SL  YV SL  L +YF           D  F+ T++F+WKV+A+T +SC+PL++LKY++ KL PP ++KL
Sbjct:   62 FENDESDYHTLPRARITRRERGLEWFVCGG---------WKFLCT--SCCDW--LINVCQRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVVSCSQFVPALKIGYLYTYWAPLGFVMAVTIAREAIDEFRRFQRDKEMNSQLYSKLTVRG-KVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQRLPALGDLFSISAYVYAQKPQLDIHSFEGTFTRDDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNQLTKALFLALVVLSVVMVTLQGFAGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAAYGWMIMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHVLNSYLQVHSQTSGHNPSSAPLRRSQSSTPKVKKSVSSRIHEAVKAIALCHNVTPVYE---ARTGITGETEFAEADQDFSD--ENRTYQASSPDEVALVRWTESVGLTLVSRDLASMQLKTPSGQVLTYCILQMFPFTSESKRMGIIVRDEATAEITFYMKGADVAMSTIVQYNDWLEEECGNMAREGLRTLVVAKRTLTEEQYQDFESRYSQAKLSIHDRTLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRPVTNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHELVELACQCPAVVCCRCSPTQKAHIVTLLRQHTRKRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAILYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFEAEFVHVVAISFTALILTELLMVALTIRTWHWLMVVAEFLSLGCYVASLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLKRKLSPPSYSKL 1145          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A5K3FPH0 (Phospholipid-transporting ATPase OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1414.05 bits (3659), Expect = 0.000e+0
Identity = 702/1050 (66.86%), Postives = 847/1050 (80.67%), Query Frame = 2
Query:  278 KYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETY----EMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEV------EAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYES----GATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            K LC   +    SC  KC+R+K Y +R+V IGRP R+QK P N I+NQKYN  +FIP VLFEQFS+FLN++FL+MACSQFI  L++GYLYTYW PLGFV+ VT+ REAVDDIRRW RDREVN   Y K+++ G + T+ S+KI+VGDII++ KNQR+PADMV L T+E  G+CFIRTDQLDGETDWKLR AVP TQ +       E +F IQAQIYAE PN+ IH+FEG F+RTD +      E E  LSV+ TLW+NTVLA G A G+VIY G ETRAVMNSS+  +K G ID+EINN+ KLLFV  V+LSL+M+ LKGF G+WY Y WRFFLLFSYIIPLALRVN+D+AKIV A +I RD+++P  +VR+TTIPEELGRI+YL+SDKTGTLTQNEM+FKKLHLG+V++  DSMD++ E L  +YE+    G  M     ++RKTG  R++EAV AIA+CHNV P   + DE    G++    +GD   +   Q V YQASSPDEVALVSWT +VG+TL++RD   M LR  NG  + Y ILQ+FPF+SE KRM I+++D +T +I  ++KGAD VMA +V +T W+++E GN+AREGLRTLVV  +++TE+QY DF SRYHQA +S+SDRAAKV A +AT+E DL LLCLTGVEDKLQE VRPTLETLRNAGI+VWMLTGDKLETAE IAKSSRLV   Q+LHVFQPV GR+EAHLELNAFR+RSD  LVITG SL+ CL +YE EF+ L  QCPAVVVCR SPTQKA I +LL+ +T   +AAIGDGGNDVSMI AA VGIGIVGKEGRQASLASDFS+ QF+HVA+L LVHGRNTYKNTA+LSQF+IHRG IISVMQA+FSAIFYFV++ LFPGFLMVGYAT+FTMFPVFSLVLDKDV D +A+TYPELYK L KGR+L +KTFF+WV+ISIYQGG+IMYGAL+LF+ DF+HVVSITFTS++LTELLMVALTIRTWH LM+IAE+ SLVIYVV+L+V K +FD  FL T++FVWKV A+TA+SCIPL ILK IR KLRPPI++KL+
Sbjct:   66 KGLCGSAAGACGSCFSKCRRKKVYHSRVVCIGRPTRLQKLPPNVIRNQKYNVFSFIPYVLFEQFSVFLNLIFLIMACSQFIDPLRVGYLYTYWAPLGFVIAVTMIREAVDDIRRWMRDREVNNALYTKIIRGG-RVTLASAKIQVGDIILLHKNQRVPADMVLLWTSEPDGSCFIRTDQLDGETDWKLRTAVPVTQNIVHAAGRPEALFDIQAQIYAEAPNQRIHSFEGTFARTDVLADAQNQENEASLSVDQTLWSNTVLATGTAAGIVIYCGPETRAVMNSSKAHTKMGHIDKEINNIAKLLFVFVVLLSLVMVALKGFGGAWYIYYWRFFLLFSYIIPLALRVNMDMAKIVYALMITRDKDLPGCVVRSTTIPEELGRITYLLSDKTGTLTQNEMVFKKLHLGSVAFAQDSMDDLIETLSRYYENTTKEGDFMG-TGKQLRKTGDERLVEAVLAIAICHNVTP---MNDERE--GSAEKPIAGD--FNTFAQPVGYQASSPDEVALVSWTASVGVTLIHRDQQLMVLRLPNGATVAYDILQMFPFSSEAKRMGIVVRDRETQQIHFYVKGADTVMANLVQYTPWMEDEAGNLAREGLRTLVVSHRMLTEDQYADFASRYHQASMSVSDRAAKVQAAVATLECDLQLLCLTGVEDKLQEGVRPTLETLRNAGIKVWMLTGDKLETAECIAKSSRLVPHGQALHVFQPVTGRSEAHLELNAFRRRSDMPLVITGSSLEVCLRYYECEFLDLIRQCPAVVVCRTSPTQKAGIAKLLKTYTKAVVAAIGDGGNDVSMIQAAHVGIGIVGKEGRQASLASDFSITQFSHVARLLLVHGRNTYKNTASLSQFIIHRGFIISVMQAVFSAIFYFVSVALFPGFLMVGYATIFTMFPVFSLVLDKDVDDSIAMTYPELYKDLAKGRELTFKTFFIWVVISIYQGGVIMYGALVLFDTDFIHVVSITFTSVLLTELLMVALTIRTWHFLMVIAELASLVIYVVALVVFKSFFDQAFLLTLNFVWKVFAITAVSCIPLVILKCIRMKLRPPIYSKLR 1106          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A5K3FMB7 (Phospholipid-transporting ATPase OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1413.67 bits (3658), Expect = 0.000e+0
Identity = 702/1050 (66.86%), Postives = 847/1050 (80.67%), Query Frame = 2
Query:  278 KYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETY----EMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEV------EAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYES----GATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            K LC   +    SC  KC+R+K Y +R+V IGRP R+QK P N I+NQKYN  +FIP VLFEQFS+FLN++FL+MACSQFI  L++GYLYTYW PLGFV+ VT+ REAVDDIRRW RDREVN   Y K+++ G + T+ S+KI+VGDII++ KNQR+PADMV L T+E  G+CFIRTDQLDGETDWKLR AVP TQ +       E +F IQAQIYAE PN+ IH+FEG F+RTD +      E E  LSV+ TLW+NTVLA G A G+VIY G ETRAVMNSS+  +K G ID+EINN+ KLLFV  V+LSL+M+ LKGF G+WY Y WRFFLLFSYIIPLALRVN+D+AKIV A +I RD+++P  +VR+TTIPEELGRI+YL+SDKTGTLTQNEM+FKKLHLG+V++  DSMD++ E L  +YE+    G  M     ++RKTG  R++EAV AIA+CHNV P   + DE    G++    +GD   +   Q V YQASSPDEVALVSWT +VG+TL++RD   M LR  NG  + Y ILQ+FPF+SE KRM I+++D +T +I  ++KGAD VMA +V +T W+++E GN+AREGLRTLVV  +++TE+QY DF SRYHQA +S+SDRAAKV A +AT+E DL LLCLTGVEDKLQE VRPTLETLRNAGI+VWMLTGDKLETAE IAKSSRLV   Q+LHVFQPV GR+EAHLELNAFR+RSD  LVITG SL+ CL +YE EF+ L  QCPAVVVCR SPTQKA I +LL+ +T   +AAIGDGGNDVSMI AA VGIGIVGKEGRQASLASDFS+ QF+HVA+L LVHGRNTYKNTA+LSQF+IHRG IISVMQA+FSAIFYFV++ LFPGFLMVGYAT+FTMFPVFSLVLDKDV D +A+TYPELYK L KGR+L +KTFF+WV+ISIYQGG+IMYGAL+LF+ DF+HVVSITFTS++LTELLMVALTIRTWH LM+IAE+ SLVIYVV+L+V K +FD  FL T++FVWKV A+TA+SCIPL ILK IR KLRPPI++KL+
Sbjct:   81 KGLCGSAAGACGSCFSKCRRKKVYHSRVVCIGRPTRLQKLPPNVIRNQKYNVFSFIPYVLFEQFSVFLNLIFLIMACSQFIDPLRVGYLYTYWAPLGFVIAVTMIREAVDDIRRWMRDREVNNALYTKIIRGG-RVTLASAKIQVGDIILLHKNQRVPADMVLLWTSEPDGSCFIRTDQLDGETDWKLRTAVPVTQNIVHAAGRPEALFDIQAQIYAEAPNQRIHSFEGTFARTDVLADAQNQENEASLSVDQTLWSNTVLATGTAAGIVIYCGPETRAVMNSSKAHTKMGHIDKEINNIAKLLFVFVVLLSLVMVALKGFGGAWYIYYWRFFLLFSYIIPLALRVNMDMAKIVYALMITRDKDLPGCVVRSTTIPEELGRITYLLSDKTGTLTQNEMVFKKLHLGSVAFAQDSMDDLIETLSRYYENTTKEGDFMG-TGKQLRKTGDERLVEAVLAIAICHNVTP---MNDERE--GSAEKPIAGD--FNTFAQPVGYQASSPDEVALVSWTASVGVTLIHRDQQLMVLRLPNGATVAYDILQMFPFSSEAKRMGIVVRDRETQQIHFYVKGADTVMANLVQYTPWMEDEAGNLAREGLRTLVVSHRMLTEDQYADFASRYHQASMSVSDRAAKVQAAVATLECDLQLLCLTGVEDKLQEGVRPTLETLRNAGIKVWMLTGDKLETAECIAKSSRLVPHGQALHVFQPVTGRSEAHLELNAFRRRSDMPLVITGSSLEVCLRYYECEFLDLIRQCPAVVVCRTSPTQKAGIAKLLKTYTKAVVAAIGDGGNDVSMIQAAHVGIGIVGKEGRQASLASDFSITQFSHVARLLLVHGRNTYKNTASLSQFIIHRGFIISVMQAVFSAIFYFVSVALFPGFLMVGYATIFTMFPVFSLVLDKDVDDSIAMTYPELYKDLAKGRELTFKTFFIWVVISIYQGGVIMYGALVLFDTDFIHVVSITFTSVLLTELLMVALTIRTWHFLMVIAELASLVIYVVALVVFKSFFDQAFLLTLNFVWKVFAITAVSCIPLVILKCIRMKLRPPIYSKLR 1121          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A158QWA4 (Phospholipid-transporting ATPase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9645 PE=3 SV=1)

HSP 1 Score: 1411.74 bits (3653), Expect = 0.000e+0
Identity = 699/1039 (67.28%), Postives = 843/1039 (81.14%), Query Frame = 2
Query:  311 ASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETY----EMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEV------EAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYES----GATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
             SC  KC+R+K Y +R+V IGRP R+QK P N I+NQKYN  +FIP VLFEQFS+FLN++FL+MACSQFI  L++GYLYTYW PLGFV+ VT+ REAVDDIRRW RDREVN   Y K+++ G + T+ S+KI+VGDII++ KNQR+PADMV L T+E  G+CFIRTDQLDGETDWKLR AVP TQ +       E +F IQAQIYAE PN+ IH+FEG F+RTD +      E E  LSV+ TLW+NTVLA G A G+VIY G ETRAVMNSS+  +K G ID+EINN+ KLLFV  V+LSL+M+ LKGF G+WY Y WRFFLLFSYIIPLALRVN+D+AKIV A +I RD+++P  +VR+TTIPEELGRI+YL+SDKTGTLTQNEM+FKKLHLG+V++  DSMD++ E L  +YE+    G  M     ++RKTG  R++EAV AIA+CHNV P   + DE    G++    +GD   +   Q V YQASSPDEVALVSWT +VG+TL++RD   M LR  NG  + Y ILQ+FPF+SE KRM I+++D +T +I  ++KGAD VMA +V +T W+++E GN+AREGLRTLVV  +++TE+QY DF SRYHQA +S+SDRAAKV A +AT+E DL LLCLTGVEDKLQE VRPTLETLRNAGI+VWMLTGDKLETAE IAKSSRLV   Q+LHVFQPV GR+EAHLELNAFR+RSD  LVITG SL+ CL +YE EF+ L  QCPAVVVCR SPTQKA I +LL+ +T   +AAIGDGGNDVSMI AA VGIGIVGKEGRQASLASDFS+ QF+HVA+L LVHGRNTYKNTA+LSQF+IHRG IISVMQA+FSAIFYFV++ LFPGFLMVGYAT+FTMFPVFSLVLDKDV D +A+TYPELYK L KGR+L +KTFF+WV+ISIYQGG+IMYGAL+LF+ DF+HVVSITFTS++LTELLMVALTIRTWH LM+IAE+ SLVIYVV+L+V K +FD  FL T++FVWKV A+TA+SCIPL ILK IR KLRPPI++KL+
Sbjct:   33 GSCFSKCRRKKVYHSRVVCIGRPTRLQKLPPNVIRNQKYNVFSFIPYVLFEQFSVFLNLIFLIMACSQFIDPLRVGYLYTYWAPLGFVIAVTMIREAVDDIRRWMRDREVNNALYTKIIRGG-RVTLASAKIQVGDIILLHKNQRVPADMVLLWTSEPDGSCFIRTDQLDGETDWKLRTAVPVTQNIVHAAGRPEALFDIQAQIYAEAPNQRIHSFEGTFARTDVLADAQNQENEASLSVDQTLWSNTVLATGTAAGIVIYCGPETRAVMNSSKAHTKMGHIDKEINNIAKLLFVFVVLLSLVMVALKGFGGAWYIYYWRFFLLFSYIIPLALRVNMDMAKIVYALMITRDKDLPGCVVRSTTIPEELGRITYLLSDKTGTLTQNEMVFKKLHLGSVAFAQDSMDDLIETLSRYYENTTKEGDFMG-TGKQLRKTGDERLVEAVLAIAICHNVTP---MNDERE--GSAEKPIAGD--FNTFAQPVGYQASSPDEVALVSWTASVGVTLIHRDQQLMVLRLPNGATVAYDILQMFPFSSEAKRMGIVVRDRETQQIHFYVKGADTVMANLVQYTPWMEDEAGNLAREGLRTLVVSHRMLTEDQYADFASRYHQASMSVSDRAAKVQAAVATLECDLQLLCLTGVEDKLQEGVRPTLETLRNAGIKVWMLTGDKLETAECIAKSSRLVPHGQALHVFQPVTGRSEAHLELNAFRRRSDMPLVITGSSLEVCLRYYECEFLDLIRQCPAVVVCRTSPTQKAGIAKLLKTYTKAVVAAIGDGGNDVSMIQAAHVGIGIVGKEGRQASLASDFSITQFSHVARLLLVHGRNTYKNTASLSQFIIHRGFIISVMQAVFSAIFYFVSVALFPGFLMVGYATIFTMFPVFSLVLDKDVDDSIAMTYPELYKDLAKGRELTFKTFFIWVVISIYQGGVIMYGALVLFDTDFIHVVSITFTSVLLTELLMVALTIRTWHFLMVIAELASLVIYVVALVVFKSFFDQAFLLTLNFVWKVFAITAVSCIPLVILKCIRMKLRPPIYSKLR 1062          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A1S3HSR6 (Phospholipid-transporting ATPase OS=Lingula unguis OX=7574 GN=LOC106157848 PE=3 SV=1)

HSP 1 Score: 1400.19 bits (3623), Expect = 0.000e+0
Identity = 680/1037 (65.57%), Postives = 851/1037 (82.06%), Query Frame = 2
Query:  305 CWASCIKKCKRQKEYFARIVTIGRPPRVQ-----KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEV-EAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDT---KVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKD-YFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQ 3385
            CW + ++KC+R+ EY  R + +G+  +        +P N I+NQKY+  +FIPLVLFEQF  FLN+ FLVMACSQFIP ++IGYLYTYWGPLGFV+FVT+ REAVDD RR++RD+E+N  +Y +L + G + +  SS I VGDIIIV+KNQR+PAD++ L+TTEK+G CFIRTDQLDGETDWKLR+AVP TQ+L + E + +I  Q YAEKP K+IH+F G F R D+  + EDPLS+ENTLWANTV+A+G A+G+V+YTGSETR+VMN+S P+SK GL+D E+N LTK+LF++ +VLS++M+++KGF G WY+Y++RF LLFSYIIP++LRVNLD+ K+  ++ I RD+++P  +VR+TTIPEELGRI+YL+SDKTGTLTQNEM+FK+LHLGTVS+  ++MDE+   LK+ +   A +    +   KVR+T   RV EAV+A+ALCHNV PV E E +  +     D  S         Q   YQASSPDEVALVSWTE+VGL LV RDL SMQL   +G  + Y+ILQIFPFTSETKRM II+++E+TGEI+ +MKGAD+VM  +V + DWL+EE GNMAREGLRTLVV KK ++E+QY DFESRYHQAKLS+ DRA KVAA + ++ERDL+LLCLTGVEDKLQ++VRPTLE LRNAGIR+WMLTGDKLETA  IA SSRLVS+ QS++VF+ V+ R EAHLELN FRK+SDSALVI G SL+ CL++YE+EF++LA QCPAVVVCRCSPTQKA+IV+LLR+HT  R  AIGDGGNDVSMI AAD GIGIVGKEG+QASLA+DFS+ QF+HVA+L LVHGRN+YK +A+LSQFVIHRG+IIS MQAIFS++FYF +I LFPGFLMVGYAT++TM+PVFSLVLDKDV+ ++A+TYPELYK LTKGR L++KTFF+WVLIS+YQGGIIMYGA LLF++DF+HVVSITFTSL+LTELLMVALTIRTWH LM +AEI S  IYV SL+VLK+ YFD DFLK+  FVWKV  +T++SCIPL+ILKY+R K  PP ++KLQ
Sbjct:   64 CWDALVEKCRRKVEYKPRTIWVGKRAKTDIGDGVVYPPNVIRNQKYSIFSFIPLVLFEQFKFFLNLYFLVMACSQFIPEIRIGYLYTYWGPLGFVIFVTMAREAVDDFRRFRRDQEMNSQKYQRLTRTGIE-SAPSSDIRVGDIIIVEKNQRVPADLILLRTTEKTGACFIRTDQLDGETDWKLRLAVPGTQKLPSDEDLHEITGQAYAEKPQKDIHSFVGTFQRMDDGGKCEDPLSIENTLWANTVVASGTALGLVVYTGSETRSVMNTSAPKSKVGLLDLEVNTLTKVLFLSVLVLSIVMMVIKGFQGPWYRYMFRFVLLFSYIIPISLRVNLDMGKVAYSWFIQRDKDVPGTVVRSTTIPEELGRITYLLSDKTGTLTQNEMVFKRLHLGTVSFSPETMDEVMAHLKTAFSQQAPLTSKSSTLPKVRRTVVTRVYEAVKALALCHNVTPVYE-ETDTENQDTEADQQS--------TQKAVYQASSPDEVALVSWTESVGLALVKRDLTSMQLSIPSGRHVRYEILQIFPFTSETKRMGIIVREEETGEITFYMKGADVVMISIVQYNDWLEEECGNMAREGLRTLVVAKKTLSEDQYKDFESRYHQAKLSVQDRATKVAAVVESLERDLELLCLTGVEDKLQDNVRPTLELLRNAGIRIWMLTGDKLETATCIASSSRLVSKVQSIYVFRNVSSREEAHLELNTFRKKSDSALVIKGDSLEICLKYYEHEFVELACQCPAVVVCRCSPTQKAEIVKLLRLHTKKRTCAIGDGGNDVSMIQAADAGIGIVGKEGKQASLAADFSITQFSHVARLLLVHGRNSYKRSASLSQFVIHRGLIISTMQAIFSSVFYFASIALFPGFLMVGYATIYTMYPVFSLVLDKDVSAEIAMTYPELYKDLTKGRSLSFKTFFLWVLISLYQGGIIMYGAFLLFDEDFIHVVSITFTSLILTELLMVALTIRTWHWLMAVAEIFSFGIYVASLVVLKNFYFDEDFLKSWDFVWKVLVITSVSCIPLYILKYLRRKFSPPSYSKLQ 1090          
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Match: A0A210PT26 (Phospholipid-transporting ATPase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13568 PE=3 SV=1)

HSP 1 Score: 1395.56 bits (3611), Expect = 0.000e+0
Identity = 697/1090 (63.94%), Postives = 853/1090 (78.26%), Query Frame = 2
Query:  158 FDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGA-------------TMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            FD + N F  N RY++ N      ++F ++   N        LCS    CW    + C R+KEY AR V +G       KFP N I+NQKY+ ITFIP VLFEQF  FLN+ FLVMA SQFIP +KIGYLYTYWGPLGFV+FVT+ REA+DD RR++RD+E N  +Y KL ++G    I SS I VGD+I V+K+QR+PADM+FL+TTE  G CFIRTDQLDGETDWKLR+AV  TQ L +   I  I+AQ+YAE P K+IHNF G F RTD +VE ED LSVEN LW+NTV+A+G A+G+VIYTGSETR+VMN+SQP+SK GL+D EIN LTK+LF   V LS++M+ LKGF G WY+YL+RF LLFSYIIP++LRVNLD+ K   ++ I RD+ IP+ IVRTTTIPEELGRISYL+SDKTGTLTQNEM+FKKLHLGTV+Y  D+MDE+   LK+ +                 T P     VR+T   R  EAV+AIALCHNV PV   EDE+S      D  S        +Q V YQASSPDEVALV+WTE+VGL L+ RDL+SMQLR  +G ++ Y+ILQIFPFTSETKRM II+K+E TGEI+ +MKGADMVM  +V + DWLDEE GNMAREGLRTLV+ KK++T+EQY +FE+RYHQAK+SI DR AKV A + ++ERD+DLL LTGVEDKLQE VRPTLE L+N GI+VWMLTGDKLETA  IAKSS+LVSR Q +H F  V GR EAHLELNA R++ D+ LVITG +LQ CL++YE+EF++LA QCP VVVCRCSPTQKADIV+LL++HTG R  AIGDGGNDVSMI AA+ GIGIVGKEGRQASLA+DFS+ QF+H+ +L +VHGRN+YK +A+LSQFVIHRG+IIS MQA+FS++FYF +I LFPGFLMVGY+T++TM+PVFSLVLDKDV+ ++A+TYPELYK LTKGR L++KTFF+WVLIS+YQGGII+YGAL LF++DFVHVVSITFTSL+LTELLMVAL +RTWH LM+IAE  SL IY++SL VL++YFD +FL T +FVWKV  +T++SCIPL+ILKY+R K  PP+++KL
Sbjct:   56 FDMDENDFLVNRRYRNPN--QSRIVYFLTDGWSN--------LCSR---CWE---RLCHRRKEYKARKVPVGLEKNSDVKFPKNVIRNQKYSIITFIPKVLFEQFKFFLNLYFLVMASSQFIPEIKIGYLYTYWGPLGFVLFVTMFREALDDYRRYRRDKEANSQKYSKLNRDG-FVVIPSSDIRVGDLIAVEKDQRVPADMIFLRTTEHGGACFIRTDQLDGETDWKLRLAVQNTQSLMSNVDILDIKAQVYAEAPQKDIHNFVGTFKRTDTDVEEEDSLSVENVLWSNTVVASGTALGVVIYTGSETRSVMNTSQPQSKVGLLDLEINTLTKVLFFAVVALSVVMICLKGFEGPWYRYLFRFILLFSYIIPISLRVNLDMGKAAYSWFIQRDKLIPETIVRTTTIPEELGRISYLLSDKTGTLTQNEMVFKKLHLGTVAYTPDTMDEVMTHLKTMFSQQQQQQASQQPFLGPMTTPTRTGPVRRTVVTRTYEAVKAIALCHNVTPV--FEDESSK-----DTSSETEADQQSQQKVVYQASSPDEVALVAWTESVGLALLKRDLSSMQLRAPDGSIIGYQILQIFPFTSETKRMGIIVKEEATGEITFYMKGADMVMQTIVQYNDWLDEECGNMAREGLRTLVIAKKILTDEQYQEFETRYHQAKMSIQDRNAKVQAVIESLERDMDLLSLTGVEDKLQEGVRPTLELLKNGGIKVWMLTGDKLETAICIAKSSKLVSRIQDIHTFGGVTGRTEAHLELNALRRKQDAVLVITGNNLQVCLKYYEHEFVELACQCPCVVVCRCSPTQKADIVKLLQVHTGKRTCAIGDGGNDVSMIQAANAGIGIVGKEGRQASLAADFSVTQFSHIGRLLMVHGRNSYKRSASLSQFVIHRGLIISTMQAVFSSVFYFASIALFPGFLMVGYSTIYTMYPVFSLVLDKDVSAEIAITYPELYKELTKGRSLSFKTFFLWVLISVYQGGIIIYGALWLFDEDFVHVVSITFTSLILTELLMVALAVRTWHYLMVIAEAFSLAIYLLSLAVLRNYFDANFLTTWNFVWKVLVITSVSCIPLYILKYLRKKFSPPVYSKL 1121          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:103037606])

HSP 1 Score: 1338.55 bits (3463), Expect = 0.000e+0
Identity = 654/1054 (62.05%), Postives = 835/1054 (79.22%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAE-------QLKSFYESGATM--------PPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKL+IAV  TQRL     +F + A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEE+GR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI         Q+ S   +G++         PP   KVRK+ + R+ EAV+AIALCHNV PV E    + + G S +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L + ILQIFPFTSE+KRM II++DE TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY+QAKLS+ DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLIS+YQGGI+MYGAL+LF+ +FVHVV+I+FT+LVLTELLMVAL +RTWH LM++AE  SL  Y+ SL  L +YFD  F+ T +F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKVLCG--SCC--ECLARTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRYRRDKEMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLKIAVACTQRLPALGDLFSVSAYVYAQKPQLDIHSFEGNFTREDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFIGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWLIMKDENIPGTVVRTSTIPEEMGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVTSAPANGSSASSTPSRKPPPSAPKVRKSVSSRIHEAVKAIALCHNVTPVYE----SLANGASAEPESTEADRDYSDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTFCILQIFPFTSESKRMGIIVRDEATGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYNQAKLSLHDRGLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLVVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISVYQGGILMYGALVLFDQEFVHVVAISFTALVLTELLMVALMVRTWHWLMVVAEFFSLGCYLASLAFLNEYFDLSFITTRTFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1123          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:103037606])

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 654/1065 (61.41%), Postives = 835/1065 (78.40%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAE-------QLKSFYESGATM--------PPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKL+IAV  TQRL     +F + A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEE+GR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI         Q+ S   +G++         PP   KVRK+ + R+ EAV+AIALCHNV PV E    + + G S +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L + ILQIFPFTSE+KRM II++DE TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY+QAKLS+ DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLIS+YQGGI+MYGAL+LF+ +FVHVV+I+FT+LVLTELLMVAL +RTWH LM++AE  SL  Y+ SL  L +YF           D  F+ T +F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKVLCG--SCC--ECLARTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRYRRDKEMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLKIAVACTQRLPALGDLFSVSAYVYAQKPQLDIHSFEGNFTREDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFIGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWLIMKDENIPGTVVRTSTIPEEMGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVTSAPANGSSASSTPSRKPPPSAPKVRKSVSSRIHEAVKAIALCHNVTPVYE----SLANGASAEPESTEADRDYSDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTFCILQIFPFTSESKRMGIIVRDEATGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYNQAKLSLHDRGLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLVVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISVYQGGILMYGALVLFDQEFVHVVAISFTALVLTELLMVALMVRTWHWLMVVAEFFSLGCYLASLAFLNEYFGIGRVSLGSFLDLSFITTRTFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1134          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:103037606])

HSP 1 Score: 1330.08 bits (3441), Expect = 0.000e+0
Identity = 654/1065 (61.41%), Postives = 835/1065 (78.40%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAE-------QLKSFYESGATM--------PPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADM+FL+T+EK+G+CFIRTDQLDGETDWKL+IAV  TQRL     +F + A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEE+GR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI         Q+ S   +G++         PP   KVRK+ + R+ EAV+AIALCHNV PV E    + + G S +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L + ILQIFPFTSE+KRM II++DE TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY+QAKLS+ DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLIS+YQGGI+MYGAL+LF+ +FVHVV+I+FT+LVLTELLMVAL +RTWH LM++AE  SL  Y+ SL  L +YF           D  F+ T +F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   57 WKVLCG--SCC--ECLARTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRYRRDKEMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKNQRIPADMIFLRTSEKTGSCFIRTDQLDGETDWKLKIAVACTQRLPALGDLFSVSAYVYAQKPQLDIHSFEGNFTREDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFIGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWLIMKDENIPGTVVRTSTIPEEMGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVTSAPANGSSASSTPSRKPPPSAPKVRKSVSSRIHEAVKAIALCHNVTPVYE----SLANGASAEPESTEADRDYSDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTFCILQIFPFTSESKRMGIIVRDEATGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYNQAKLSLHDRGLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLVVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISVYQGGILMYGALVLFDQEFVHVVAISFTALVLTELLMVALMVRTWHWLMVVAEFFSLGCYLASLAFLNEYFGIGRVSLGSFLDLSFITTRTFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1112          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:103037606])

HSP 1 Score: 1297.72 bits (3357), Expect = 0.000e+0
Identity = 642/1059 (60.62%), Postives = 821/1059 (77.53%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDK-----NQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAE-------QLKSFYESGATM--------PPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+P NAIKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR++RD+E+N   Y KL   G K  + SS I+VGD+IIV+K     +  +       Q   K  +CFIRTDQLDGETDWKL+IAV  TQRL     +F + A +YA+KP  +IH+FEG F+R D +    + LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+SQ ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEE+GR+ YL++DKTGTLTQNEM+FK+LHLGTVSYG D+MDEI         Q+ S   +G++         PP   KVRK+ + R+ EAV+AIALCHNV PV E    + + G S +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T  G +L + ILQIFPFTSE+KRM II++DE TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY+QAKLS+ DR  KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+PV+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IVRLL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS+IFYF ++PL+ GFLMVGYAT++TMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLIS+YQGGI+MYGAL+LF+ +FVHVV+I+FT+LVLTELLMVAL +RTWH LM++AE  SL  Y+ SL  L +YFD  F+ T +F+WKV  +T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   40 WKVLCG--SCC--ECLARTCRRKKELKARTVWLGHPEKCEEKYPKNAIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRYRRDKEMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKVFIPFSVSLAPCCSCYQHGAKCRSCFIRTDQLDGETDWKLKIAVACTQRLPALGDLFSVSAYVYAQKPQLDIHSFEGNFTREDCDPPIHESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSQSKNKVGLLDLELNRLTKALFLAQVVLSVVMVALQGFIGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWLIMKDENIPGTVVRTSTIPEEMGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGTDTMDEIQSHIIQSYAQVTSAPANGSSASSTPSRKPPPSAPKVRKSVSSRIHEAVKAIALCHNVTPVYE----SLANGASAEPESTEADRDYSDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPAGQILTFCILQIFPFTSESKRMGIIVRDEATGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYNQAKLSLHDRGLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRPVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVRLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFKHIGRLLVVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSIFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISVYQGGILMYGALVLFDQEFVHVVAISFTALVLTELLMVALMVRTWHWLMVVAEFFSLGCYLASLAFLNEYFDLSFITTRTFLWKVCVITLVSCLPLYIIKYLKRKFSPPSYSKL 1089          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Match: ATP9A (ATPase phospholipid transporting 9A (putative) [Source:NCBI gene;Acc:103032624])

HSP 1 Score: 1275 bits (3298), Expect = 0.000e+0
Identity = 627/1041 (60.23%), Postives = 808/1041 (77.62%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY-----ESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTV-----TYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
             CC W+SC        ++  R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N+ FL++ACSQF+  L++G LYTYW PLGFV+ +T+ REAV++IR + RD+EVN   Y KL   G  + + SS I+VGD+IIV+KNQR+PADM+FL+T+E++G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA+TV+A+G  VG+VIYTG E R+VMN+S PR K GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  ++RF LLFS I+P++LRVNLD+ K+V +++I +D +IP  +VR +TIPE+LGRISYL++DKTGTLTQNEM+F++LHLGTV+YG DSMDE+   + S Y     ++ A+  P  TKVRKT + RV EAV+AIAL HNV PV E               +G T  +  EQ        YQASSPDEV+LV WTE+VGLTLV RD +SMQLRT +G +LN+ ILQIFPFT E+KRM II++DE TGEI+ +MKGAD+VMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLE LRNAGI+VWMLTGDKLETA   AK++ LV+RNQ +HVF+PV  R+EAHLELNAFR++ D ALVI+G SL+ CL+FYEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  AD G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK +A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+T++TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L++KTF +WVLISIYQG IIMYGALLLFE +FVH+V+I+FTSL+LTELLMVALTI+TWH LM++AE++SL  Y+ SL+ L ++ D  F+ T+SFVWKV  +T +SC+PL+ILKY+R +  PP ++KL
Sbjct:   26 GCCPWSSCCG----MGDFRPRTVWLGHPEKREQRYPRNVINNQKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVNELRLGALYTYWVPLGFVLIITIVREAVEEIRCFLRDKEVNSQIYSKLSTRGTVK-VKSSGIQVGDLIIVEKNQRVPADMIFLRTSERNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAADLLQIRSYVYAEEPNIDIHNFIGTFTREDGDPPVNESLSIENTLWASTVIASGTVVGVVIYTGKELRSVMNTSNPRHKIGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIFRFLLLFSNIVPISLRVNLDMGKMVFSWMIKKDAKIPGTVVRASTIPEQLGRISYLLTDKTGTLTQNEMVFRRLHLGTVAYGMDSMDEVQSHVFSAYTQPPHDAPASRAPAATKVRKTISSRVHEAVKAIALVHNVTPVYE--------------ANGVTDQAEAEQHYEDTCRVYQASSPDEVSLVQWTESVGLTLVGRDQSSMQLRTPSGQILNFTILQIFPFTYESKRMGIIVRDESTGEITFYMKGADVVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQADVRPTLEILRNAGIKVWMLTGDKLETATCTAKNAHLVTRNQDVHVFRPVTTRSEAHLELNAFRRKHDCALVISGDSLEVCLKFYEYEFMELACQCPAVVCCRCAPTQKAQIVRLLQERTGKLACAVGDGGNDVSMIQEADCGVGVEGKEGKQASLAADFSVTQFKHLGRLLMVHGRNSYKRSAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTIYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSFKTFLIWVLISIYQGSIIMYGALLLFESEFVHIVAISFTSLILTELLMVALTIQTWHWLMIVAELLSLACYIASLVFLHEFIDVYFIATLSFVWKVTVITLVSCLPLYILKYLRRRFSPPSYSKL 1047          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp8b1 (ATPase phospholipid transporting 8B1 [Source:ZFIN;Acc:ZDB-GENE-091116-14])

HSP 1 Score: 422.935 bits (1086), Expect = 7.214e-128
Identity = 320/1059 (30.22%), Postives = 505/1059 (47.69%), Query Frame = 2
Query:  383 RVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQR-LETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEA--EDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLI----------------LKGFSGS--------------WYKYL--WRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRD-------EEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGAD-----------------SMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEET----GNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRN----------------QSLHVFQPVAGRAEAHLEL-NAFRKRSDSALVITGQSLQTCL----------------------------------EFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL-DKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIM---YGALL-------LFEDDFVHVVSITFTSLVLTELLMVALTIRTWHIL 3184
            + +++  N IK  KYN +TF+P+ L EQF    N+ FL +   Q IP +     YT + PL  V+ +T  ++AVDDI R + D+++N  +  ++M+NG  +      I+VGD++ + KN  +PADM+ L TTE +  C++ T +LDGE++ K + A+  T   L   + + +  A I +E PN  +  + G     D++ +   D L +      NT   +G    +VI+ G +T+ + NS + + K   ID+++N +  ++F   +V++  + I                  G +G               W  +L  W + +L + ++P++L V++++ ++  +F I  D        + P    RTTT+ EELG+I Y+ +DKTGTLTQN M FKK  +  +++G                   S +E A++   F++           VR        E  + +ALCH V+   +                GD I         YQA SPDE ALV+     G   ++R L S+ +    G    Y++L I  F S+ KRMS+I++  + G++ L+ KGAD V+ + +   D   E T       A E LRTL +  K ++EE+YLD+  +Y QA +S++DR  K       IE +L LL  T +EDKLQ+ V   +  L  A I++W+LTGDK ETAE+I  +  L++ +                Q     +  A   E  ++    F K   +A++ITG  L   L                                  E  E  F+ LA  C AV+ CR SP QKA +VR++  H      AIGDG NDV+MI  A +G+GI G+EG QA L+SD+S  QF  + +L LVHGR +Y       Q+  ++    +++   FS    F A  ++  + +  Y  +++  PV  + L D+DV+D  +  +PELY++  K  + NYK F   ++  I    II    YGA L       L  DD+     +T TSL L   L + L    W  L
Sbjct:   41 KQKRYKGNYIKTAKYNIVTFLPMNLLEQFQRVANVYFLFLLILQAIPIISSLAWYTTFVPLVIVLSITAIKDAVDDISRHRSDKQIN-NRKCEIMQNGSFKEDKWMNIQVGDLLRLKKNDFVPADMLLLSTTEPNSLCYLETAELDGESNLKFKQALTVTHNNLTDEKQLAEFDAIIMSEAPNNRLDKYLGTMQWKDKMYSLDNDKLLLRGCRIRNTETCHG----LVIFAGFDTKIMKNSGETKFKRTQIDKQMNKIVFMIFGMLLVMATGLAIGNTIWEVVHGQGFGKYCSGITGDPAVPSPDTVSEWAVWTGFLNFWGYIILLNTVVPISLYVSVEVIRLGQSFFINWDLRMYFKVNDTPSN-ARTTTLNEELGQIEYIFTDKTGTLTQNIMTFKKCSISGMAFGGCEDTWRSGHNVIDNPVDWSWNERADKNFEFHDHSLV-----NLVRLKKDPTACEFFKLLALCHTVMAEEK---------------EGDLI---------YQAQSPDEGALVTAARNFGYVFLDRTLESVTI-VELGTERVYELLNILDFNSDRKRMSVIVRSPE-GKLRLYCKGADTVILERLQKDDPNRESTEKDLNTFAAESLRTLCLSYKDLSEEEYLDWSKKYEQASMSLTDREKKQGLVYEKIETNLKLLGATAIEDKLQDGVPEAIAKLAAAKIKIWVLTGDKQETAENIGYACHLLTEDMQICYGDEVSTMLSDVQECQTIKRDAKGNEEEVDFAKQFLKGKKNAIIITGGCLNGILTDNKQKRLDRLKLPRRRKPREQREEEKQREILKRERIEKRFVSLACACEAVICCRVSPRQKARVVRMVMKHKQAVTLAIGDGANDVNMIKTAHIGVGISGQEGMQAVLSSDYSFAQFRFLERLLLVHGRWSYLRMCKFLQYFFYKNFAFTLVHFWFSFFNGFSAQAVYDDWYITLYNMLYSALPVLVMGLFDQDVSDSKSFKFPELYETGQKNLNFNYKIFGRCLIQGIITSLIIFFIPYGAFLETMRSDGLAPDDYQSFAVVTATSLTLIVNLQIGLDTAFWTYL 1062          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:HGNC Symbol;Acc:HGNC:13531])

HSP 1 Score: 317.005 bits (811), Expect = 1.692e-93
Identity = 248/814 (30.47%), Postives = 406/814 (49.88%), Query Frame = 2
Query:  560 PLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSK-IEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREI------------NNXXXXXXXXXXXXXXIM--LILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVI--VRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADS--MDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNM---AREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL 2929
            PL FV+ V+  ++  +D++R K D   N  + ++L K      + S K + VG II V ++Q  PAD+  L++   +G  ++ T  LDGET+ K + AV       T+      +  +  E PN    +FEG     D V     L   + L   T L N   V G+VIYTG +++ + NSS+ R+KF   +++I            N+    L   T   S ++  + L   S S  ++   + LLF+  +P++L V L++ K       + D EI  V   + T  + E+LG++ Y+ SDKTGTLT N M +KK  +G  SYG D   + +  E+    +E  A M   +    K     +   +  +A+CH V+   E +D                        + Y ASSPDE+ALV+  +  G     RD ++      NG  + Y++L +  F+S+ KRM+II++  +  +I +  KGAD ++   ++ +  L     ++   A  GLRTL++ +K ++E +Y +F+  Y  A  S+  R  K    +  +   L+++  T +EDKLQ+ V   +  ++ AGI+VW+LTGDK+ETA +I  S +L++    L+V   + G ++  L          S  V++G+SL         +F++LA     ++ CR SP QKADIVRL+  +    I  AIGDG NDV+MI AA +G+GI G EG+QA  ASD+++ QF  +  L  VHGR +Y+  + L  +  ++ ++  + Q  F     F     +  ++   +  +FT FP+    L
Sbjct:    8 PLMFVITVSAVKDIFEDMKRHKSDNVENTRKVLRLDKKTKTFVLDSWKNLRVGQIIQVRQDQYFPADLALLRSANNNGIAYVETKNLDGETNLKHKAAVVDASACTTF------RGTLTCEAPN----DFEGTVKTADNVTY--SLDHNSILLRGTSLRNTEWVYGIVIYTGHDSKIMKNSSKSRTKFSKTNKQIILSFSLLVLHSMNSGLSELVKLTTHTSTLLVRMTLTRISDSVTRF-GTWLLLFANFVPISLIVTLEVVKF------LWDAEIYDVAKDLNTKNLNEQLGQVDYVFSDKTGTLTCNLMEYKKHSVGKYSYGVDGAQITDGVEKDDEIFE--AHMNDKNHPNYKN----IQNFLTHLAICHTVVA--EAKD----------------------GKILYNASSPDELALVNCGKYFGYFFKGRDDDNNIEVEVNGKSVIYQLLGVIEFSSDRKRMTIIVRTPEN-KIMVLCKGADSIVQARLSDSKVLGATVQHLESYASGGLRTLLLAEKELSEAEYQNFKEEYRVAASSMIKRDEK----MEEVADRLEIVGTTAIEDKLQDDVDKAIFAMKKAGIKVWVLTGDKIETAINIGFSCQLLNDKMELYV---IDGASKEGLRT--------SGTVVSGESLFKIR--ITKQFLKLACSSSVLIACRMSPKQKADIVRLIIANNPSLITLAIGDGANDVNMINAAHIGVGISGVEGQQAVSASDYAIGQFKFLKNLLFVHGRESYRKNSYLVCYTFYKNVLFVMPQFWFGFYSAFSGQVFYEKWIYQIFNIIFTAFPIIIFAL 754          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp8b4 (ATPase phospholipid transporting 8B4 [Source:ZFIN;Acc:ZDB-GENE-121116-7])

HSP 1 Score: 313.923 bits (803), Expect = 1.638e-89
Identity = 294/1116 (26.34%), Postives = 496/1116 (44.44%), Query Frame = 2
Query:  401 SNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVP-TTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGR-AVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKG-------------------------FSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGAD-------------------SMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVM--------AQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVS-RNQSLHV------------FQPVAGRAEAHLE-------LNAFRKRSD-----------SALVITGQSLQTCL-EFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDG--GNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFED----------DFVHVVSITFTSLVLTELLMVALTIRTW----HILMLIA-EXXXXXXXXXXXXXXKDYFDTDF---------LKTISFVWKVAALTAISCI-PLFILKYIRYKLRPPIHTKLQD 3388
            +N IK  KYN +TF+P+ LFEQF    N  FL +   Q IP +     +T   PL  V+ +T  ++A ++  R + D +VN  Q  ++  NG  +      + VGDII ++ NQ + AD++ L ++E    C+I T +LDGET+ K+R A+P T+Q  +  + +     ++  E PN  +  F G         + D    +  L    VL N     G+V++ G +T+ + NS + + K   IDR +N L        +V    +L L                           FSG  +   W + ++ + ++P++L V++++ ++  ++ I  D ++          VRTTT+ EELG+I Y+ SDKTGTLTQN M F K  +    YG                     S + +A++   FY+   TM     +  + G   V E  + +ALCH V+P  + E E                       + YQA SPDE ALV+          +R   ++ L    G    Y++L I  F +  KRMS+I+++ + G + L+ KGAD V+         Q+V  T    +     A EGLRTL +  + + E  + +++ R+H+A  S+  R   +AA    IE+++ LL  T +EDKLQE V  T+  L  A I++W+LTGDK     +    S L+S   +++H+              P+  R+   L        L    K +            +  V  G +L   L    + +F+       + V  R +   +++  R +      +   + DG   ++  +I  A +G+GI G+EG QA L+SD+S  QF  + +L LVHGR +Y        +  ++    +++   F     F A  ++  + +  +  V+T  PV ++ V D+D+ D+ ++  P+LY+        N + FF+ +   IY   ++ +     F +          D   +     TSL++   L + L    W    H  +  +  +   +++ +    L   F + F         L   S VW V ALT I CI P+   ++++  LRP +  K Q+
Sbjct:    1 TNRIKTSKYNVVTFLPVNLFEQFQRVANAYFLFLLILQLIPQISSLSWFTTIVPLVLVLTITAVKDASEEYFRHRSDNQVNNRQ-SQVHINGKLQNEKWMNVRVGDIIKMENNQFVAADLLLLSSSEPHSLCYIETAELDGETNLKVRQALPVTSQIADDIDKLAHFDGEVICEPPNNKLDRFTGTLYWRGNTYSLDN---DKMLLRGCVLRNTEWCYGLVVFAGPDTKLMQNSGRTKLKRTSIDRLMNTLVLWWIFGFLVCMGSILGLGNTIWESAIGYYFQPYLPWESAVDSAIFSG--FLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWDRKMYYGKRDTPAEVRTTTLNEELGQIEYIFSDKTGTLTQNIMTFNKCSINGRVYGGAYDVTGHKVEINERSVPVDFSRNLLADRRFLFYDQ--TM----LEAIRLGEWGVHEFFRLLALCHTVMPEEKTEGE-----------------------LAYQAQSPDEGALVTAARNFDFVFRSRTPETITLHEL-GEPRTYQLLAILDFNNFRKRMSVIVRNAE-GRLKLYCKGADSVIFERLHPCNQQLVNITA---DHLSAFAGEGLRTLCLAYRDLDEASFEEWQERHHEANTSLQGREELLAAVYDEIEQNMMLLGATAIEDKLQEGVPETIAKLALANIKIWVLTGDKQAATRAAFYRSSLISIVRKNVHLILMSSLLTVLCFIHPINERSVEPLHGVFISSTLGRLHKMAVVVMVVVIVADCAGRVCNGVNLAVRLGAVLKDDFLAAVASNHSSVALRLTANSESENTRFV----AKQWIGLNDGRPSHNCIVIETAHIGVGISGQEGMQAVLSSDYSFAQFRFLQRLLLVHGRWSYLRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQTVYDQWFITLFNIVYTSLPVLAMGVFDQDINDQWSIDCPKLYEPGQLNLLFNKREFFICIGQGIYTSVVLFFVPYAAFVEAVRDDGTGLSDHQSLAVAVSTSLIIVVSLQMGLDTAYWTAINHFFIWGSVAVYFAIMFAMYSAGLYSIFPSQFRFIGTARNTLNQPS-VWLVIALTTIVCIMPIAAFRFLKTDLRPTLSDKTQE 1071          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: ATP8A1 (ATPase phospholipid transporting 8A1 [Source:HGNC Symbol;Acc:HGNC:13531])

HSP 1 Score: 254.603 bits (649), Expect = 8.672e-74
Identity = 176/556 (31.65%), Postives = 286/556 (51.44%), Query Frame = 2
Query:  422 KYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKG------FSGSWY-------------KYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEET 2011
            KYN +TF+P  L+EQFS   N+ FL +A  Q IP +     YT   PL F++ V   +E ++D +R + DREVN  +  ++++NGD  T+   K+ VGD++ +   Q +PAD+V L ++E    C+I T  LDGET+ K+R  +P T  L+T + +  I  +I  E PN+++++F G      +     PL  +  L     L N + V G+V+YTG +T+ + NS++   K   +DR  N    LL VT ++++L   I         + G WY              +L  F +L++ +IP++L V L++ K + AF I  D E+         + RT+ + EELG++ Y+ SDKTGTLT N M FKK  +  ++YG +      E  +  ++  A +  + +     G I   E +  +++CH  +P  E ED                       ++ YQASSPDE ALV    ++G T   R  N M +  + G   N+++L +  FTS  +RMS+I++   +G++ L+ KGAD  + + +       E+T
Sbjct:    4 KYNALTFLPRFLYEQFSRAANLFFLFIALLQQIPEVSPTGRYTTLMPLIFILVVAALKEIIEDYKRHRADREVNKKKTTQVLQNGDWHTVSWEKVGVGDVLRITNGQNLPADLVMLSSSEPQAMCYIETANLDGETNLKIRQGLPLTAGLQTSDSLLSIDGRIECEAPNRHLYDFTGNIQL--QGHGTVPLGPDQILLRGAQLRNTQWVFGVVVYTGHDTKLMQNSTRAPLKRSNVDRVTNLQILLLVVTLLLMALASAIGSSIWTSAHWKGDWYLGFRDNAPSNFGFNFL-TFIILYNNLIPISLLVTLEVVKFIQAFFINWDSEMYHEESNTNAMARTSNLNEELGQVKYIFSDKTGTLTCNVMEFKKATVAGIAYGHNE-----EPSEVGFQDPALLQNLHSNHPSAGVI--YEFLVMMSVCHTAVP--EAED----------------------GSIVYQASSPDEGALVRAARSLGFTFTVRTPN-MVVIDALGQEQNFELLHVLEFTSVRRRMSVIVRTP-SGKLRLYCKGADNAIYERLANNSLYKEDT 523          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Match: si:dkey-211e20.10 (ATPase phospholipid transporting 11B (putative) [Source:HGNC Symbol;Acc:HGNC:13553])

HSP 1 Score: 236.884 bits (603), Expect = 1.685e-65
Identity = 201/664 (30.27%), Postives = 316/664 (47.59%), Query Frame = 2
Query:  377 PPRV-----QKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFI---PALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAED---PLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIML--ILKGF-------SGSWY-----------KYL------WRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKV-----RKTGAIRVLEAV-QAIALCHNV-IPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADM-VMAQMVTF-TDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDK 2209
            PP V     Q FP N I + KY    FIP  LFEQF    N  F+++   Q I   P   +    T   PL FV+ VT  ++  +D  R K D E N    V  +++G      S  I VGDI+ V  ++  P D+V L +    GTC + T  LDGET+ K   A+  T RL++   + ++ A I  E+P  +++ + G      E   +D   PL  EN L     L N   + G+ +YTG ET+  +N      K   ++  +  L  L    T++L   +L  +LK +          WY           K+L        F +L++YIIP++L V +++ K + +  I  D  +       + +V T+ + EELG++ Y+ +DKTGTLT+N+M F++  +G V Y                E G  +P           R  G     EA   A+ALCH V I   E    + + G S    +G    +     V Y ASSPDE ALV   + +G+T +    + M+++T  G +  +K+LQ+  F S  + MS+I++ E +G++ +  KGA+  ++ ++V+   +    +    A EGLRTL +  K ++  +YL+ E R H A++++ +R  +  A    IE  L LL  TGVED+
Sbjct:   12 PPHVDHYVPQWFPDNRIISSKYTVWNFIPKNLFEQFRRIANFYFIIIFLVQLIIDTPTSPV----TSGLPLFFVIIVTAIKQGYEDWLRHKADNETN-NYTVYAVRSGGLVKTRSKNIRVGDIVRVTSDETFPCDLVLLSSCNGDGTCHVTTASLDGETNLKTHTALLDTARLQSLLQLSELHATIECEQPQPDLYRYVGRMVIHLEDTEQDVVRPLGQENLLLRGARLKNTDEIFGVAVYTGMETKMALNYKGKSQKRSAVENHLGQLIILTVYLTLLLVKALLSTVLKYWWQATPQNDEPWYNGKSDKLKHVNKFLAGFADFLAFMVLYNYIIPISLYVTVEMQKFLGSLFISWDMALYDEGSNERALVNTSDLNEELGQVEYVFTDKTGTLTENDMQFRQCSIGGVKY--------------VEEDGVLLPLGGGATSLYAHRGVGGGDASEAFFLALALCHTVHISKEEGGSVDETGGASAGRATGRGGSAAGRPAVLYYASSPDEKALVEAAQRLGVTFLGLHGDIMEVQTM-GDVNRFKLLQVLEFDSNRRCMSVIVEKE-SGDVLVITKGAESSILPKVVSGEVERTRAQVDEFAMEGLRTLCLAYKALSGAEYLETEQRLHAARVALQNRDDETRAAFDAIESGLHLLGATGVEDR 654          

HSP 2 Score: 63.1586 bits (152), Expect = 3.246e-10
Identity = 45/101 (44.55%), Postives = 58/101 (57.43%), Query Frame = 2
Query: 2498 QCPAVVVCRCSPTQK----ADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGI-GIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQF 2782
            +C  V V    P Q       +VRL++  +   I  AIGDG NDVSMI  A VGI GI+GKEGRQA   SD+++ +F  + +L LVHG   Y   A L Q+
Sbjct:  697 KCMMVSVWSHIPAQGIFVVVQVVRLMKTSSSSPITLAIGDGANDVSMIQEAHVGIEGIMGKEGRQAVRNSDYAIARFRFLLRLLLVHGHFYYVRVAELVQY 797          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: NEO1 (Phospholipid translocase (flippase), role in phospholipid asymmetry of plasma membrane; involved in endocytosis, vacuolar biogenesis and Golgi to ER vesicle-mediated transport; localizes to endosomes and the Golgi apparatus [Source:SGD;Acc:S000001310])

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 489/1012 (48.32%), Postives = 690/1012 (68.18%), Query Frame = 2
Query:  389 QKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLAN-GRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGF-SGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKV-----RKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQL-RTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLAT-IERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALL---LFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQD 3388
             ++ SN + N KYN +TF+P +L+EQF  F N+ FLV+A SQ +PAL+IGYL +Y  PL FV+ VT+ +EA+DDI+R +RDRE N   Y  + +N   R+I S  ++VGD+I V K  RIPAD+V LQ++E SG  FI+TDQLDGETDWKLR+A P TQ L   ++I +I   I A  P K+IH F G  +  D     +PLSV+NTLWANTVLA+ G  +  V+YTG +TR  MN++  + K GL++ EIN+++K+L      LS++++   GF +  WY  + R+ +LFS IIP++LRVNLDLAK V A  I  D+ IP+ IVRT+TIPE+LGRI YL+SDKTGTLTQN+M  KK+HLGTVSY ++++D +++ ++S   S       ++KV     RK  + RV + +  +A+CHNV P  E +DE                       +TYQA+SPDE+A+V +TE+VGL+L  RD +S+ L    +G  LNY+ILQ+FPF S++KRM II++DEQ  E     KGAD VM+++V   DWL+EETGNMAREGLRTLV+G+K + ++ Y  F+  Y+ A LS+ +R  +++  +   +E DL+LL LTGVEDKLQ+ V+ ++E LRNAGI++WMLTGDK+ETA  ++ S++L+SR Q +H    V     A  +L   +   ++ L+I G+SL   L+ YE EF  + +  P V+ CRC+P QKAD+  ++R  TG R+  IGDGGNDVSMI  ADVG+GIVGKEG+QASLA+DFS+ QF H+ +L L HGRN+YK +A L+QFV+HRG+II++ QA++S    F  I L+ G+LMVGYAT +TM PVFSL LD D+ + +   YPELYK LT+G+ L+YKTFFVWVL+S++QG +I   +     L + DF  +V+I+FT+LV+ EL+MVAL I TW+  ML+ EI +L+ Y+VS+  L DYFD  ++ T+++   +  +  IS  P++  K I  +L PP + K+Q+
Sbjct:  168 NRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRN---RSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRIS--ITASAPEKSIHKFLGKVTYKDS--TSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSLV-SSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFE-DDE-----------------------LTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAKAIYRRLHPPSYAKVQE 1147          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DRS2 (Trans-golgi network aminophospholipid translocase (flippase); maintains membrane lipid asymmetry in post-Golgi secretory vesicles; contributes to clathrin-coated vesicle formation, endocytosis, protein trafficking between the Golgi and endosomal system and the cellular response to mating pheromone; autoinhibited by its C-terminal tail; localizes to the trans-Golgi network; mutations in human homolog ATP8B1 result in liver disease [Source:SGD;Acc:S000000024])

HSP 1 Score: 423.705 bits (1088), Expect = 2.333e-127
Identity = 320/1013 (31.59%), Postives = 509/1013 (50.25%), Query Frame = 2
Query:  395 FPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGD----KRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXI-----------------MLILKGF--SGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIR-------------VLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQ-LRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETG-----------NMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVF-QPVAGRAEAHL--ELNAFRKRSDS-------ALVITGQSLQTCLE-FYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFE------------DDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIA 3196
            +  N I   KYNF TF+P  LF++FS + N+ FL  +  Q +P +     YT  G L  V+ V+  +E ++DI+R   D+E+N +      +  D    KR I    I VGDII V   + IPAD + L ++E  G C+I T  LDGET+ K++ +   T +    + +  +  ++ +E+PN +++ +EG  +  D    + PLS +  +     L N   + G+VI+TG ET+ + N++    K   +++ IN     LF   +VL LI                  L L+G   +G ++K    F++LFS ++P++L V ++L K   AF+I  D ++         +VRT+++ EELG+I Y+ SDKTGTLT+N M FK   +    Y    +D+I E   +  E G     ++   RK   ++             + + +  +A CH VIP      E  S G                 ++ YQA+SPDE ALV     +G   + R  NS+  L    G    Y++L I  F S  KRMS I +    G I LF KGAD V+ +       LD+E             + A EGLRTL +  + ++E +Y ++ S Y++A  ++ +RA K+      IE++L L+  T +EDKLQ+ V  T+ TL+ AGI++W+LTGD+ ETA +I  S RL+S + +L +  +      E +L  ++NA  +   S       ALVI G+SL   LE   E   + +A  C AV+ CR SP QKA +V++++  +   + AIGDG NDVSMI AA VG+GI G EG QA+ ++D ++ QF  + KL LVHG  +Y+  +    +  ++   + + Q  +     F    +   + M  Y   FT++P F + V D+ V+ ++   YP+LYK   KG+  +   F+ W++   +   I+  G +L++             D +   V++  TS+++  L   AL    W    LIA
Sbjct:  198 YSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWI---DIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDR---QIPLSPDQMILRGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIALFTVLIVLILISSIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY----IDKIPEDKTATVEDG-----IEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIP------EFQSDG-----------------SIKYQAASPDEGALVQGGADLGYKFIIRKPNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPD-GSIKLFCKGADTVILER------LDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNEHQLSTHDMNTLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFKFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGVTVYTTSVIIV-LGKAALVTNQWTKFTLIA 1164          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DNF1 (Aminophospholipid translocase (flippase); type 4 P-type ATPase; involved in phospholipid translocation, contributing to endocytosis, protein transport, and cellular polarization; localizes primarily to the plasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; DNF1 has a paralog, DNF2, that arose from the whole genome duplication [Source:SGD;Acc:S000000968])

HSP 1 Score: 349.362 bits (895), Expect = 3.394e-100
Identity = 273/946 (28.86%), Postives = 452/946 (47.78%), Query Frame = 2
Query:  704 IEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAE---DPLSVENTLWANTVLANGR-AVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLIL-------KGFSGSWYKY--------------LWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIV------RTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYG-----------------------------ADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQ-------------AIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIK-------DEQTGEISLFMKGADMVM-----AQMVTFTDWLDEETG----NMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVA------GRAEAHL------------------ELNAFRKRSDS-------ALVITGQSLQTCL--EFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRT 3172
            ++VGDI+ +  N  IPAD++ L T++  G C++ T  LDGET+ K+R ++  T  + T + I + +  I +E P+ N++ ++G     +  + E   +P+++ N L     L N + A+G+V++TG +T+ ++NS    +K   I RE+N    + FV   +L  +  I        KG S   Y++               W   +L+  ++P++L +++++ K   A  I  D  +    +      ++  I ++LG++ Y+ SDKTGTLTQN M FKK  +  VSYG                             A   D + ++L++   +    P   T V K   +R L+                A+ALCH+V+    +E    +P                 + +  +A SPDE ALV+    VG + V +    + +    G+   ++IL I  F S  KRMS I+K       DE      L  KGAD ++      Q  + ++ + E+T       A EGLRTL + ++ ++  +Y  +  +Y  A  S+++R  ++     +IER+L LL  T +ED+LQ+ V   +E L  AGI++W+LTGDK+ETA +I  S  L++    L V +         G   + +                  E   F  + D        A+VI G +L+  L  E    +F+ L   C AV+ CR SP+QKA +V+L++        AIGDG NDV+MI +ADVGIGI G+EGRQA + SD+++ QF ++A+L LVHGR +YK  A +     ++ MI ++    +     F    L+    M+ Y   FT  PV  L +LD+DV D ++L  P+LY+     ++ N + F  ++L  +YQ  I  +   L++  + +    +T   L L     V + + T
Sbjct:  401 VKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKE-FVRDLKGASGEVQQRCCEHFMLALALCHSVL----VEANPDNP-----------------KKLDLKAQSPDEAALVATARDVGFSFVGKTKKGLIIEMQ-GIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRA--LLICKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFFFPYLVYHKNMI----VTSNGLGLDHRYFVGVYVTT 1317          

HSP 2 Score: 48.9062 bits (115), Expect = 6.268e-6
Identity = 34/98 (34.69%), Postives = 53/98 (54.08%), Query Frame = 2
Query:  371 GRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWG----PLGFVVFVTLCREAVDDIRRWKRDREVNMTQ 652
            G P  + ++P N I+  KY  +TF+P  +  QF  F N+ FLV+     + A +I +  T  G    PL  +V +T  ++A++D RR   D EVN T+
Sbjct:  185 GNP--IMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLI---ILGAFQI-FGVTNPGLSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTK 276          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DNF2 (Aminophospholipid translocase (flippase); type 4 P-type ATPase; involved in phospholipid translocation, contributing to endocytosis, protein transport, and cellular polarization; localizes primarily to the plasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; DNF2 has a paralog, DNF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002500])

HSP 1 Score: 337.806 bits (865), Expect = 2.625e-96
Identity = 266/925 (28.76%), Postives = 440/925 (47.57%), Query Frame = 2
Query:  704 IEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAE---DPLSVENTLWANTVLANGR-AVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGF-SGSWYKY------------------------LWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIV------RTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYG-----------------------------ADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQ----------------AIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIK-----DEQTGEISLFMKGADMVMAQMVTFTD---WLDEETG----NMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQ------------PVA--------------GRAEAHLELNAFRK-----RSDSALVITGQSLQTCLEFYEY--EFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFV 3100
            ++VGDI+ V  N  IPADM+ L T++  G C++ T  LDGET+ K+R ++  ++ +++   I + +  + +E P+ N+++++G F   D        +P+++ N L     L N + A+GMVI+TG +T+ ++N+    +K   I RE+N       +   VL  I+    G  +G +YK                          W   +L+  ++P++L +++++ K   A  I  D  +    +      ++  I ++LG+I Y+ SDKTGTLTQN M FKK  +  VSYG                             A   + + ++L+S  ++    P   T V K     ++E ++                A+ALCH+V+    +E     P    DI                +A SPDE ALVS    +G + V    + + +    G+   +++L +  F S  KRMS IIK      +   +  L  KGAD V+   +  T     L E+T       A EGLRTL + ++ +T  +Y  +   Y  A  S+++R  ++      IER+L LL  T +ED+LQ+ V  ++  L  AGI++W+LTGDK+ETA +I  S  +++ +  L V +            P+               G + +  EL   ++     + + A++I G +L+  L   E   +F+ L   C AV+ CR SP QKA +V+L++        AIGDG NDV+MI +ADVG+GI G+EGRQA + SD+++ QF +V +L LVHG+  YK  A +     ++ +I ++    +     F    LF    +  Y   FT  PV  L VLD+DV+D V++  P+LY+     ++ N   F  ++L  +YQ  I  +   L +  + V
Sbjct:  446 VKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELN----FSVILNFVLLFILCFTAGIVNGVYYKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSK----EIVEDLKGSSGDHQQKCCEHFLLALALCHSVL----VEPNKDDP-KKLDI----------------KAQSPDESALVSTARQLGYSFVGSSKSGLIVEIQ-GVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLWYMLDGVYQSVICFFFPYLAYHKNMV 1340          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Match: DNF3 (Trans-golgi network aminophospholipid translocase (flippase); type 4 P-type ATPase; involved in phospholipid translocation, contributing to the maintenance of membrane lipid asymmetry in post-Golgi secretory vesicles; role in protein trafficking between the Golgi and endosomal system; localizes to the trans-Golgi network; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone [Source:SGD;Acc:S000004772])

HSP 1 Score: 210.305 bits (534), Expect = 1.857e-55
Identity = 134/385 (34.81%), Postives = 202/385 (52.47%), Query Frame = 2
Query: 2027 EGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSA------LVITGQSLQ--TCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLR-IHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQG------GIIMYGALLLFEDDFVHVVSITFTSLV 3133
            EGLRTLV   K +   QY ++  RYHQAK S++DR  KV    A IE  L+LL +T +EDKLQ+ V   +E +R AGI++WMLTGDK ETA +I  S  L+    ++ +         +  ++NA  +  DS       +VI G ++        Y   F++L  +  +V+ CR SP+QKA +V  +R         AIGDG ND++MI +AD+G+GI GKEG QAS  SD+S+ QF  + KL  VHGR  Y  T+       ++ +     Q I+     F    L+  + +  + T+FT  PV  + + +KD+     LT PELY      +  N+  F  WV+++           ++M+G   L ++    +  I FT++V
Sbjct: 1031 EGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILTTTDENIIS--KMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLSDNTMYPLGLINFTAIV 1413          

HSP 2 Score: 131.339 bits (329), Expect = 3.836e-31
Identity = 91/289 (31.49%), Postives = 158/289 (54.67%), Query Frame = 2
Query:  701 KIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRL-ETYEMIFKIQAQIYAEKPNKNIHNFEGCFS----RTDEVEAEDPLSVENTLWANTVLANGR-AVGMVIYTGSETRAVMNS-SQPRSKFGLIDREINNXXXXXXXXXXXXXXI-----MLILKGF---SGSWYKY---------LWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIV------RTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSY 1477
            K+ VGD +++ ++  +PAD++ L    ++  CF+ T  LDGET+ K +   P   +L +    +  I AQ+  E PN +++NFEG       R D +  + PL  +N ++  ++L N +  VGMVI++G ET+  MN+   PR+K   + R+IN +   +      +SL      +L  K +   + +WY +         +  F ++++ +IPL+L V +++ K+V + ++  D ++           RT TI EELG++SY+ SDKTGTLT N+M+F+K  L   S+
Sbjct:  301 KLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTI-MKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588          

HSP 3 Score: 65.4698 bits (158), Expect = 4.930e-11
Identity = 41/131 (31.30%), Postives = 68/131 (51.91%), Query Frame = 2
Query: 1604 AIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRT------SNGLLLNYKILQIFPFTSETKRMSIIIK-DEQTGEISLFMKGADMVMAQ 1975
            ++ALCH+ +P +     N S G               E ++ YQ+SSPDE+ALV+    +G  ++NR+   + ++T          L NY+IL    F S+ KRMS++++   Q  ++ L  KGAD V+ +
Sbjct:  734 SLALCHSCLPKKT---HNESIG---------------EDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIME 846          

HSP 4 Score: 63.5438 bits (153), Expect = 2.143e-10
Identity = 33/97 (34.02%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  389 QKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGD 679
            + +  N I + +Y F +F+P  L+ QFS   N  F ++A  Q IP       YT   PL   + +++ REA DD RR + D+E N      L+K+G+
Sbjct:  136 KPYCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGN 232          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO36012 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJW8])

HSP 1 Score: 426.402 bits (1095), Expect = 3.048e-130
Identity = 306/1016 (30.12%), Postives = 501/1016 (49.31%), Query Frame = 2
Query:  356 RIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIY------AEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGF--------SGSWY---------KY---LWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSY-----------GADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLN-------YKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEET----GNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSL-----HVFQPVAGRAEAHLEL---NAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL-DKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFV----------HVVSITFTSLVLTELLMVALTIRTWH 3178
            R++ I +P +V+++ +N I   KYNF+TF+P  L EQFS + N+ FL +A  Q I  +     YT   PL  V+  +  +E ++D +R   D  VN  + VK++++   ++++  +++VGDI+ V      PAD++ L ++E  G C++ T  LDGET+ K+R    +       + I KI    Y       E PN  +++F G  + T +     PLS +  L     L N + V G+V YTG +++ + NS+    K   +D   N     LF   + L+L   I  GF           WY          Y      F +L++ +IP++L V L++ K + A  I  D ++         + RT+ + EELG++ Y+ SDKTGTLT+N M F+K+ +G +SY             D +   +      +   A +  +         IR  E +  +++CH V+P R+ ++ +                      + YQA+SPDE ALV   + +G         S  +RT   +++N       Y+IL +  F S  KRMS+I++  + G+I L+ KGAD V+ + +       E T       A+EGLRTL +    +  E+Y ++   Y+QA  S+ +RA KV      IER+L LL  T +EDKLQE V  ++  L +A I++W+LTGDK ETA +I  + RL++    L          +      HL +   N  +        +    LQ   +  +  F+ LA+ C AV+ CR SP QK+ +VRL++ H    I  AIGDG NDV MI AA VG+GI G+EG QA+ ASD+++ QF ++ KL  VHG  +Y+  A L  +  ++ + + V++  F+    F    LF  + +  Y  +FT  P  ++ L D+ V+ +  L YP+LYK+       N K F++W++ S+Y   ++ Y    + + +            H+ ++ +T +V+T  L   + +  W+
Sbjct:    1 RVIIINKP-QVRQYCNNKISTAKYNFLTFLPKFLLEQFSRYSNVFFLFIALLQQIDGVSPTGRYTTAVPLLLVLSCSAIKEIIEDYKRHAADGLVN-NRRVKVLRDNTLQSLLWIEVQVGDIVKVVNGHFFPADLILLSSSEPMGMCYVETSNLDGETNLKIRQMFNSLSLF--IDCISKISGHCYLQGRVECEGPNNRLYDFVGNIALTGKKPV--PLSADQVLLRGAQLRNTQWVFGLVAYTGHDSKLMQNSTAAPIKRSNVDHTTNIQILFLFGLLMALALCSTI--GFYVWAGEHEHAHWYLGYEELPPQNYGLTFLTFIILYNNLIPISLTVTLEVVKFIQAIFINLDIDMYYAPSDTPAMARTSNLNEELGQVKYIFSDKTGTLTRNVMEFRKVTIGGISYRLSVRPFFVLQNNDHLKNNSCGEGQSFSDPALLDNLREHHPTASVIR--EFLTLLSVCHTVVPERDTQNPDK---------------------IIYQAASPDEGALVKGAKKLGF--------SFNVRTPTSVIINAMGKEEVYEILNVLEFNSTRKRMSVIVRTPE-GKIKLYCKGADTVVFERMRENQLYLETTVKHLEEFAKEGLRTLCIAMSELDPEEYSEWSKIYYQASTSLENRADKVDEAAELIERNLFLLGATAIEDKLQEGVPESIAALADADIKIWVLTGDKQETAINIGYACRLLTGEMKLLMCNDETLDGIREWLNEHLRMIGRNGIKCERMCCFFVDQVLLQALTDELKLNFLDLALCCKAVICCRVSPLQKSQVVRLVKHHVKDSITLAIGDGANDVGMIQAAHVGVGISGQEGLQAASASDYAIAQFRYLNKLLFVHGAWSYQRLAKLILYSFYKNVCLYVIELWFAMENGFSGQILFDKWCIGIYNVIFTSVPPLAIGLFDRTVSSESMLKYPKLYKTSQNAEIYNTKVFWLWIMTSVYHSLLLFYLPFGMLKHEVPYSNGLVVGQWHLGNVVYTLVVITVCLKAGMELDAWN 976          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO42274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1W4])

HSP 1 Score: 415.231 bits (1066), Expect = 2.299e-125
Identity = 299/952 (31.41%), Postives = 478/952 (50.21%), Query Frame = 2
Query:  389 QKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYE-MIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIM---------LILKGFSG--SWYKYL-----------W-RFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVR----------KTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMV-----TFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRN----------------QSLHVF----QPVAGRAEAHLELNAFRK------RSDSA-----------LVITGQSLQTCL-EFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNH----VAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFP-VFSLVLDKDVTDKVALTYPELY 2977
              +  N I+  KY  ITF+P  LFEQF    NM FL+      IP +      +   PL FV+  T  ++A DDIRR + DR+VN  +   L+ N  +  I   KI+ GD++ +D N++IPAD + L T+E++G C+I T +LDGET+ K R  +P T  +   E ++ K +  ++ E PN  +  F G  +  ++   E  L  +N +    VL N   V G V+Y G +++ +MNS     K   +DR +N L   + V    + +++         L+ + F     W  +            W  F ++ + +IP++L +++++ ++  +  I  D+ +           RTTT+ EELG+I Y+ SDKTGTLTQN M FKK  +    YG  +       L+S     ++ P  D K R             +    E ++ +ALCH V+                        + N E+ + YQA SPDE ALV+     G     R   ++ +  + G    +++L I  F ++ KRMS+I++  Q  +I L+ KGAD ++ + +     +  D   E+    A EGLRTLV+  K +T + Y  ++S+Y +A +++ +R  +V A    IE++L L+  T +EDKLQ+ V   + TL  A I++W+LTGDK ETA +I  S +L++ +                +S++++    Q       AH    +FRK      +SDS            LVITG+SL   L +  E EF++LA  C AV+ CR +P QKA +V+L++ +      AIGDG NDVSMI AA +G+GI G+EG QA+LASD+S  QF +    + +L LVHGR +Y        +  ++    +++Q  ++    + A  L+  + +  Y  +FT  P VF  + D+DV  +  + YP+LY
Sbjct:   21 HHYKDNFIRTSKYTIITFLPKNLFEQFQRVANMYFLLQVIIMSIPEITALKPESTAVPLVFVIGFTAIKDAYDDIRRHQSDRDVNNRKSKALIGNS-REEIKWMKIKCGDVLKIDNNEQIPADFLILSTSEENGLCYIETAELDGETNLKCRQPLPDTNEMGDDEALLAKFKGTVHCEPPNNILDKFNGKIAFDNQ---EYSLDNDNLILRGCVLRNTDWVYGTVVYAGQDSKLMMNSGVSTFKRTNLDRLLNKLIIGIAVLLACICIVLSIGTTIWEELVGQNFQVFLQWPNFYMNNVVFIGTCHWPSFIMVLNTLIPISLYISVEVIRMGQSIWINWDQYMYYEKKDTPARARTTTLTEELGQIEYIFSDKTGTLTQNVMTFKKCSIHGKMYGEHAPLLYCIVLQSPLVDFSSNPYYDGKFRFHDKALIDDIANNSQGCHEMMRLLALCHTVM------------------------IDNAEEGLVYQAQSPDEAALVTAARNFGFVFKERSPTTLTI-VAMGQEEQHELLAILDFNNDRKRMSVIVR--QNDKIKLYCKGADSIIYERLHPSCTSLMDKTTEDLNKFAAEGLRTLVLAYKDITPQDYQAWKSKYDKACVAMDNREEQVQAVYEEIEKNLILIGATAIEDKLQDGVPDAIATLAAANIKIWVLTGDKPETAVNIGYSCQLLTDDMTEVFMINGDSMDAVRESINMYKSKVQAGLDDKAAHNNSVSFRKGSRETAKSDSGGKTDGGNAGFGLVITGKSLVFALNKQLELEFLELACMCKAVICCRVTPLQKALVVQLVKDNKKAVTLAIGDGANDVSMIKAAHIGVGISGQEGMQATLASDYSFAQFRYPLHSIVRLLLVHGRWSYMRMCKFLNYFFYKNFAFTLIQLWYAFFTGYSAQTLYDAWFISFYNVLFTSGPVVFLAIFDQDVNHENCIRYPKLY 941          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO37903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEC6])

HSP 1 Score: 404.445 bits (1038), Expect = 6.243e-122
Identity = 288/962 (29.94%), Postives = 458/962 (47.61%), Query Frame = 2
Query:  383 RVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLC-REAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEG--CFSRTDEVEAEDPLSVENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILK--------------------GFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAE---------------QLKSFYESGATMP-PVDTK--VRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTF--TDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDS------ALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDD 3094
            + +++  N I   KY    FIP  LFEQF    N  FL +   Q      I  +       G   + T C  +  +D  R K D+EVN ++   ++ +G  + I S  I+VGDI+ V  N+  P D++ L + +  G C I T  LDGET+ K+R AV  T  L + E +  +QA I  + P+ +++ + G   F+   E E    L  +N L     L N   V G+ +YTG ET+  +N ++   KF  +++ +N    +  +  V+   I   LK                     F G    +L  F +L++Y+IP++L V ++L K + A     D ++         I  T+ + EELG++ Y+ +DKTGTLT+N+M FK+  +    Y  + M+   +                L  F   G     P  TK  +       VL+   A+ALCH V   +  + E+                        YQASSPDE ALV      G+    +    M+++   G    Y +L +  F S  KRMS+I+K  + G+  +  KGA+  +   +     D   +     A +GLRTL V ++V T E+Y D +++  +A  +I+DR  ++A     +E +L LL  T VEDKLQ  V  T+E +R AGI+VW+LTGDK +TA +I+ S         L      +  +E   EL  F+++  S       L++ G SL      ++  F+++   C AV+ CR SP QKA +V+L+++     +  AIGDG ND  MI  A VGIG++GKEGRQA + SD+++ +F  +A++ LVHG   Y  +A L Q+  ++ +     Q I++    F   PL+ GFL+  Y   FT  P+    + ++ +   +    P LY+ + K   L++  F  WV    +   +  +G  L+F+ D
Sbjct:   24 KQKRYADNMIVTSKYTIWNFIPKNLFEQFRRIANFYFLCIGTIQVRGGSLIKSVVA-----GTDFYHTKCVAKGYEDYLRHKVDKEVN-SRPCGVVFDGIVKDIQSKDIKVGDIVRVKDNEEFPCDLIVLASDDPEGKCHITTANLDGETNLKVRSAVSRTAFLHSPEKLSSLQATIECQHPHVDLYGYSGRIIFNANGENEITS-LGPQNLLLRGARLKNSDHVFGVAVYTGKETKMALNQAEAPHKFSTVEKTMNTFLIVFLLVLVLQGAICTGLKYWKESTVPGKAPYANDSGIASFKGVIEDFL-VFLILYNYVIPISLYVTVELQKFIGALFFAWDVKMYNPDTDEPAIANTSDLNEELGQVEYVFTDKTGTLTENDMQFKECSINGKKYKENEMELCVDGPGQPASILMPSASVSLGQFNHVGHLQSTPFKTKMSILYNYIQDVLDFYLALALCHTVQASKSSDQESI-------------------YEFHYQASSPDEKALVEAAVRFGIVYRGKVGEDMEVQM-QGTSHRYTLLHVLEFDSTRKRMSVIVKTAE-GQYLMLTKGAETAILDRLESGPKDVTADHVDGYAEQGLRTLAVAQRVFTPEEYRDVDAKLTKAGQAINDREQQLAEVFEEVECNLHLLGATAVEDKLQAGVPETIEAMREAGIKVWVLTGDKEQTAVNISHSCGHFKHGMDLMFVTRRSSPSECEQELLQFKQKVQSQPDKLFGLIVDGMSLVHIFNGHKELFIEVCKFCMAVLCCRMSPLQKAQVVQLVKVSKEKPVTLAIGDGANDCGMIQEAHVGIGVMGKEGRQAVMTSDYAISRFRFLARVLLVHGHWYYIRSAILVQYFFYKNVCFITPQFIYAFFNAFSGQPLYHGFLLTCYNIFFTSLPILIFGIFNQHIGGDILQGRPSLYQDVAKNSRLSWVQFIYWVASGYWHALVFFFGGYLMFQGD 956          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO40789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S635])

HSP 1 Score: 247.669 bits (631), Expect = 5.350e-67
Identity = 173/590 (29.32%), Postives = 295/590 (50.00%), Query Frame = 2
Query: 1631 PVREIEDENSSP----GNSFD---------IGSGDTILSNLE------------QTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDE--ETG--------------NMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLV----------SRNQ---SLHVF--------QPVAGRAEAHLELN--AFRKRSDS----ALVITGQSLQTCLEFYEYE-FMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMF-PVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFE----DDFVHVVSITFTSLVLTELLMVALTIR-TW 3175
            P R ++ E   P    GNS           I S  ++ SNL+            ++++Y+A SPDE ALV    + G  L++R  NS+ +      ++ +K+L +  F S  KRMS++++    G + ++ KGAD  +   +T   + DE  E G                AR+GLRTL + K+ +++ +Y D+ + + +A+ ++  R   +  +   +E +++LL  TG+ED+LQ+ V  T+  LR  G++VW+LTGDK ETA ++  +S+L+          ++N+   S  ++        +P              +F  R  +     L+I G +L   LE    E F+ LA +C  V+ CR +P QKA +V L+R        AIGDG NDVSMI  ADVGIGI G+EG QA +ASDF++ +F  +A+L LVHG   Y     +  +  ++  +  ++   +     F          ++ +  +FT   P+   +LDKD+   +    P+LYK+  +G+  + K F+  +L ++YQ  I+ +   LLFE    DD +  +++   ++VL  + +  +T + TW
Sbjct:  611 PARPVQVERDPPNGFTGNSLSQSPVANRTRIPSNFSVDSNLDSSLLEIMDSKAWESISYEAESPDEAALVKMACSYGYRLLSRSPNSVTIFIPGEGVVKFKVLHVLSFDSTRKRMSVVVRRPSDGAVLMYCKGADSAVLTRLTHASYADEAVEGGVKSTLVNQIDRHLTMYARDGLRTLCMAKRELSDSEYHDWLTEHKRAETALQHRERLLQESAQKLESNMELLGATGIEDRLQDGVPETIAKLREGGLKVWVLTGDKQETAINVGYASKLLDASMQKITLNAKNKDECSCQIYSWLNHLKIEPTVSSISGSTSYTTVSFDSRITADQPLGLIIDGPTLIYALEKPLNEKFLHLASRCQVVLCCRATPMQKASVVELVRDGLKVMTLAIGDGANDVSMIQMADVGIGITGQEGMQAVMASDFAIARFRFLAQLLLVHGHWCYDRITKMILYFFYKNAMFVLVLFWYQLYNGFSGSNAIDDLSLIFFNLIFTAAPPIVCGILDKDLPATLLKDNPQLYKAGQEGQLYSRKLFWATILDALYQSVILFFACFLLFEGMPADDRMVGITMHQAAVVLASVHLGLMTAQWTW 1200          

HSP 2 Score: 186.422 bits (472), Expect = 1.005e-47
Identity = 138/427 (32.32%), Postives = 218/427 (51.05%), Query Frame = 2
Query:  404 NAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSK---IEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAV----PTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSV--ENTLWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFS-GSW-----------------------YKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRD-----EEIPQ-VIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKV 1564
            N IK  KY   +FIP  LFEQF  F N+ FL +    ++PA+          PL FV+ VT  ++  +D RR+  D++VN T  +  + +    + I++K   + VGDII +  N+ IPAD++ L +++++  C++ T  LDGET+ K R  V       +R       FK++     E PN +I+ F G      E++    L+V  EN L    ++ N + V G+V+Y G +T+A++N+S PRSK   ++R++N    L  +  VV+   +  L G   G W                       +   W F ++   +IP +L V+ +L K+   F+I  D     EE  Q VI R   I E+LG+I Y+ SDKTGTLT+N+M+FKK  +G V+Y  +S  ++ +   S  E    M  V ++V
Sbjct:   39 NKIKTTKYTIWSFIPKNLFEQFHRFANIYFLFIVGLNWVPAINAFGKEIAMLPLIFVLAVTAVKDLFEDRRRYNSDKKVNNT--ICQVYSSASASYIATKWKDVVVGDIIKLSSNEIIPADILLLNSSDENNICYVETANLDGETNLKQREVVNGLFKEDERFSPRNFNFKLK----CETPNNHIYRFHGAI----ELDDSHTLAVGKENLLLRGCIVRNTKNVEGVVVYAGHDTKAMLNNSGPRSKHSKVERDLN----LDVIACVVILFTLCFLGGLGCGIWTQNNDFFNAHFAPGGESSAPMEGFIRFWTFIIILQVLIPYSLYVSAELVKLGQVFLISSDLQLYHEETDQPVICRALNINEDLGQIKYVFSDKTGTLTENKMVFKKCTIGGVNYPHESAQDLPDAGPSDTEDEQYMQQVSSQV 451          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Match: EDO37904 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEC7])

HSP 1 Score: 113.62 bits (283), Expect = 6.391e-28
Identity = 63/204 (30.88%), Postives = 102/204 (50.00%), Query Frame = 2
Query: 2591 AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSI--------TFTSLVLTELLMVALTIRTW 3175
            AIGDG ND  MI  A VGIG++GKEGRQA + SD+++ +F  +A++ LVHG   Y  +A L Q+  ++ +     Q I++    F   PL+ GFL+  Y   FT  P+    + ++ +   +    P LY+ + K   L++  F  WV    +   +  +G  L+F+ D    +++         F   V+   L +AL    W
Sbjct:   22 AIGDGANDCGMIQEAHVGIGVMGKEGRQAVMTSDYAISRFRFLARVLLVHGHWYYIRSAILVQYFFYKNVCFITPQFIYAFFNAFSGQPLYHGFLLTCYNIFFTSLPILIFGIFEQHIGGDILQGRPSLYQDVAKNSRLSWVQFIYWVASGYWHALVFFFGGYLMFQGDLFGSINVGIWSFGTFVFAVCVIVSNLKLALVTHYW 225          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:101163914])

HSP 1 Score: 1327.77 bits (3435), Expect = 0.000e+0
Identity = 653/1054 (61.95%), Postives = 832/1054 (78.94%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMPP-----VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+  N IKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD ++N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADMVFL+T+EK+G CFIRTDQLDGETDWKL++AV  TQRL     +F I+A ++A+KP  +IH+FEG F+R D + + ++ LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+S  ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   +   Y           +G T P         +VRK+ + R+ EAV+AIALCHNV PV E      S GN  +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T +G +L++ ILQIFPFTSE+KRM II+++E TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+ V+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF HV +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS++FYF ++PL+ GFLMVGYAT+FTMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE+ SL  Y+ SL  L +YFD  ++ T  F+WKV+A+T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKLLCG--SCC--DCLLRLCRRRKELKARTVWLGCPEKCEEKYSKNIIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDTDMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKNQRIPADMVFLRTSEKTGACFIRTDQLDGETDWKLKVAVGCTQRLPAVGDLFSIKAFVFAQKPQLDIHSFEGNFTREDSDPQIQESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSSAKNKVGLLDLELNRLTKALFLAQVVLSIVMVALQGFVGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDESIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGADTMDEIQSHIVRSYGQVTHQASSSTTGGTTPSGKSQTAGPRVRKSVSSRIHEAVKAIALCHNVTPVYE------SHGNG-ETESAEADQDFTDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPSGQILSFHILQIFPFTSESKRMGIIVREESTGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYSQAKLSLHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRSVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVTLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHVGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSVFYFASVPLYQGFLMVGYATIFTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAELFSLACYLASLAFLSEYFDRSYITTWPFLWKVSAITLVSCLPLYIIKYLKRKFSPPSYSKL 1120          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:101163914])

HSP 1 Score: 1320.84 bits (3417), Expect = 0.000e+0
Identity = 653/1065 (61.31%), Postives = 832/1065 (78.12%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMPP-----VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+  N IKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD ++N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADMVFL+T+EK+G CFIRTDQLDGETDWKL++AV  TQRL     +F I+A ++A+KP  +IH+FEG F+R D + + ++ LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+S  ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   +   Y           +G T P         +VRK+ + R+ EAV+AIALCHNV PV E      S GN  +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T +G +L++ ILQIFPFTSE+KRM II+++E TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+ V+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF HV +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS++FYF ++PL+ GFLMVGYAT+FTMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE+ SL  Y+ SL  L +YF           D  ++ T  F+WKV+A+T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   57 WKLLCG--SCC--DCLLRLCRRRKELKARTVWLGCPEKCEEKYSKNIIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDTDMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKNQRIPADMVFLRTSEKTGACFIRTDQLDGETDWKLKVAVGCTQRLPAVGDLFSIKAFVFAQKPQLDIHSFEGNFTREDSDPQIQESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSSAKNKVGLLDLELNRLTKALFLAQVVLSIVMVALQGFVGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDESIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGADTMDEIQSHIVRSYGQVTHQASSSTTGGTTPSGKSQTAGPRVRKSVSSRIHEAVKAIALCHNVTPVYE------SHGNG-ETESAEADQDFTDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPSGQILSFHILQIFPFTSESKRMGIIVREESTGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYSQAKLSLHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRSVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVTLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHVGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSVFYFASVPLYQGFLMVGYATIFTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAELFSLACYLASLAFLSEYFGTGRLSAKTLLDRSYITTWPFLWKVSAITLVSCLPLYIIKYLKRKFSPPSYSKL 1109          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:101163914])

HSP 1 Score: 1320.06 bits (3415), Expect = 0.000e+0
Identity = 653/1065 (61.31%), Postives = 832/1065 (78.12%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY----------ESGATMPP-----VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF-----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+  N IKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD ++N   Y KL   G K  + SS I+VGD+IIV+KNQRIPADMVFL+T+EK+G CFIRTDQLDGETDWKL++AV  TQRL     +F I+A ++A+KP  +IH+FEG F+R D + + ++ LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+S  ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   +   Y           +G T P         +VRK+ + R+ EAV+AIALCHNV PV E      S GN  +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T +G +L++ ILQIFPFTSE+KRM II+++E TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+ V+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF HV +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS++FYF ++PL+ GFLMVGYAT+FTMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE+ SL  Y+ SL  L +YF           D  ++ T  F+WKV+A+T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   79 WKLLCG--SCC--DCLLRLCRRRKELKARTVWLGCPEKCEEKYSKNIIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDTDMNSQLYSKLTVRG-KIQVKSSDIQVGDLIIVEKNQRIPADMVFLRTSEKTGACFIRTDQLDGETDWKLKVAVGCTQRLPAVGDLFSIKAFVFAQKPQLDIHSFEGNFTREDSDPQIQESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSSAKNKVGLLDLELNRLTKALFLAQVVLSIVMVALQGFVGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDESIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGADTMDEIQSHIVRSYGQVTHQASSSTTGGTTPSGKSQTAGPRVRKSVSSRIHEAVKAIALCHNVTPVYE------SHGNG-ETESAEADQDFTDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPSGQILSFHILQIFPFTSESKRMGIIVREESTGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYSQAKLSLHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRSVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVTLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHVGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSVFYFASVPLYQGFLMVGYATIFTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAELFSLACYLASLAFLSEYFGTGRLSAKTLLDRSYITTWPFLWKVSAITLVSCLPLYIIKYLKRKFSPPSYSKL 1131          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: atp9b (ATPase phospholipid transporting 9B (putative) [Source:NCBI gene;Acc:101163914])

HSP 1 Score: 1296.95 bits (3355), Expect = 0.000e+0
Identity = 642/1059 (60.62%), Postives = 820/1059 (77.43%), Query Frame = 2
Query:  275 YKYLCSLPSCCWASCIKK-CKRQKEYFARIVTIGRPPRVQ-KFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY-----ESGATMPP-----VDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYF----------DTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
            +K LC   SCC   C+ + C+R+KE  AR V +G P + + K+  N IKNQKYN +TF+P VL++QF  FLN+ FLV+ACSQF+P+LKIGYLYTYW PLGFV+ VT+ REAVD++RR +RD ++N   Y KL   G + + +S             NQRIPADMVFL+T+EK+G CFIRTDQLDGETDWKL++AV  TQRL     +F I+A ++A+KP  +IH+FEG F+R D + + ++ LS+ENTLWA+TV+A+G  +G+VIYTG ETR+V+N+S  ++K GL+D E+N LTK LF+  VVLS++M+ L+GF G W++ L+RF +LFSYIIP++LRVNLD+ K    ++IM+DE IP  +VRT+TIPEELGR+ YL++DKTGTLTQNEM+FK+LHLGTVSYGAD+MDEI   +   Y     +   T P         +VRK+ + R+ EAV+AIALCHNV PV E      S GN  +  S +      +   TYQASSPDEVALV WTE+VGLTLVNRDL S+QL+T +G +L++ ILQIFPFTSE+KRM II+++E TGEI+ +MKGAD+ MA +V + DWL+EE GNMAREGLRTLVV KK ++EEQY DFESRY QAKLS+ DRA KVAA + ++ER+++LLCLTGVED+LQ  VRPTLE LRNAGI++WMLTGDKLETA  IAKSS LVSR+Q +HVF+ V+ R EAHLELNAFR++ D ALVI+G SL+ CL +YE+EF++LA QCPAVV CRCSPTQKA IV LL+ HT  R  AIGDGGNDVSMI AAD GIGI GKEG+QASLA+DFS+ QF HV +L +VHGRN+YK +A L QFV+HRGMIIS MQA+FS++FYF ++PL+ GFLMVGYAT+FTMFPVFSLVLD+DV  ++AL YPELYK LTKGR L++KTF +WVLISIYQGGI+MYGALLLFE +FVHVV+I+FT+L+LTELLMVALT+RTWH LM++AE+ SL  Y+ SL  L +YF          D  ++ T  F+WKV+A+T +SC+PL+I+KY++ K  PP ++KL
Sbjct:   82 WKLLCG--SCC--DCLLRLCRRRKELKARTVWLGCPEKCEEKYSKNIIKNQKYNILTFVPGVLYQQFKFFLNLYFLVVACSQFVPSLKIGYLYTYWAPLGFVLAVTMVREAVDEVRRCRRDTDMNSQLYSKLTVRGQRSSSVS----------FHSNQRIPADMVFLRTSEKTGACFIRTDQLDGETDWKLKVAVGCTQRLPAVGDLFSIKAFVFAQKPQLDIHSFEGNFTREDSDPQIQESLSIENTLWASTVVASGTVIGVVIYTGKETRSVLNTSSAKNKVGLLDLELNRLTKALFLAQVVLSIVMVALQGFVGPWFRNLFRFVVLFSYIIPISLRVNLDMGKSAYGWMIMKDESIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMVFKRLHLGTVSYGADTMDEIQSHIVRSYGQVSAQVSGTTPSGKSQTAGPRVRKSVSSRIHEAVKAIALCHNVTPVYE------SHGNG-ETESAEADQDFTDDNRTYQASSPDEVALVRWTESVGLTLVNRDLTSLQLKTPSGQILSFHILQIFPFTSESKRMGIIVREESTGEITFYMKGADVAMASIVQYNDWLEEECGNMAREGLRTLVVAKKSLSEEQYQDFESRYSQAKLSLHDRALKVAAVVESLEREMELLCLTGVEDQLQADVRPTLELLRNAGIKIWMLTGDKLETATCIAKSSHLVSRSQDIHVFRSVSNRGEAHLELNAFRRKHDCALVISGDSLEVCLRYYEHEFVELACQCPAVVCCRCSPTQKAQIVTLLQQHTANRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHVGRLLMVHGRNSYKRSAALGQFVMHRGMIISTMQAVFSSVFYFASVPLYQGFLMVGYATIFTMFPVFSLVLDQDVKPEMALLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALLLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAELFSLACYLASLAFLSEYFGGLTVFDVPPDRSYITTWPFLWKVSAITLVSCLPLYIIKYLKRKFSPPSYSKL 1119          
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Match: ATP9A (ATPase phospholipid transporting 9A (putative) [Source:NCBI gene;Acc:101163741])

HSP 1 Score: 1265.37 bits (3273), Expect = 0.000e+0
Identity = 620/1041 (59.56%), Postives = 803/1041 (77.14%), Query Frame = 2
Query:  299 SCC-WASCIKKCKRQKEYFARIVTIGRP-PRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTD-EVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFY-----ESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTV-----TYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKL 3382
             CC W+ C        ++  R V +G P  R Q++P N I NQKYNF TF+P VLF QF  F N+ FL++ACSQF+  L++G LYTYW PLG V+F+T+ REA+++IR + RD+EVN   Y KL   G  + + SS I+VGD+IIV+KNQR+PADM+FL+T+E++G+CF+RTDQLDGETDWKLR+ V  TQRL T   + +I++ +YAE+PN +IHNF G F+R D +    + LS+ENTLWA+TV+A+G  VG+VIYTG E R+VMN+S PR K GL D E+N LTK+LF   VV+SL+M+ L+ F+G WY  ++RF LLFS+I+P++LRVNLD+ K+V +++I RD +IP  +VR +TIPE+LGRISYL++DKTGTLTQNEM+F++LHLGTV+YG DSMDE+   + S Y     +  A+  P  TKVRKT + RV EAV+AIAL HNV PV E               +G T  +  EQ        YQASSPDEV+LV WTE+VGLTLV RD +SMQLRT  G ++N+ ILQIFPFT E+KRM II++DE  GEI+ +MKGADMVMA +V + DWL+EE GNMAREGLR LVV KK +TEEQY DFE+RY QAKLS+ DR+ KVA  + ++E +++LLCLTGVED+LQ  VRPTLE LRNAGI+VWMLTGDKLETA   AK++ L++R+Q +H+F+PV  R EAHLELNAFR++ D ALVI+G SL+ CL++YEYEFM+LA QCPAVV CRC+PTQKA IVRLL+  TG    A+GDGGNDVSMI  AD G+G+ GKEG+QASLA+DFS+ QF H+ +L +VHGRN+YK  A LSQFVIHR + IS MQA+FS++FYF ++PL+ GFL++GY+TV+TMFPVFSLVLDKDV  +VA+ YPELYK L KGR L++KTF +WVLISIYQG IIMYGALLLFE +FVH+V+I+FTSL+LTELLMVALT++TWH  M++AE++SL  Y+ SL+ L ++ D  F+ T+SF+WKV A+T +SC+PL+ILKY+R +  PP ++KL
Sbjct:   23 GCCPWSRCCGG----GDFRPRTVWLGHPEKREQRYPKNVINNQKYNFFTFLPGVLFNQFKYFFNLYFLLLACSQFVEELRLGALYTYWVPLGLVLFITIAREAIEEIRCYLRDKEVNSQIYSKLSTRGTVK-VKSSGIQVGDLIIVEKNQRVPADMIFLRTSERNGSCFLRTDQLDGETDWKLRLPVACTQRLPTAGDLLQIRSFVYAEEPNIDIHNFIGTFTREDGDPPVNESLSIENTLWASTVVASGTVVGVVIYTGKELRSVMNTSNPRHKVGLFDLEVNCLTKILFGALVVVSLVMVALQHFAGRWYLQIFRFLLLFSHIVPISLRVNLDMGKMVFSWMIKRDSKIPGTVVRASTIPEQLGRISYLLTDKTGTLTQNEMVFRRLHLGTVAYGMDSMDEVQSHIFSAYTQPTHDLPASRTPAATKVRKTISSRVHEAVKAIALVHNVTPVYE--------------SNGVTDQAEAEQHYEDTCRVYQASSPDEVSLVQWTESVGLTLVGRDQSSMQLRTPTGQIMNFTILQIFPFTYESKRMGIIVRDESAGEITFYMKGADMVMAGIVQYNDWLEEECGNMAREGLRVLVVAKKSLTEEQYQDFEARYVQAKLSVHDRSLKVATVIESLEMEMELLCLTGVEDQLQTDVRPTLEILRNAGIKVWMLTGDKLETATCTAKNAHLITRSQDIHIFRPVTTRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEYEFMELACQCPAVVCCRCTPTQKAQIVRLLQERTGKLTCAVGDGGNDVSMIQEADCGVGVEGKEGKQASLAADFSVTQFKHLGRLLMVHGRNSYKRAAALSQFVIHRSLCISTMQAVFSSVFYFASVPLYQGFLIIGYSTVYTMFPVFSLVLDKDVKSEVAMLYPELYKDLLKGRPLSFKTFLIWVLISIYQGSIIMYGALLLFESEFVHIVAISFTSLILTELLMVALTVQTWHWFMIVAELLSLACYIASLVFLHEFIDIYFITTVSFLWKVTAITLVSCLPLYILKYLRRRFSPPNYSKL 1044          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000061014.1 (SMESG000061014.1)

HSP 1 Score: 2132.07 bits (5523), Expect = 0.000e+0
Identity = 1060/1060 (100.00%), Postives = 1060/1060 (100.00%), Query Frame = 2
Query:  212 MKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN 3391
            MKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNLTKLLFVTTVVLSLIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEIVSLVIYVVSLIVLKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN
Sbjct:    1 MKDDEEIFFGSNRRLNRFEIFYKYLCSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNLTKLLFVTTVVLSLIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEIVSLVIYVVSLIVLKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN 1060          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000061014.1 (SMESG000061014.1)

HSP 1 Score: 2066.2 bits (5352), Expect = 0.000e+0
Identity = 1029/1029 (100.00%), Postives = 1029/1029 (100.00%), Query Frame = 2
Query:  305 CWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEXXXXXXXXXXXXXXKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN 3391
            CWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNLTKLLFVTTVVLSLIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEIVSLVIYVVSLIVLKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN
Sbjct:   25 CWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLANGRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNLTKLLFVTTVVLSLIMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVLTELLMVALTIRTWHILMLIAEIVSLVIYVVSLIVLKDYFDTDFLKTISFVWKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN 1053          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000000504.1 (SMESG000000504.1)

HSP 1 Score: 452.21 bits (1162), Expect = 1.366e-140
Identity = 304/954 (31.87%), Postives = 496/954 (51.99%), Query Frame = 2
Query:  356 RIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENT--LWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINN------XXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRF------------FLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFT--------DWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFR--------KRSDSALVITGQSLQTCLEFY-EYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL-DKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALL 3079
            RIV I  P  V K+  N I   KYNF+TF+P  LFEQF  + N+ FL++A  Q  P +     YT   PL  ++ ++  +E V+D +R K D   N ++ + +++N +   I   +++VG+ + +   Q IPAD+V L ++E  G  +I T  LDGET+ K+R  +P T  + T   + K+   I  E PN++++ F G  +    ++ E  +S+ N   L     L N + V G+V+Y+G ET+ ++NS+ P  K   ++R  N          L       ++ ++        +WY    R+            F++F  IIP++L+V L++ + + A  I  D E+           RT+ + EELG++ Y+ SDKTGTLT+N M FK+  +G + YG    +  + Q           P +  K++   +  V    +A+A+CH V+P +E                        +  + YQASSPDE ALV   + +G     R  + +++  +N     YK+L +  FTS  KRMS+I+K   + +I LF KGAD V+ + ++          D L+E     A+ GLRTL +    +   +Y  ++  +H+A +SI +R  K+AA    IE++L L+  + +EDKLQ+ V  T+  L  AGI++W+LTGDK ETA +I  S +L+++N SL +        +   +L   R        K +D  LV++G +L+  L+F    +F+Q+A+ C AV+ CR SP+QKA++V L++ +    I  AIGDG NDV MI AA VGIGI G EG+QA+  SD+++ QF  + +L LVHG   Y     L  +  ++ +   V+Q  F+ +  F    +F  + +  Y  +FT  P  +L L D+  + + +L YP+LY+ + +    + K F  W+L S+Y   I+ +  +L
Sbjct:   35 RIVNINHPQPV-KYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSK-ILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLA----LDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYILGLCGLLLFLTLATSIANVVWTNANKDTAWYLGFDRYPPNNFGLMLLTAFIMFHTIIPISLQVTLEMVRFIQAHFINVDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKD---------PNLLEKLKYIDS-EVDMFFKALAVCHTVVPEKE------------------------DNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNE-NYEYKVLNVLEFTSLRKRMSVIVKTPDS-KIVLFTKGADNVIYERLSTASKNGKLTLDNLEE----FAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDS-DSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVL 941          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000000504.1 (SMESG000000504.1)

HSP 1 Score: 452.981 bits (1164), Expect = 1.624e-140
Identity = 305/959 (31.80%), Postives = 497/959 (51.82%), Query Frame = 2
Query:  356 RIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENT--LWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINN------XXXXXXXXXXXXXXIMLILKGFSGSWYKYLWRF------------FLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFT--------DWLDEETGNMAREGLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFR--------KRSDSALVITGQSLQTCLEFY-EYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSLVL-DKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDD 3094
            RIV I  P  V K+  N I   KYNF+TF+P  LFEQF  + N+ FL++A  Q  P +     YT   PL  ++ ++  +E V+D +R K D   N ++ + +++N +   I   +++VG+ + +   Q IPAD+V L ++E  G  +I T  LDGET+ K+R  +P T  + T   + K+   I  E PN++++ F G  +    ++ E  +S+ N   L     L N + V G+V+Y+G ET+ ++NS+ P  K   ++R  N          L       ++ ++        +WY    R+            F++F  IIP++L+V L++ + + A  I  D E+           RT+ + EELG++ Y+ SDKTGTLT+N M FK+  +G + YG    +  + Q           P +  K++   +  V    +A+A+CH V+P +E                        +  + YQASSPDE ALV   + +G     R  + +++  +N     YK+L +  FTS  KRMS+I+K   + +I LF KGAD V+ + ++          D L+E     A+ GLRTL +    +   +Y  ++  +H+A +SI +R  K+AA    IE++L L+  + +EDKLQ+ V  T+  L  AGI++W+LTGDK ETA +I  S +L+++N SL +        +   +L   R        K +D  LV++G +L+  L+F    +F+Q+A+ C AV+ CR SP+QKA++V L++ +    I  AIGDG NDV MI AA VGIGI G EG+QA+  SD+++ QF  + +L LVHG   Y     L  +  ++ +   V+Q  F+ +  F    +F  + +  Y  +FT  P  +L L D+  + + +L YP+LY+ + +    + K F  W+L S+Y   I+ +  +L    D
Sbjct:   35 RIVNINHPQPV-KYCLNKISTAKYNFLTFMPKFLFEQFRRYANIFFLLIAILQQFPNVSPTGRYTTAVPLFIILTISAIKEIVEDYKRHKADDSTNNSK-ILILQNSEWVEICWKQLQVGNFVKLINGQGIPADLVLLASSEPHGMSYIETSNLDGETNLKMRQGLPRTCDILTITDLMKMHGHIACEVPNRHLYEFCGNLA----LDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTPPLKRSSVERMTNRYILGLCGLLLFLTLATSIANVVWTNANKDTAWYLGFDRYPPNNFGLMLLTAFIMFHTIIPISLQVTLEMVRFIQAHFINVDIEMYDPDTNTPANARTSNLNEELGQVRYIFSDKTGTLTRNVMEFKQCSIGGIIYGKGPDETFSAQKD---------PNLLEKLKYIDS-EVDMFFKALAVCHTVVPEKE------------------------DNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKISINNE-NYEYKVLNVLEFTSLRKRMSVIVKTPDS-KIVLFTKGADNVIYERLSTASKNGKLTLDNLEE----FAKIGLRTLCIAYAEIDSNEYEKWKGEFHEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDS-DSLDKTRTQLIEVRQGFGENIGKENDIGLVVSGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRLTKLILYSFYKNVCFFVIQFWFAIVSGFSGQIIFERWSIGFYNVIFTAAPPLALGLFDRSCSAENSLKYPQLYREIQQSSTFDLKVFLTWILNSLYHSLILFWLTVLANNHD 946          
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Match: SMESG000026251.1 (SMESG000026251.1)

HSP 1 Score: 456.447 bits (1173), Expect = 3.922e-140
Identity = 315/992 (31.75%), Postives = 511/992 (51.51%), Query Frame = 2
Query:  356 RIVTIGRPPRVQKFPSNAIKNQKYNFITFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVTLCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDKNQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEMIFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENT--LWANTVLANGRAV-GMVIYTGSETRAVMNSSQPRSKFGLIDREINNXXXXXXXXXXXXXXIMLILK--------------GFSGSWYKY-LWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDEEI------PQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGADSMDEIAEQLKSFYESGATMPPVDTKVR---KTGAIRVLEAVQAIALCHNVIPVREIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVGLTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEISLFMKGADMVMAQMVTFTDWLDEETGNMARE----GLRTLVVGKKVMTEEQYLDFESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTLETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAHLELNAFR--------KRSDSALVITGQSLQTCLEFY-EYEFMQLAIQCPAVVVCRCSPTQKADIVRLLRIHTGCRIA-AIGDGGNDVSMILAADVGIGIVGKEGRQASLASDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAIFYFVAIPLFPGFLMVGYATVFTMFPVFSL-VLDKDVTDKVALTYPELYKSLTKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFV----------HVVSITFTSLVLTELLMVALTIRTW 3175
            RIV I  P  V K+  N I   KYNF+TF+P  LFEQF  + N+ FL++   Q  P +     YT   PL F++ ++  +E V+D +R K D   N ++ + +++N +   I   K++VG+I+ +   Q+IPAD+V L ++E     +I T  LDGET+ K+R  +P T  + T   + KI+  I  E PN++++ F G  +    ++ E  +S+ N   L     L N + V G+V+Y+G ET+ ++NS+    K   ++R++N    + F   V L+L+  I                GF GS +       F+ +  IIP+++ V L++A+   +  I  D E+           RT+ + EELG+I Y+ SDKTGTLT+N M FK+  +G + YG  + D ++ Q              DT +    K G   V    +A+A+CH V+P +E                        +  + YQASSPDE ALV   + +G     R  + +++  +N     YK+L +  FTS  KRMS+I+K   + +I LF KGAD V+ + ++      + T +  +E    GLRTL +    +   +Y  ++  + +A +SI +R  K+AA    IE++L L+  + +EDKLQ+ V  T+  L  AGI++W+LTGDK ETA +I  S +L+++N SL +        +   +L   R        K +D  LV+ G +L+  L+F    +F+Q+A+ C AV+ CR SP+QKA++V L++ +    I  AIGDG NDV MI AA VGIGI G EG+QA+  SD+++ QF  + +L LVHG   Y   A L  +  ++ +   ++Q  F+    F    +F  + +  Y  +FT  P  +L + D+  + K+ L YP LY+ +      + K F  W+L SI+   I+ +  + +   D +          ++ +  +  +V+T  L   L +R W
Sbjct:   50 RIVNINHPQLV-KYCINKISASKYNFLTFMPKFLFEQFRKYGNLYFLLIVILQQFPNVSPTGRYTTAVPLFFILTLSAIKEIVEDYKRHKADDSTNNSKLL-ILQNSEWVEICWKKLQVGNIVKLINGQKIPADLVLLASSEPHAMSYIETSNLDGETNLKMRQGLPRTCHILTITDLVKIRGHIECEVPNRHLYEFYGNLA----LDGEKKISLGNDQLLLRGATLKNTKWVFGIVVYSGHETKVMLNSTTAPLKKSSVERKMNRYILVTFGILVFLTLVTTIANMISTNAIKDIAWYLGFEGSNFGLNFLENFITYHSIIPISVSVQLEMARFGQSHFINEDIEMYDPDTNTPANARTSNLNEELGQIRYIFSDKTGTLTRNIMEFKQCSIGGIIYGKGAGDTLSVQ-------------KDTNLLEKLKYGDSEVDMFFKALAVCHTVVPDKE------------------------DNEIIYQASSPDESALVKAAKEMGYIFHTRTPDGIKILINNENY-EYKVLNVLEFTSLRKRMSVIVKTPDS-KIVLFTKGADNVIYERLSPASKNGKLTLDNLKEFAKIGLRTLCIAYAEIDSNKYEKWKKEFLEASVSIENRENKLAAVAEKIEKNLILIGASAIEDKLQDQVPETISNLAKAGIKIWVLTGDKQETAVNIGYSCQLLTQNMSLCILDS-DSLDKTRTQLIEVRQGFGENLGKENDIGLVVNGDTLKFALDFQCRDDFLQIALSCKAVICCRVSPSQKAEVVTLVKSNIKDAITLAIGDGANDVGMIQAAHVGIGISGLEGQQAACNSDYAIAQFRFLNRLLLVHGAWNYNRIAKLILYSFYKNVCFFMIQFWFATESSFSGQIIFERWSIAFYNVIFTAAPPLALGIFDRSCSSKILLKYPRLYREIQHSSTFDLKVFLTWILYSIFHSAILFWLPVYINNHDILFRNGQTGSLFYLGNCIYAYVVVTVSLKAGLELRVW 995          
The following BLAST results are available for this feature:
BLAST of Phospholipid-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP9B0.000e+060.44ATPase phospholipid transporting 9B (putative) [So... [more]
ATP9B0.000e+059.84ATPase phospholipid transporting 9B (putative) [So... [more]
ATP9A0.000e+060.10ATPase phospholipid transporting 9A (putative) [So... [more]
ATP9A3.590e-3160.56ATPase phospholipid transporting 9A (putative) [So... [more]
ATP9B6.554e-14955.42ATPase phospholipid transporting 9B (putative) [So... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tat-50.000e+055.22Phospholipid-transporting ATPase [Source:UniProtK... [more]
tat-50.000e+055.22Phospholipid-transporting ATPase [Source:UniProtK... [more]
tat-50.000e+055.22Phospholipid-transporting ATPase [Source:UniProtK... [more]
tat-60.000e+052.72Phospholipid-transporting ATPase [Source:UniProtK... [more]
tat-11.080e-12731.72Phospholipid-transporting ATPase tat-1 [Source:Un... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG317290.000e+057.38gene:FBgn0051729 transcript:FBtr0080461[more]
CG317290.000e+057.46gene:FBgn0051729 transcript:FBtr0080462[more]
CG317290.000e+058.24gene:FBgn0051729 transcript:FBtr0344140[more]
CG317290.000e+058.15gene:FBgn0051729 transcript:FBtr0344851[more]
ATP8A1.448e-13631.12gene:FBgn0259221 transcript:FBtr0303100[more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp9b0.000e+061.10ATPase phospholipid transporting 9B [Source:NCBI g... [more]
atp9b0.000e+061.10ATPase phospholipid transporting 9B [Source:NCBI g... [more]
atp9b0.000e+060.39ATPase phospholipid transporting 9B [Source:NCBI g... [more]
ATP9A0.000e+055.69ATPase phospholipid transporting 9A (putative) [So... [more]
ATP9A0.000e+055.72ATPase phospholipid transporting 9A (putative) [So... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP9B0.000e+061.70ATPase, class II, type 9B [Source:NCBI gene;Acc:10... [more]
ATP9B0.000e+062.26ATPase, class II, type 9B [Source:NCBI gene;Acc:10... [more]
ATP9B0.000e+060.42ATPase, class II, type 9B [Source:NCBI gene;Acc:10... [more]
ATP9B0.000e+060.47ATPase, class II, type 9B [Source:NCBI gene;Acc:10... [more]
ATP9B0.000e+060.37ATPase, class II, type 9B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp9b0.000e+060.81ATPase, class II, type 9B [Source:MGI Symbol;Acc:M... [more]
Atp9b0.000e+060.20ATPase, class II, type 9B [Source:MGI Symbol;Acc:M... [more]
Atp9a0.000e+060.00ATPase, class II, type 9A [Source:MGI Symbol;Acc:M... [more]
Atp9a0.000e+060.02ATPase, class II, type 9A [Source:MGI Symbol;Acc:M... [more]
Atp9a0.000e+060.02ATPase, class II, type 9A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1A4J6|ATP9B_BOVIN0.000e+061.26Probable phospholipid-transporting ATPase IIB OS=B... [more]
sp|F1Q4S1|ATP9B_DANRE0.000e+062.27Probable phospholipid-transporting ATPase IIB OS=D... [more]
sp|P98195|ATP9B_MOUSE0.000e+060.29Probable phospholipid-transporting ATPase IIB OS=M... [more]
sp|O43861|ATP9B_HUMAN0.000e+059.84Probable phospholipid-transporting ATPase IIB OS=H... [more]
sp|D4ABB8|ATP9B_RAT0.000e+059.84Probable phospholipid-transporting ATPase IIB OS=R... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FPH00.000e+066.86Phospholipid-transporting ATPase OS=Mesocestoides ... [more]
A0A5K3FMB70.000e+066.86Phospholipid-transporting ATPase OS=Mesocestoides ... [more]
A0A158QWA40.000e+067.28Phospholipid-transporting ATPase OS=Mesocestoides ... [more]
A0A1S3HSR60.000e+065.57Phospholipid-transporting ATPase OS=Lingula unguis... [more]
A0A210PT260.000e+063.94Phospholipid-transporting ATPase OS=Mizuhopecten y... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp9b0.000e+062.05ATPase phospholipid transporting 9B (putative) [So... [more]
atp9b0.000e+061.41ATPase phospholipid transporting 9B (putative) [So... [more]
atp9b0.000e+061.41ATPase phospholipid transporting 9B (putative) [So... [more]
atp9b0.000e+060.62ATPase phospholipid transporting 9B (putative) [So... [more]
ATP9A0.000e+060.23ATPase phospholipid transporting 9A (putative) [So... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp8b17.214e-12830.22ATPase phospholipid transporting 8B1 [Source:ZFIN;... [more]
ATP8A11.692e-9330.47ATPase phospholipid transporting 8A1 [Source:HGNC ... [more]
atp8b41.638e-8926.34ATPase phospholipid transporting 8B4 [Source:ZFIN;... [more]
ATP8A18.672e-7431.65ATPase phospholipid transporting 8A1 [Source:HGNC ... [more]
si:dkey-211e20.101.685e-6530.27ATPase phospholipid transporting 11B (putative) [S... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NEO10.000e+048.32Phospholipid translocase (flippase), role in phosp... [more]
DRS22.333e-12731.59Trans-golgi network aminophospholipid translocase ... [more]
DNF13.394e-10028.86Aminophospholipid translocase (flippase); type 4 P... [more]
DNF22.625e-9628.76Aminophospholipid translocase (flippase); type 4 P... [more]
DNF31.857e-5534.81Trans-golgi network aminophospholipid translocase ... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360123.048e-13030.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422742.299e-12531.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379036.243e-12229.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407895.350e-6729.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379046.391e-2830.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp9b0.000e+061.95ATPase phospholipid transporting 9B (putative) [So... [more]
atp9b0.000e+061.31ATPase phospholipid transporting 9B (putative) [So... [more]
atp9b0.000e+061.31ATPase phospholipid transporting 9B (putative) [So... [more]
atp9b0.000e+060.62ATPase phospholipid transporting 9B (putative) [So... [more]
ATP9A0.000e+059.56ATPase phospholipid transporting 9A (putative) [So... [more]
back to top
BLAST of Phospholipid-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061014.10.000e+0100.00SMESG000061014.1[more]
SMESG000061014.10.000e+0100.00SMESG000061014.1[more]
SMESG000000504.11.366e-14031.87SMESG000000504.1[more]
SMESG000000504.11.624e-14031.80SMESG000000504.1[more]
SMESG000026251.13.922e-14031.75SMESG000026251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035079 ID=SMED30035079|Name=Phospholipid-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=3776bp
CTTGATTTATTAGTATTTAACTTTTAAAATTTGTTAATTACTGCCTATGA
TTAATTTAATATAGTTATCTGACTTTAACTCATTTTAGAAGCTTTTACAA
ATTTATAAAATTACAAACTATATATCTCTTCCGTATATGGAAGAGACTGC
TTTAATTTTCGATAATGAGAGAAATTCATTTCATGACAATTTTAGATACA
AGTCGTGTAATATGAAAGATGACGAAGAAATTTTCTTCGGCAGTAATAGA
CGCTTAAATCGATTCGAAATATTTTATAAATATTTATGCAGTTTGCCATC
ATGTTGTTGGGCATCATGTATCAAAAAATGTAAAAGGCAAAAGGAATATT
TTGCTAGGATTGTAACAATCGGAAGACCTCCAAGAGTTCAGAAATTTCCT
TCTAATGCCATTAAAAATCAGAAATATAATTTTATCACATTTATACCTTT
GGTACTATTTGAGCAATTTAGCATATTTCTTAATATGTTGTTTTTGGTGA
TGGCATGTAGTCAATTCATTCCAGCTTTAAAGATCGGTTATCTTTACACA
TATTGGGGTCCCTTAGGTTTTGTTGTGTTTGTCACACTTTGTCGAGAAGC
AGTGGATGACATTCGAAGGTGGAAAAGAGACAGAGAAGTTAACATGACTC
AATATGTTAAATTAATGAAAAATGGAGATAAGAGAACAATTATAAGTTCA
AAAATTGAAGTCGGAGACATAATCATCGTTGATAAAAATCAACGAATTCC
AGCTGATATGGTGTTTTTACAAACCACAGAAAAATCTGGTACTTGTTTTA
TACGAACGGATCAACTGGACGGAGAAACTGATTGGAAATTACGAATAGCA
GTCCCAACAACGCAACGATTAGAAACTTATGAGATGATTTTTAAAATTCA
AGCCCAAATTTATGCCGAGAAACCTAACAAAAACATTCATAATTTCGAAG
GCTGTTTCTCTAGAACGGACGAAGTCGAGGCTGAAGATCCTCTTTCAGTT
GAAAATACTCTGTGGGCAAATACCGTTTTGGCAAATGGCAGAGCGGTGGG
TATGGTCATATATACGGGTTCGGAAACCCGCGCAGTGATGAATTCTAGTC
AGCCACGCAGCAAATTCGGCCTAATTGATAGAGAAATTAACAATTTAACG
AAATTGCTCTTCGTTACCACTGTCGTTCTGTCACTCATTATGCTCATTCT
CAAAGGTTTCTCGGGTTCTTGGTACAAATATCTGTGGCGATTCTTTTTAT
TGTTCTCCTACATAATTCCATTAGCTCTCAGAGTAAACTTAGATTTGGCT
AAAATTGTCGCAGCATTTATAATAATGCGCGACGAAGAAATTCCACAAGT
TATTGTTCGAACGACCACCATTCCCGAAGAACTCGGACGAATTTCATATT
TGATGTCTGACAAAACTGGAACTTTAACACAAAATGAAATGATGTTCAAA
AAATTACATCTGGGTACGGTATCTTATGGAGCTGATTCGATGGATGAGAT
TGCTGAACAATTAAAGTCATTCTATGAATCAGGGGCTACCATGCCTCCAG
TTGATACAAAAGTAAGAAAGACTGGTGCCATACGAGTTTTAGAAGCTGTT
CAAGCTATTGCACTTTGTCACAATGTCATCCCGGTAAGAGAAATAGAAGA
TGAAAATTCATCGCCTGGAAATTCGTTTGATATTGGAAGTGGAGATACTA
TTTTGTCAAATCTGGAACAAACAGTTACCTATCAAGCGAGTTCACCGGAT
GAAGTTGCGTTAGTATCTTGGACAGAAACTGTTGGTTTGACATTAGTAAA
CCGAGATCTCAATTCAATGCAGCTGCGAACATCTAATGGTCTACTTTTGA
ATTATAAGATTTTGCAAATATTCCCATTTACATCAGAAACGAAAAGAATG
AGCATCATAATAAAAGATGAACAGACTGGTGAAATAAGTTTGTTTATGAA
AGGTGCTGATATGGTCATGGCGCAAATGGTTACATTTACGGATTGGCTAG
ACGAAGAAACTGGTAACATGGCTAGAGAAGGTTTGCGTACACTGGTTGTA
GGCAAAAAGGTTATGACAGAAGAACAATATTTGGATTTTGAATCGAGATA
TCATCAGGCCAAATTATCGATATCTGACAGGGCAGCGAAAGTTGCAGCAA
CTCTTGCTACAATTGAACGAGATCTTGATTTATTGTGCCTTACTGGTGTC
GAAGATAAGCTTCAAGAATCTGTAAGACCAACTCTTGAAACTCTCAGAAA
TGCTGGTATTCGGGTGTGGATGTTAACTGGCGATAAATTAGAAACAGCAG
AATCCATTGCCAAATCATCACGATTGGTTTCTCGAAATCAATCTCTTCAT
GTTTTTCAACCGGTAGCAGGTCGAGCAGAAGCCCATCTTGAATTGAATGC
TTTTCGAAAGCGTTCCGATTCTGCTCTTGTAATAACTGGCCAATCATTAC
AAACATGTTTGGAATTTTATGAATACGAGTTCATGCAGCTTGCGATACAA
TGTCCTGCTGTAGTGGTTTGCAGGTGTTCACCCACTCAAAAAGCCGATAT
AGTTCGTTTATTACGAATTCATACAGGATGTAGAATTGCTGCAATTGGTG
ATGGAGGCAATGACGTAAGCATGATTCTTGCTGCAGATGTTGGAATCGGA
ATTGTTGGTAAAGAAGGACGACAAGCATCTCTGGCCTCGGATTTCTCATT
AGTGCAATTTAATCACGTTGCCAAATTGTTCTTAGTACATGGCCGAAATA
CGTATAAAAATACAGCTACCTTGAGTCAATTCGTTATACATAGAGGTATG
ATTATCTCCGTAATGCAAGCGATTTTCTCCGCTATCTTCTACTTTGTTGC
TATTCCTTTGTTTCCCGGATTTCTAATGGTTGGTTATGCTACTGTGTTTA
CTATGTTTCCTGTATTCTCGCTCGTCCTTGATAAAGATGTCACAGACAAA
GTTGCCTTAACATATCCCGAGTTATATAAATCTTTAACCAAGGGTAGAGA
TTTGAATTATAAAACTTTTTTCGTTTGGGTTTTGATTAGTATTTATCAAG
GGGGAATAATTATGTATGGTGCTTTGTTACTGTTCGAGGATGACTTTGTT
CATGTGGTATCAATTACTTTCACATCTCTTGTTCTCACAGAATTACTTAT
GGTCGCACTCACAATTCGAACTTGGCATATTTTGATGTTAATTGCCGAAA
TTGTCAGTTTAGTTATTTATGTCGTATCTCTTATCGTTCTCAAAGATTAT
TTCGATACAGATTTTTTGAAAACGATAAGTTTTGTATGGAAAGTGGCTGC
ACTGACTGCTATTTCTTGTATTCCATTATTCATTCTGAAATACATCCGAT
ATAAGTTACGTCCACCAATTCATACAAAGCTCCAAGATAATTGATGATGA
TCATGATGATTATGTGATTATTATGTGTGATATTTGGTCATAATATTATT
CTGTAGAATTTCTCGCTACCCCTATACATATTTACTGATTTAGAACTTAT
TTTTTTATCCACTGATATCTTTACATTTAAGTGGCATAAGATTGATGTAG
TTGGTGCAAGGTTGGTGTACATTGTGTCAGTTGTCTGTTGTAATTATTTA
TTTTCGGGAAAATAAATCAGATTGATTTGGATTCAAATATTGATAATTTA
TTTTTTGGAGAATCCATGGATTGACATTCTGTCTAAATATTTGTTGTTTT
CATTTTTATACTCGTTTTTAGCATTAACAGAATTCGAGAAATATCTCATT
TTGACTATTGTGAACAATTGCAGTTG
back to top

protein sequence of SMED30035079-orf-1

>SMED30035079-orf-1 ID=SMED30035079-orf-1|Name=SMED30035079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1086bp
MEETALIFDNERNSFHDNFRYKSCNMKDDEEIFFGSNRRLNRFEIFYKYL
CSLPSCCWASCIKKCKRQKEYFARIVTIGRPPRVQKFPSNAIKNQKYNFI
TFIPLVLFEQFSIFLNMLFLVMACSQFIPALKIGYLYTYWGPLGFVVFVT
LCREAVDDIRRWKRDREVNMTQYVKLMKNGDKRTIISSKIEVGDIIIVDK
NQRIPADMVFLQTTEKSGTCFIRTDQLDGETDWKLRIAVPTTQRLETYEM
IFKIQAQIYAEKPNKNIHNFEGCFSRTDEVEAEDPLSVENTLWANTVLAN
GRAVGMVIYTGSETRAVMNSSQPRSKFGLIDREINNLTKLLFVTTVVLSL
IMLILKGFSGSWYKYLWRFFLLFSYIIPLALRVNLDLAKIVAAFIIMRDE
EIPQVIVRTTTIPEELGRISYLMSDKTGTLTQNEMMFKKLHLGTVSYGAD
SMDEIAEQLKSFYESGATMPPVDTKVRKTGAIRVLEAVQAIALCHNVIPV
REIEDENSSPGNSFDIGSGDTILSNLEQTVTYQASSPDEVALVSWTETVG
LTLVNRDLNSMQLRTSNGLLLNYKILQIFPFTSETKRMSIIIKDEQTGEI
SLFMKGADMVMAQMVTFTDWLDEETGNMAREGLRTLVVGKKVMTEEQYLD
FESRYHQAKLSISDRAAKVAATLATIERDLDLLCLTGVEDKLQESVRPTL
ETLRNAGIRVWMLTGDKLETAESIAKSSRLVSRNQSLHVFQPVAGRAEAH
LELNAFRKRSDSALVITGQSLQTCLEFYEYEFMQLAIQCPAVVVCRCSPT
QKADIVRLLRIHTGCRIAAIGDGGNDVSMILAADVGIGIVGKEGRQASLA
SDFSLVQFNHVAKLFLVHGRNTYKNTATLSQFVIHRGMIISVMQAIFSAI
FYFVAIPLFPGFLMVGYATVFTMFPVFSLVLDKDVTDKVALTYPELYKSL
TKGRDLNYKTFFVWVLISIYQGGIIMYGALLLFEDDFVHVVSITFTSLVL
TELLMVALTIRTWHILMLIAEIVSLVIYVVSLIVLKDYFDTDFLKTISFV
WKVAALTAISCIPLFILKYIRYKLRPPIHTKLQDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR006539P-type_ATPase_IV
IPR001757P_typ_ATPase
IPR030355ATP9B
IPR036412HAD-like_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR032630P_typ_ATPase_c
IPR023299ATPase_P-typ_cyto_dom_N
IPR023214HAD_sf
IPR032631P-type_ATPase_N
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR018303ATPase_P-typ_P_site
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0046872metal ion binding
GO:0000287magnesium ion binding
GO:0004012phospholipid-translocating ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005802trans-Golgi network
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0015914phospholipid transport
GO:0045332phospholipid translocation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 423..437
score: 64.24
coord: 706..716
score: 68.41
coord: 820..839
score: 43.39
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 524..613
e-value: 2.4E-10
score: 40.3
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 172..393
e-value: 2.0E-15
score: 56.8
NoneNo IPR availableSFLDSFLDG00002C1.7:_P-type_atpase_likecoord: 404..870
e-value: 0.0
score: 267.6
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 404..870
e-value: 0.0
score: 267.6
NoneNo IPR availableTMHMMTMhelixcoord: 366..385
NoneNo IPR availableTMHMMTMhelixcoord: 987..1006
NoneNo IPR availableTMHMMTMhelixcoord: 961..983
NoneNo IPR availableTMHMMTMhelixcoord: 882..904
NoneNo IPR availableTMHMMTMhelixcoord: 1050..1072
NoneNo IPR availableTMHMMTMhelixcoord: 99..121
NoneNo IPR availableTMHMMTMhelixcoord: 136..156
NoneNo IPR availableTMHMMTMhelixcoord: 1013..1035
NoneNo IPR availableTMHMMTMhelixcoord: 909..931
NoneNo IPR availableTMHMMTMhelixcoord: 340..362
IPR032630P-type ATPase, C-terminalPFAMPF16212PhoLip_ATPase_Ccoord: 849..1076
e-value: 2.5E-48
score: 165.0
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 426..685
e-value: 9.9E-31
score: 108.9
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 429..696
IPR032631P-type ATPase, N-terminalPFAMPF16209PhoLip_ATPase_Ncoord: 85..139
e-value: 3.2E-17
score: 62.0
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 686..860
e-value: 3.0E-50
score: 172.4
IPR006539P-type ATPase, subfamily IVTIGRFAMTIGR01652TIGR01652coord: 87..1083
e-value: 1.3E-293
score: 974.6
IPR006539P-type ATPase, subfamily IVPANTHERPTHR24092FAMILY NOT NAMEDcoord: 47..1083
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 793..902
e-value: 9.7E-28
score: 94.8
coord: 316..455
e-value: 5.4E-23
score: 79.1
IPR030355Probable phospholipid-transporting ATPase IIBPANTHERPTHR24092:SF50PHOSPHOLIPID-TRANSPORTING ATPASE IIB-RELATEDcoord: 47..1083
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 425..431
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 172..315
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 673..868
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 83..1076