Calcium-transporting ATPase

Overview
NameCalcium-transporting ATPase
Smed IDSMED30035069
Length (bp)2908
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium-transporting ATPase (SMED30035069) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30035069) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium-transporting ATPase (SMED30035069) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium-transporting ATPase (SMED30035069) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035069

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035069h1SMcG0022283 dd_Smed_v4_6310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035069h1SMcG0022283 dd_Smed_v4_6310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035069h1SMcG0022283 dd_Smed_v4_6310_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035069h1SMcG0005546 OX_Smed_1.0.04425ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035069h1SMcG0011649 OX_Smed_1.0.04425ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30035069h1SMcG0022283 OX_Smed_1.0.04425ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2C1 (ATPase secretory pathway Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:13211])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 507/901 (56.27%), Postives = 660/901 (73.25%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   20 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 902          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2C1 (ATPase secretory pathway Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:13211])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 507/901 (56.27%), Postives = 660/901 (73.25%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   20 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 902          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2C1 (ATPase secretory pathway Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:13211])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 507/901 (56.27%), Postives = 660/901 (73.25%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   20 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 902          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2C1 (ATPase secretory pathway Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:13211])

HSP 1 Score: 908.286 bits (2346), Expect = 0.000e+0
Identity = 507/901 (56.27%), Postives = 660/901 (73.25%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   20 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 902          
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Match: ATP2C1 (ATPase secretory pathway Ca2+ transporting 1 [Source:HGNC Symbol;Acc:HGNC:13211])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 507/901 (56.27%), Postives = 660/901 (73.25%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:    4 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 886          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: pmr-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EFK9])

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 495/900 (55.00%), Postives = 643/900 (71.44%), Query Frame = 2
Query:   89 IMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEIL--FSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGF-LGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMS-DNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKK 2776
            IM+ +L +   ++      +  L  NL  GL++ EA +R+  +G N+F+  +EEP++ KY  QF+ P+ILLLL SAFVS+ M+Q+DDAISITVA++IVVTV F+QEYRSEK LE L +L+PP  H +RDG+   ++A ELVPGD+V+LN GDRIP+DLR+ E+  L IDESS TGETEP  K    +   S T  D       +T +A+MGTLV  G G+G+V+ T  NS+FGE+ KMM  EE PKTPLQKSMD LGKQLS+YSFG+I +I +IG+ QGR ++ +FTIGVSLAVAAIPEGLPIVV VTLAIG  RMAKR A+VKK+PAVETLGCV VICSDKTGTLTKNEMT   I +  G+ A  TG+GY+ +G V       +  +++ +     +IIE G +CNNA+I +  L GQPTEGA + L  K +L  +   Y RL+E PFSS+TK M V+    A   G+N      +YF+KGA++RVL  C  YY+    +   D    Q   E+G  LG  G+RV+GLA G     ++F G++G++DPP+    ++++IV+ SGV V +ITGDAMETA SI   LGI     D C+SG ++D ++ + +   + +VTVFYR SP+HK  IVK  Q+  ++VAMTGDGVNDA+ALK ADIG+AMG+ GTDVCKEAA ++L DD+F T+  A+EEGKAI+HNI NFVRFQLSTS+AALSLI  ST+F++ NPLN MQILWINI+MDGPPAQSLGVEP D DII+Q PR   + +L  +LI +++ SA  IV+GTL +F +EMS DNKVTPRDTTMTFTCFVLFDM+NALSCRS +K I+ IG   N++F ++V  SL+ Q+LVIY  PLQ IFQTEAL + DL+ L  I SSVF+ +E +K
Sbjct:   77 IMIETLTSEQAASHEVVPCTHQLRTNLEEGLTTAEATRRRQYHGYNEFDVGEEEPIYKKYLEQFQNPLILLLLASAFVSIVMKQYDDAISITVAVVIVVTVGFVQEYRSEKTLEQLTKLVPPTCHVLRDGKEAMMLARELVPGDIVLLNTGDRIPSDLRIAESFSLQIDESSLTGETEPKHKETRSVPAASATGSD----VEHLTCIAFMGTLVCAGRGRGIVISTAANSQFGEVVKMMMGEESPKTPLQKSMDDLGKQLSIYSFGVIAVIFLIGMFQGRNVVDMFTIGVSLAVAAIPEGLPIVVAVTLAIGVMRMAKRRAVVKKMPAVETLGCVTVICSDKTGTLTKNEMTAQAIATPEGKLAEITGIGYSAEGGVVQYQGEQVHQWTHPE---FARIIEAGLVCNNATIEADKLIGQPTEGAIVVLAKKAQLEGVRSEYKRLREMPFSSDTKWMGVQC---ADAHGQN------VYFIKGALDRVLDQCGTYYSSDNQRKQCDQYSRQHILEIGKELGQKGLRVLGLARGESMQSLMFLGMIGMMDPPRPGAADAISIVKASGVDVKLITGDAMETAQSIGQSLGILSSS-DSCLSGQQVDQMSDHDLELVIRQVTVFYRASPRHKLKIVKALQALGEVVAMTGDGVNDAVALKKADIGVAMGVCGTDVCKEAADMILCDDDFSTMTAAIEEGKAIYHNITNFVRFQLSTSVAALSLIAASTMFKFDNPLNAMQILWINIIMDGPPAQSLGVEPVDDDIIRQRPRNTKQPMLTGKLIADILASAAIIVVGTLSVFYKEMSADNKVTPRDTTMTFTCFVLFDMWNALSCRSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITSSVFIFNETRK 959          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: pmr-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EFK9])

HSP 1 Score: 871.307 bits (2250), Expect = 0.000e+0
Identity = 494/899 (54.95%), Postives = 642/899 (71.41%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEIL--FSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGF-LGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMS-DNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKK 2776
            M+ +L +   ++      +  L  NL  GL++ EA +R+  +G N+F+  +EEP++ KY  QF+ P+ILLLL SAFVS+ M+Q+DDAISITVA++IVVTV F+QEYRSEK LE L +L+PP  H +RDG+   ++A ELVPGD+V+LN GDRIP+DLR+ E+  L IDESS TGETEP  K    +   S T  D       +T +A+MGTLV  G G+G+V+ T  NS+FGE+ KMM  EE PKTPLQKSMD LGKQLS+YSFG+I +I +IG+ QGR ++ +FTIGVSLAVAAIPEGLPIVV VTLAIG  RMAKR A+VKK+PAVETLGCV VICSDKTGTLTKNEMT   I +  G+ A  TG+GY+ +G V       +  +++ +     +IIE G +CNNA+I +  L GQPTEGA + L  K +L  +   Y RL+E PFSS+TK M V+    A   G+N      +YF+KGA++RVL  C  YY+    +   D    Q   E+G  LG  G+RV+GLA G     ++F G++G++DPP+    ++++IV+ SGV V +ITGDAMETA SI   LGI     D C+SG ++D ++ + +   + +VTVFYR SP+HK  IVK  Q+  ++VAMTGDGVNDA+ALK ADIG+AMG+ GTDVCKEAA ++L DD+F T+  A+EEGKAI+HNI NFVRFQLSTS+AALSLI  ST+F++ NPLN MQILWINI+MDGPPAQSLGVEP D DII+Q PR   + +L  +LI +++ SA  IV+GTL +F +EMS DNKVTPRDTTMTFTCFVLFDM+NALSCRS +K I+ IG   N++F ++V  SL+ Q+LVIY  PLQ IFQTEAL + DL+ L  I SSVF+ +E +K
Sbjct:    1 MIETLTSEQAASHEVVPCTHQLRTNLEEGLTTAEATRRRQYHGYNEFDVGEEEPIYKKYLEQFQNPLILLLLASAFVSIVMKQYDDAISITVAVVIVVTVGFVQEYRSEKTLEQLTKLVPPTCHVLRDGKEAMMLARELVPGDIVLLNTGDRIPSDLRIAESFSLQIDESSLTGETEPKHKETRSVPAASATGSD----VEHLTCIAFMGTLVCAGRGRGIVISTAANSQFGEVVKMMMGEESPKTPLQKSMDDLGKQLSIYSFGVIAVIFLIGMFQGRNVVDMFTIGVSLAVAAIPEGLPIVVAVTLAIGVMRMAKRRAVVKKMPAVETLGCVTVICSDKTGTLTKNEMTAQAIATPEGKLAEITGIGYSAEGGVVQYQGEQVHQWTHPE---FARIIEAGLVCNNATIEADKLIGQPTEGAIVVLAKKAQLEGVRSEYKRLREMPFSSDTKWMGVQC---ADAHGQN------VYFIKGALDRVLDQCGTYYSSDNQRKQCDQYSRQHILEIGKELGQKGLRVLGLARGESMQSLMFLGMIGMMDPPRPGAADAISIVKASGVDVKLITGDAMETAQSIGQSLGILSSS-DSCLSGQQVDQMSDHDLELVIRQVTVFYRASPRHKLKIVKALQALGEVVAMTGDGVNDAVALKKADIGVAMGVCGTDVCKEAADMILCDDDFSTMTAAIEEGKAIYHNITNFVRFQLSTSVAALSLIAASTMFKFDNPLNAMQILWINIIMDGPPAQSLGVEPVDDDIIRQRPRNTKQPMLTGKLIADILASAAIIVVGTLSVFYKEMSADNKVTPRDTTMTFTCFVLFDMWNALSCRSSRKMIWQIGLRRNRMFSLAVSASLICQLLVIYWAPLQHIFQTEALSLFDLIFLTTITSSVFIFNETRK 882          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: pmr-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:G5EFK9])

HSP 1 Score: 649.818 bits (1675), Expect = 0.000e+0
Identity = 376/713 (52.73%), Postives = 496/713 (69.57%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEIL--FSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGF-LGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSI 2221
            M+ +L +   ++      +  L  NL  GL++ EA +R+  +G N+F+  +EEP++ KY  QF+ P+ILLLL SAFVS+ M+Q+DDAISITVA++IVVTV F+QEYRSEK LE L +L+PP  H +RDG+   ++A ELVPGD+V+LN GDRIP+DLR+ E+  L IDESS TGETEP  K    +   S T  D       +T +A+MGTLV  G G+G+V+ T  NS+FGE+ KMM  EE PKTPLQKSMD LGKQLS+YSFG+I +I +IG+ QGR ++ +FTIGVSLAVAAIPEGLPIVV VTLAIG  RMAKR A+VKK+PAVETLGCV VICSDKTGTLTKNEMT   I +  G+ A  TG+GY+ +G V       +  +++ +     +IIE G +CNNA+I +  L GQPTEGA + L  K +L  +   Y RL+E PFSS+TK M V+    A   G+N      +YF+KGA++RVL  C  YY+    +   D    Q   E+G  LG  G+RV+GLA G     ++F G++G++DPP+    ++++IV+ SGV V +ITGDAMETA SI   LGI     D C+SG ++D ++ + +   + +VTVFYR SP+HK  IVK  Q+  ++VAMTGDGVNDA+ALK ADIG+AMG+ GTDVCKEAA ++L DD+F T+  A+EEGKAI+HNI NFVRFQLST +
Sbjct:    1 MIETLTSEQAASHEVVPCTHQLRTNLEEGLTTAEATRRRQYHGYNEFDVGEEEPIYKKYLEQFQNPLILLLLASAFVSIVMKQYDDAISITVAVVIVVTVGFVQEYRSEKTLEQLTKLVPPTCHVLRDGKEAMMLARELVPGDIVLLNTGDRIPSDLRIAESFSLQIDESSLTGETEPKHKETRSVPAASATGSD----VEHLTCIAFMGTLVCAGRGRGIVISTAANSQFGEVVKMMMGEESPKTPLQKSMDDLGKQLSIYSFGVIAVIFLIGMFQGRNVVDMFTIGVSLAVAAIPEGLPIVVAVTLAIGVMRMAKRRAVVKKMPAVETLGCVTVICSDKTGTLTKNEMTAQAIATPEGKLAEITGIGYSAEGGVVQYQGEQVHQWTHPE---FARIIEAGLVCNNATIEADKLIGQPTEGAIVVLAKKAQLEGVRSEYKRLREMPFSSDTKWMGVQC---ADAHGQN------VYFIKGALDRVLDQCGTYYSSDNQRKQCDQYSRQHILEIGKELGQKGLRVLGLARGESMQSLMFLGMIGMMDPPRPGAADAISIVKASGVDVKLITGDAMETAQSIGQSLGILSSS-DSCLSGQQVDQMSDHDLELVIRQVTVFYRASPRHKLKIVKALQALGEVVAMTGDGVNDAVALKKADIGVAMGVCGTDVCKEAADMILCDDDFSTMTAAIEEGKAIYHNITNFVRFQLSTKL 696          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 377.867 bits (969), Expect = 5.340e-115
Identity = 322/1003 (32.10%), Postives = 491/1003 (48.95%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI-------------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRLFE--TVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS---------LYSFXXXXXXX-XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII---SSAGEN----AFA-TGVGYAPDGEVKIETPNGLRLFSYNDDL-IIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKL----------NDLNLYYTRL--KEWP------FSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGW-------------DPNQMV-------FCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGT----LWIFNREMSDNKVTPRDTT---------------------------MTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            K+ NE+ +        GL+  + +  +  YG N+   ++ + LW     QF + ++ +LLL+A +S  +  F++    T A+   V    I             QE  +E A+EALK+  P     IR G      + A ELVPGD+V ++VGD+IPADLRL +  +  + ID+S  TGE+  V     I  + +  D         N  + GT V  G  +G+V GTG  +E G+I   M   E  KTPLQ+ +D  G+QLS         +++  I        G    +  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M+++ +     ++G+N     FA +G  Y P G+V   + NG  +     +   + ++  I  +CN++S+    T  I    G+ TE A I L  K+ +           +L     R+  ++W       FS + K M       +   G  +       FVKGA E VL  CTH         LT A   +I  +    G+    +  LA G              D  Q V       F GVVG++DPP+  V +S+     +G++V+MITGD   TA +I  ++G+F    D      +G E D +     SE   R  +F R  P HKS IV + QS+ +I AMTGDGVNDA ALK A+IGI+MG  GT V K A+ +VL DDNF +IV A+EEG+AI++N++ F+R+ +S+++  +  I        P  L P+Q+LW+N++ DG PA +LG  P D DI+ + PR   + +++  L    +   T + + T    +W F       ++T    T                           M  +  V  +M NA++  S+ +S+  +    N   + ++ LS+    +++Y   +  IFQ   L   + + ++ I+  V ++ EI K I RN+
Sbjct:    7 KDANEVCKFFGTGP-EGLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSV-----IKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKV---STNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKM-------FVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMG-SGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNY 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Match: sca-1 (Calcium-transporting ATPase [Source:UniProtKB/TrEMBL;Acc:Q9XU13])

HSP 1 Score: 377.867 bits (969), Expect = 5.340e-115
Identity = 322/1003 (32.10%), Postives = 491/1003 (48.95%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI-------------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRLFE--TVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS---------LYSFXXXXXXX-XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII---SSAGEN----AFA-TGVGYAPDGEVKIETPNGLRLFSYNDDL-IIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKL----------NDLNLYYTRL--KEWP------FSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGW-------------DPNQMV-------FCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGT----LWIFNREMSDNKVTPRDTT---------------------------MTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            K+ NE+ +        GL+  + +  +  YG N+   ++ + LW     QF + ++ +LLL+A +S  +  F++    T A+   V    I             QE  +E A+EALK+  P     IR G      + A ELVPGD+V ++VGD+IPADLRL +  +  + ID+S  TGE+  V     I  + +  D         N  + GT V  G  +G+V GTG  +E G+I   M   E  KTPLQ+ +D  G+QLS         +++  I        G    +  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M+++ +     ++G+N     FA +G  Y P G+V   + NG  +     +   + ++  I  +CN++S+    T  I    G+ TE A I L  K+ +           +L     R+  ++W       FS + K M       +   G  +       FVKGA E VL  CTH         LT A   +I  +    G+    +  LA G              D  Q V       F GVVG++DPP+  V +S+     +G++V+MITGD   TA +I  ++G+F    D      +G E D +     SE   R  +F R  P HKS IV + QS+ +I AMTGDGVNDA ALK A+IGI+MG  GT V K A+ +VL DDNF +IV A+EEG+AI++N++ F+R+ +S+++  +  I        P  L P+Q+LW+N++ DG PA +LG  P D DI+ + PR   + +++  L    +   T + + T    +W F       ++T    T                           M  +  V  +M NA++  S+ +S+  +    N   + ++ LS+    +++Y   +  IFQ   L   + + ++ I+  V ++ EI K I RN+
Sbjct:    7 KDANEVCKFFGTGP-EGLTPQQVETLRNKYGENEMPAEEGKSLWELILEQFDDLLVKILLLAAIISFVLALFEEHEDQTEAVTAFVEPFVILLILIANATVGVWQERNAESAIEALKEYEPEMAKVIRSGHHGIQMVRAKELVPGDLVEVSVGDKIPADLRLVKIYSTTIRIDQSILTGESVSV-----IKHTDSVPDPRAVNQDKKNCLFSGTNVASGKARGIVFGTGLTTEIGKIRTEMAETENEKTPLQQKLDEFGEQLSKVISVICVAVWAINIGHFNDPAHGGSWVKGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSKMFIAGQASGDNINFTEFAISGSTYEPVGKV---STNGREINPAAGEFESLTELAMICAMCNDSSVDYNETKKIYEKVGEATETALIVLAEKMNVFGTSKAGLSPKELGGVCNRVIQQKWKKEFTLEFSRDRKSMSAYCFPASGGSGAKM-------FVKGAPEGVLGRCTHVRVNGQKVPLTSAMTQKIVDQCVQYGTGRDTLRCLALGTIDTPVSVSNMNLEDSTQFVKYEQDITFVGVVGMLDPPRTEVSDSIKACNHAGIRVIMITGDNKNTAEAIGRRIGLFGENEDTTGKAYTGREFDDLPPEQQSEACRRAKLFARVEPSHKSKIVDILQSQGEITAMTGDGVNDAPALKKAEIGISMG-SGTAVAKSASEMVLADDNFASIVSAVEEGRAIYNNMKQFIRYLISSNVGEVVSIFMVAALGIPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRHPRSANDGLISGWLFFRYLAVGTYVGVATVGASMWWFLLYEEGPQITYYQLTHWMRCEIEPDNFADLDCAVFEDNHPNAMALSVLVTIEMLNAINSLSENQSLLVMPPWKNIWLMAAISLSMSLHFVILYVDIMATIFQITPLNWVEWIAVLKISLPVLLLDEILKFIARNY 992          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0306600)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 518/906 (57.17%), Postives = 657/906 (72.52%), Query Frame = 2
Query:   80 TPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH-CMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            TP+++L++   S  S  + +E++  L V++  GL   EAK R  + G N+     E+P W KY  QF+ P+ILLLL SA VS+ M+QFDDA+SIT+AI+IVVTVAFIQEYRSEK+LE LK+L+PP+ HC+R+G+    +A ELVPGD+V LNVGDR+PAD+RLFE VDL IDESSFTGETEP  K  ++L + T    H     + N+A+MGTLVRCG+GKG+VV TG+ SEFGE+FKMMQ+EE PKTPLQKSMDILG QLS YSF IIG+I+++G LQG+ L  +F I VSLAVAAIPEGLPIVVTVTLA+G  RMAKRN+IVKKLP VETLGCVNVICSDKTGTLTKNEMT T II+S G  A  TG GY   GE+ I   N + +   N    I  ++EIG +CNNA I +G L GQPTEGA + +  K  +      Y R++E+PFSSE KMM VK   K     E      +I+F KGA+E +L  CT Y        LT    ++   E   +G  G+RV+ LA+G     +++CG+VGI DPP+  V ES+ ++ QSGV+V M+TGDA ETA +IA+ +GI    + H  +SG E+D +  + + +  + V+VFYR SP+HK  IVK  Q    IV MTGDGVND +ALK ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LI  +TL    NPLN MQILWINI+MDGPPAQSLGVEP D D++KQ PR V + ++ + +++NV+LSA+ IV+GTLW+F REM+D  +  T RDTTMTFTCFV FDMFNALSCRSQ KS+FTIG TTN++F+++V  S++GQ+LV+Y PPLQ +FQTEAL   D+  L+++ SSV VVSEIKK  ER
Sbjct:   14 TPEMLLST---SESSTHSASEVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLLGSALVSVIMKQFDDAVSITIAILIVVTVAFIQEYRSEKSLEELKKLVPPECHCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNNTNVKDHS---NMKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMDILGAQLSFYSFLIIGVIMLLGWLQGKPLSEMFNISVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTATIIITSDGYMADVTGAGYNDQGEIHIRHCNNVEMAKTN----ITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAVAMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKE------EIFFAKGALETLLPQCTKYQFGTQTVPLTKQNEAEFLAEAYEIGRKGLRVLALAKGRSMQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGI--DTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPRNVKQPMITKSVVVNVLLSASIIVLGTLWVFQREMADGTLGKTKRDTTMTFTCFVFFDMFNALSCRSQTKSVFTIGLTTNRMFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFFLVSLTSSVLVVSEIKKWFER 901          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0302134)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 518/906 (57.17%), Postives = 657/906 (72.52%), Query Frame = 2
Query:   80 TPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH-CMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            TP+++L++   S  S  + +E++  L V++  GL   EAK R  + G N+     E+P W KY  QF+ P+ILLLL SA VS+ M+QFDDA+SIT+AI+IVVTVAFIQEYRSEK+LE LK+L+PP+ HC+R+G+    +A ELVPGD+V LNVGDR+PAD+RLFE VDL IDESSFTGETEP  K  ++L + T    H     + N+A+MGTLVRCG+GKG+VV TG+ SEFGE+FKMMQ+EE PKTPLQKSMDILG QLS YSF IIG+I+++G LQG+ L  +F I VSLAVAAIPEGLPIVVTVTLA+G  RMAKRN+IVKKLP VETLGCVNVICSDKTGTLTKNEMT T II+S G  A  TG GY   GE+ I   N + +   N    I  ++EIG +CNNA I +G L GQPTEGA + +  K  +      Y R++E+PFSSE KMM VK   K     E      +I+F KGA+E +L  CT Y        LT    ++   E   +G  G+RV+ LA+G     +++CG+VGI DPP+  V ES+ ++ QSGV+V M+TGDA ETA +IA+ +GI    + H  +SG E+D +  + + +  + V+VFYR SP+HK  IVK  Q    IV MTGDGVND +ALK ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LI  +TL    NPLN MQILWINI+MDGPPAQSLGVEP D D++KQ PR V + ++ + +++NV+LSA+ IV+GTLW+F REM+D  +  T RDTTMTFTCFV FDMFNALSCRSQ KS+FTIG TTN++F+++V  S++GQ+LV+Y PPLQ +FQTEAL   D+  L+++ SSV VVSEIKK  ER
Sbjct:   14 TPEMLLST---SESSTHSASEVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLLGSALVSVIMKQFDDAVSITIAILIVVTVAFIQEYRSEKSLEELKKLVPPECHCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNNTNVKDHS---NMKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMDILGAQLSFYSFLIIGVIMLLGWLQGKPLSEMFNISVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTATIIITSDGYMADVTGAGYNDQGEIHIRHCNNVEMAKTN----ITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAVAMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKE------EIFFAKGALETLLPQCTKYQFGTQTVPLTKQNEAEFLAEAYEIGRKGLRVLALAKGRSMQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGI--DTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPRNVKQPMITKSVVVNVLLSASIIVLGTLWVFQREMADGTLGKTKRDTTMTFTCFVFFDMFNALSCRSQTKSVFTIGLTTNRMFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFFLVSLTSSVLVVSEIKKWFER 901          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0113437)

HSP 1 Score: 914.835 bits (2363), Expect = 0.000e+0
Identity = 521/915 (56.94%), Postives = 660/915 (72.13%), Query Frame = 2
Query:   68 NTDQT-----PKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH-CMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            N DQT     P+++L++   S  S  + +E++  L V++  GL   EAK R  + G N+     E+P W KY  QF+ P+ILLLL SA VS+ M+QFDDA+SIT+AI+IVVTVAFIQEYRSEK+LE LK+L+PP+ HC+R+G+    +A ELVPGD+V LNVGDR+PAD+RLFE VDL IDESSFTGETEP  K  ++L + T    H     + N+A+MGTLVRCG+GKG+VV TG+ SEFGE+FKMMQ+EE PKTPLQKSMDILG QLS YSF IIG+I+++G LQG+ L  +F I VSLAVAAIPEGLPIVVTVTLA+G  RMAKRN+IVKKLP VETLGCVNVICSDKTGTLTKNEMT T II+S G  A  TG GY   GE+ I   N + +   N    I  ++EIG +CNNA I +G L GQPTEGA + +  K  +      Y R++E+PFSSE KMM VK   K     E      +I+F KGA+E +L  CT Y        LT    ++   E   +G  G+RV+ LA+G     +++CG+VGI DPP+  V ES+ ++ QSGV+V M+TGDA ETA +IA+ +GI    + H  +SG E+D +  + + +  + V+VFYR SP+HK  IVK  Q    IV MTGDGVND +ALK ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LI  +TL    NPLN MQILWINI+MDGPPAQSLGVEP D D++KQ PR V + ++ + +++NV+LSA+ IV+GTLW+F REM+D  +  T RDTTMTFTCFV FDMFNALSCRSQ KS+FTIG TTN++F+++V  S++GQ+LV+Y PPLQ +FQTEAL   D+  L+++ SSV VVSEIKK  ER
Sbjct:   85 NVDQTGLTLTPEMLLST---SESSTHSASEVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLLGSALVSVIMKQFDDAVSITIAILIVVTVAFIQEYRSEKSLEELKKLVPPECHCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNNTNVKDHS---NMKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMDILGAQLSFYSFLIIGVIMLLGWLQGKPLSEMFNISVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTATIIITSDGYMADVTGAGYNDQGEIHIRHCNNVEMAKTN----ITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAVAMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKE------EIFFAKGALETLLPQCTKYQFGTQTVPLTKQNEAEFLAEAYEIGRKGLRVLALAKGRSMQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGI--DTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPRNVKQPMITKSVVVNVLLSASIIVLGTLWVFQREMADGTLGKTKRDTTMTFTCFVFFDMFNALSCRSQTKSVFTIGLTTNRMFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFFLVSLTSSVLVVSEIKKWFER 981          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0474170)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 520/922 (56.40%), Postives = 659/922 (71.48%), Query Frame = 2
Query:  104 LKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH-CMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERN---HFYQVNILLRYLLRNHSQKK 2851
            L  S  S  + +E++  L V++  GL   EAK R  + G N+     E+P W KY  QF+ P+ILLLL SA VS+ M+QFDDA+SIT+AI+IVVTVAFIQEYRSEK+LE LK+L+PP+ HC+R+G+    +A ELVPGD+V LNVGDR+PAD+RLFE VDL IDESSFTGETEP  K  ++L + T    H     + N+A+MGTLVRCG+GKG+VV TG+ SEFGE+FKMMQ+EE PKTPLQKSMDILG QLS YSF IIG+I+++G LQG+ L  +F I VSLAVAAIPEGLPIVVTVTLA+G  RMAKRN+IVKKLP VETLGCVNVICSDKTGTLTKNEMT T II+S G  A  TG GY   GE+ I   N + +   N    I  ++EIG +CNNA I +G L GQPTEGA + +  K  +      Y R++E+PFSSE KMM VK   K     E      +I+F KGA+E +L  CT Y        LT    ++   E   +G  G+RV+ LA+G     +++CG+VGI DPP+  V ES+ ++ QSGV+V M+TGDA ETA +IA+ +GI    + H  +SG E+D +  + + +  + V+VFYR SP+HK  IVK  Q    IV MTGDGVND +ALK ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LI  +TL    NPLN MQILWINI+MDGPPAQSLGVEP D D++KQ PR V + ++ + +++NV+LSA+ IV+GTLW+F REM+D  +  T RDTTMTFTCFV FDMFNALSCRSQ KS+FTIG TTN++F+++V  S++GQ+LV+Y PPLQ +FQTEAL   D+  L+++ SSV VVSEIKK  ER      Y     L ++ +N S ++
Sbjct:    3 LSTSESSTHSASEVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLLGSALVSVIMKQFDDAVSITIAILIVVTVAFIQEYRSEKSLEELKKLVPPECHCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNNTNVKDHS---NMKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMDILGAQLSFYSFLIIGVIMLLGWLQGKPLSEMFNISVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTATIIITSDGYMADVTGAGYNDQGEIHIRHCNNVEMAKTN----ITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAVAMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKE------EIFFAKGALETLLPQCTKYQFGTQTVPLTKQNEAEFLAEAYEIGRKGLRVLALAKGRSMQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGI--DTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPRNVKQPMITKSVVVNVLLSASIIVLGTLWVFQREMADGTLGKTKRDTTMTFTCFVFFDMFNALSCRSQTKSVFTIGLTTNRMFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFFLVSLTSSVLVVSEIKKWFERTMERKMYSTRSELDFVXQNASARE 909          
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Match: SPoCk (gene:FBgn0052451 transcript:FBtr0078532)

HSP 1 Score: 914.45 bits (2362), Expect = 0.000e+0
Identity = 518/906 (57.17%), Postives = 657/906 (72.52%), Query Frame = 2
Query:   80 TPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH-CMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            TP+++L++   S  S  + +E++  L V++  GL   EAK R  + G N+     E+P W KY  QF+ P+ILLLL SA VS+ M+QFDDA+SIT+AI+IVVTVAFIQEYRSEK+LE LK+L+PP+ HC+R+G+    +A ELVPGD+V LNVGDR+PAD+RLFE VDL IDESSFTGETEP  K  ++L + T    H     + N+A+MGTLVRCG+GKG+VV TG+ SEFGE+FKMMQ+EE PKTPLQKSMDILG QLS YSF IIG+I+++G LQG+ L  +F I VSLAVAAIPEGLPIVVTVTLA+G  RMAKRN+IVKKLP VETLGCVNVICSDKTGTLTKNEMT T II+S G  A  TG GY   GE+ I   N + +   N    I  ++EIG +CNNA I +G L GQPTEGA + +  K  +      Y R++E+PFSSE KMM VK   K     E      +I+F KGA+E +L  CT Y        LT    ++   E   +G  G+RV+ LA+G     +++CG+VGI DPP+  V ES+ ++ QSGV+V M+TGDA ETA +IA+ +GI    + H  +SG E+D +  + + +  + V+VFYR SP+HK  IVK  Q    IV MTGDGVND +ALK ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LI  +TL    NPLN MQILWINI+MDGPPAQSLGVEP D D++KQ PR V + ++ + +++NV+LSA+ IV+GTLW+F REM+D  +  T RDTTMTFTCFV FDMFNALSCRSQ KS+FTIG TTN++F+++V  S++GQ+LV+Y PPLQ +FQTEAL   D+  L+++ SSV VVSEIKK  ER
Sbjct:   21 TPEMLLST---SESSTHSASEVAGRLQVDVRTGLKWTEAKYRAKIIGHNELLLVAEDPTWKKYIEQFRNPLILLLLGSALVSVIMKQFDDAVSITIAILIVVTVAFIQEYRSEKSLEELKKLVPPECHCLREGRLDTFLARELVPGDIVHLNVGDRVPADVRLFEAVDLSIDESSFTGETEPARKITDVLLNNTNVKDHS---NMKNIAFMGTLVRCGNGKGIVVSTGERSEFGEVFKMMQAEEAPKTPLQKSMDILGAQLSFYSFLIIGVIMLLGWLQGKPLSEMFNISVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNSIVKKLPTVETLGCVNVICSDKTGTLTKNEMTATIIITSDGYMADVTGAGYNDQGEIHIRHCNNVEMAKTN----ITNLLEIGAVCNNAYIQNGTLLGQPTEGALVAVAMKNGMYATAENYVRIQEYPFSSEQKMMAVKCIHKYNNNKE------EIFFAKGALETLLPQCTKYQFGTQTVPLTKQNEAEFLAEAYEIGRKGLRVLALAKGRSMQDLIYCGLVGITDPPRPLVRESIEMLMQSGVRVKMVTGDAQETALAIANLIGI--DTIHHQTLSGQEMDQMNEHQLDKVANNVSVFYRVSPRHKLEIVKSLQRSGNIVGMTGDGVNDGVALKKADIGIAMGKNGTDVCKEAADMILVNDDFHTIIAAIEEGKGIFYNIRNFVRFQLSTSIAALALIALATLMDIANPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLKQKPRNVKQPMITKSVVVNVLLSASIIVLGTLWVFQREMADGTLGKTKRDTTMTFTCFVFFDMFNALSCRSQTKSVFTIGLTTNRMFLLAVAFSIIGQMLVVYFPPLQMVFQTEALTPYDIFFLVSLTSSVLVVSEIKKWFER 908          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 514/911 (56.42%), Postives = 673/911 (73.87%), Query Frame = 2
Query:   68 NTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKI--ETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVK--YQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            + D+T   +LTS KAS +     NE++  L  +L  GL+  E ++R+  +G N+F+  ++EPLW KY  QFK+P+ILLLL SA +S+ MRQFDDA+SITVAIIIVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G    ++A ELVPGD V L+VG+R+PADLRLFE+ DL +DESS TGET P  KT+    + T  D    +    N+A+MGTLVRCG  KG+V+GTG++SEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLSLYS GIIG+I+ +G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETL C NVICSDKTGTLTKNEMT+T++ +S G++A  TG+GY   GE+ +  E  +G+   S      I KI+E+GC+CN+A I    L G+PTEGA I L  K+ L  L   + RL+E PF+SE K M V+  ++T+  + G        +++VKGA E+V+  CT Y +      L + +    +Q+  ++GS G+RV+  A G +   + F G+VGIIDPP+  V+E+VA +  SGV V M+TGD+ ETA +IAS+LG++  G   C+SGDE+D +    +S+ + RV VFYR SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +P PLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR V +SI+ R LI+ +++SA  IV GTL++F RE+ DN++TPRDTTMTFTCFV FDMFNALS RSQ + +  +G  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLLLL  + SSV VVSEI K IER
Sbjct:   16 SKDETMVPVLTSKKASELP---VNEVACALQADLQFGLNREEVERRRTYHGWNEFDISEDEPLWKKYLSQFKDPLILLLLSSAVISVLMRQFDDAVSITVAIIIVVTVAFVQEYRSEKSLEELGKLVPPECHCIREGHLEHLLARELVPGDTVCLSVGERVPADLRLFESTDLAVDESSLTGETTPCTKTSAPQPAATNGDIASRS----NIAFMGTLVRCGKAKGIVIGTGEDSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSLYSLGIIGVIMFVGWLQGKYILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLSCCNVICSDKTGTLTKNEMTVTHLFTSDGQHAEVTGIGYNNSGEILMDGEVVHGISNTS------ISKIVEVGCVCNDAMIRHNTLMGRPTEGALIALAMKMGLEGLQHEFVRLEEIPFTSEQKWMAVRVVHRTQRDKPG--------LFYVKGAYEQVIRFCTSYNSKGVTMPLNNQQRDFYQQQKSYMGSGGLRVLAFASGSEMGSLTFLGLVGIIDPPRAGVKEAVATLISSGVAVKMVTGDSEETAVAIASRLGLYTKG-SQCLSGDEVDQMDIQHLSQIVHRVVVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTILSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLLNFPTPLNAMQILWINIIMDGPPAQSLGVEPVDWDVIRKPPRNVRDSIITRSLIVKILVSAFIIVCGTLFVFWRELRDNEITPRDTTMTFTCFVFFDMFNALSSRSQTRMVHEMGLCSNRMFCYAVLGSIMGQLLVIYFPPLQSVFQTESLSILDLLLLFGLTSSVCVVSEIIKKIER 904          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 514/909 (56.55%), Postives = 672/909 (73.93%), Query Frame = 2
Query:   74 DQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKI--ETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVK--YQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            D+T   +LTS KAS +     NE++  L  +L  GL+  E ++R+  +G N+F+  ++EPLW KY  QFK+P+ILLLL SA +S+ MRQFDDA+SITVAIIIVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G    ++A ELVPGD V L+VG+R+PADLRLFE+ DL +DESS TGET P  KT+    + T  D    +    N+A+MGTLVRCG  KG+V+GTG++SEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLSLYS GIIG+I+ +G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETL C NVICSDKTGTLTKNEMT+T++ +S G++A  TG+GY   GE+ +  E  +G+   S      I KI+E+GC+CN+A I    L G+PTEGA I L  K+ L  L   + RL+E PF+SE K M V+  ++T+  + G        +++VKGA E+V+  CT Y +      L + +    +Q+  ++GS G+RV+  A G +   + F G+VGIIDPP+  V+E+VA +  SGV V M+TGD+ ETA +IAS+LG++  G   C+SGDE+D +    +S+ + RV VFYR SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +P PLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR V +SI+ R LI+ +++SA  IV GTL++F RE+ DN++TPRDTTMTFTCFV FDMFNALS RSQ + +  +G  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLLLL  + SSV VVSEI K IER
Sbjct:   18 DETMVPVLTSKKASELP---VNEVACALQADLQFGLNREEVERRRTYHGWNEFDISEDEPLWKKYLSQFKDPLILLLLSSAVISVLMRQFDDAVSITVAIIIVVTVAFVQEYRSEKSLEELGKLVPPECHCIREGHLEHLLARELVPGDTVCLSVGERVPADLRLFESTDLAVDESSLTGETTPCTKTSAPQPAATNGDIASRS----NIAFMGTLVRCGKAKGIVIGTGEDSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSLYSLGIIGVIMFVGWLQGKYILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLSCCNVICSDKTGTLTKNEMTVTHLFTSDGQHAEVTGIGYNNSGEILMDGEVVHGISNTS------ISKIVEVGCVCNDAMIRHNTLMGRPTEGALIALAMKMGLEGLQHEFVRLEEIPFTSEQKWMAVRVVHRTQRDKPG--------LFYVKGAYEQVIRFCTSYNSKGVTMPLNNQQRDFYQQQKSYMGSGGLRVLAFASGSEMGSLTFLGLVGIIDPPRAGVKEAVATLISSGVAVKMVTGDSEETAVAIASRLGLYTKG-SQCLSGDEVDQMDIQHLSQIVHRVVVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTILSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLLNFPTPLNAMQILWINIIMDGPPAQSLGVEPVDWDVIRKPPRNVRDSIITRSLIVKILVSAFIIVCGTLFVFWRELRDNEITPRDTTMTFTCFVFFDMFNALSSRSQTRMVHEMGLCSNRMFCYAVLGSIMGQLLVIYFPPLQSVFQTESLSILDLLLLFGLTSSVCVVSEIIKKIER 904          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 397.127 bits (1019), Expect = 4.910e-122
Identity = 336/1002 (33.53%), Postives = 504/1002 (50.30%), Query Frame = 2
Query:  119 ISNKNTNEISELLH---VNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQTMA--IMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXXXXXXXXX---------XXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII-------SSAGENAFA-TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKL--NDL------------NLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSS--GMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLW-IFNRE------------MSDNKVTP-------------RDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            + N +T   SE+L    VN   GL+  + K     YGPN+   ++ + LW     QF++ ++ +LLL+A VS  +  F++    T A +  + +  I          QE  +E A+EALK+  P      R  +T    I A ++VPGD+V ++VGD++PAD+R+   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG ++E G+I   M + E  KTPLQ+ +D  G+QLS + S   I + VI               R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +        SS   + F  +G  YAP+GEV ++    ++   Y D L+  ++  I  LCN++S+      G+    G+ TE A  TL  K+ +   DL            NL   +L +  F+ E            T  G N        FVKGA E V+  C           LT A   ++   +   G+    +R + LA    P                  + + F G VG++DPP+  V  S+ +  ++G++V+MITGD   TA +I  ++GIF    D      +G E D +A     E + R   F R  P HKS IV   QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL+DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  + +   P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R L I   +    +   T W +F+ +            M   +  P               TTM  +  V  +MFNAL+  S+ +S+  +    N   + ++ LSL    L+++  PL  IFQ   L+ S  +++  I+  V ++ E  K I R+H 
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEV-LKADKQVQCGDY-DGLV--ELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTPNGTN---SQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHHL 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a3 (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3 [Source:ZFIN;Acc:ZDB-GENE-060531-103])

HSP 1 Score: 396.741 bits (1018), Expect = 6.230e-122
Identity = 336/1002 (33.53%), Postives = 504/1002 (50.30%), Query Frame = 2
Query:  119 ISNKNTNEISELLH---VNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQTMA--IMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXXXXXXXXX---------XXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII-------SSAGENAFA-TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKL--NDL------------NLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSS--GMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLW-IFNRE------------MSDNKVTP-------------RDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            + N +T   SE+L    VN   GL+  + K     YGPN+   ++ + LW     QF++ ++ +LLL+A VS  +  F++    T A +  + +  I          QE  +E A+EALK+  P      R  +T    I A ++VPGD+V ++VGD++PAD+R+   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG ++E G+I   M + E  KTPLQ+ +D  G+QLS + S   I + VI               R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +        SS   + F  +G  YAP+GEV ++    ++   Y D L+  ++  I  LCN++S+      G+    G+ TE A  TL  K+ +   DL            NL   +L +  F+ E            T  G N        FVKGA E V+  C           LT A   ++   +   G+    +R + LA    P                  + + F G VG++DPP+  V  S+ +  ++G++V+MITGD   TA +I  ++GIF    D      +G E D +A     E + R   F R  P HKS IV   QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL+DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  + +   P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R L I   +    +   T W +F+ +            M   +  P               TTM  +  V  +MFNAL+  S+ +S+  +    N   + ++ LSL    L+++  PL  IFQ   L+ S  +++  I+  V ++ E  K I R+H 
Sbjct:    1 MENAHTKSASEVLANFGVNENTGLTLEQVKNNFDKYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPIVILLILVANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRTAVQRIKARDIVPGDIVEISVGDKVPADIRITSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGRAIGVVVSTGVSTEIGKIRNQMAATEQEKTPLQQKLDEFGQQLSKVISLICIAVWVINIGHFADPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKADDSSCSLHEFTISGSTYAPEGEV-LKADKQVQCGDY-DGLV--ELATICSLCNDSSLDYNEAKGVYEKVGEATETALTTLVEKMNVFKTDLSGLSKVDRAAACNLIIRQLMQKKFTLEFSRDRKSMSVYCTPNGTN---SQSKMFVKGAPEGVIDRCQFVRVGKERFPLTMAVKEELMSTIRDWGTGRDTLRCLALATRDSPPAVDKMDLENAGKFAEYESSLTFVGCVGMLDPPRKEVIGSIKLCNKAGIRVIMITGDNKGTAVAICRRIGIFSENEDVEGRAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVAYLQSFDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVSAATWWYLFDEDGPQVSFYQLRHFMQCTEENPMFEGINCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILHVEPLPLIFQVTPLHFSQWIIVFKISIPVILLDEALKYISRHHL 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Match: atp2a2b (ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2b [Source:ZFIN;Acc:ZDB-GENE-030131-867])

HSP 1 Score: 392.119 bits (1006), Expect = 8.139e-120
Identity = 333/1003 (33.20%), Postives = 500/1003 (49.85%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIR-DGQTMA-IMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXX---------XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITN--IISSAGENAFA------TGVGYAPDGEVKIE-TPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKV--------------KLNDLNLYYTRL--KEW--PFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDA---KISQIKQEVGFLGSSGMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATC----------------------IVIGTLWIFNREMSDNKV----------TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            K   E+     VN   GL   + K+++  +GPN+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R D +T+  I A ++VPGD+V + VGD++PAD+RL   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG N+E G+I   M S E  +TPLQ+ +D  G+QLS + S   I + +         + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++    I+  A  N  +      +G  YAPDG+V  E  P     F   D L+  ++  I  LCN++S+      G+    G+ TE A   L  K+              + N  N    +L  KE+   FS + K M V             +F      VKGA E V+  CTH         +T     KI  + +E G  G   +R + LA   +P                    + F G VG++DPP+  V  S+ + +Q+G++V+MITGD   TA +I  ++GIF    D      +G E D +++    E +     F R  P HKS IV+  QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  +    +P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++  L     L+  C                      +    L  F +   DN            +P   TM  +  V  +M NAL+  S+ +S+  +    N   + ++ LS+    L++Y  PL  IFQ   L ++  L+++ I+  V ++ E+ K   RN+ 
Sbjct:    7 KTVEEVYSFFAVNESTGLGLEQVKRQREKWGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKTVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMASTEQERTPLQQKLDEFGQQLSKVISLICIAVWIINIGHFNDPVHGGSWVRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDQANGNTCSLKEFSISGSTYAPDGQVCHEGKPVQCSKF---DALV--EMASICALCNDSSLDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSMGKMF------VKGAPEGVIDRCTHIRVGGNKVPMTPGIKEKIMSVIREYG-TGRDTLRCLALATRDNPLSKESLVLEDSTRFVEYETDLTFVGCVGMLDPPRAEVAASIKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGENDDVSRMAYTGREFDDLSAAAQREAVLTARCFARVEPSHKSKIVEFLQSYDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMSKPPRNAREPLISGWLFFR-YLAIGCYVGAATVGAAAWWFIAAEDGPRVTFYQLSHFLQCAPDNPEFEGLQCEIFGSPYPMTMALSVLVTIEMCNALNSVSENQSLLHMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNVTQWLMVLKISLPVILLDEVLKFAARNYL 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2C1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:NCBI gene;Acc:100487845])

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 514/911 (56.42%), Postives = 674/911 (73.98%), Query Frame = 2
Query:   62 MSNTDQTPKI-MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERN 2791
            ++NT+    I +L+S KAS +     +E++ +L  +L  GL++ E   R+  +G N+F+  + EPLW KY  QFK P+++LLL SA +S+ M+QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G+    +A +LVPGD V L VGDR+PADLRLFE +DL +DESS TGET P  K+       +  D    +    N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMDILGKQLSLYSFGIIG+I+++G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV     +G  +  + +   I K+IE GC+CN+A I +  L G+PTEGA I L  K+ L  L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +     QE  ++G++G+RVI LA G +  Q+ F G+VG+IDPP+  V+E+V+ + +SGV + MITGD+ ETA +IAS+LG +  GL   +SG+++D++    +S+ + +V+VFYR SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR + +SIL + LI+ ++LS+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DL+ LI + SSV +VSEI K +ER+
Sbjct:   53 LTNTENDTMIPVLSSKKASELP---VSEVAWILKADLQSGLNNPEVCHRRAAHGWNEFDISEGEPLWKKYIEQFKNPLLMLLLASAVISILMQQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCIREGRMEHTLARDLVPGDTVCLTVGDRVPADLRLFEAMDLSVDESSLTGETAPCAKSTAPQPCASNGDLTSRS----NIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDILGKQLSLYSFGIIGVIMLVGWLQGKHILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNRFGEV---IHDGEIIHGFCNP-SISKVIEAGCVCNDAEIRNNTLMGKPTEGALIALSMKMGLEALRHDYIRRAEYPFSSEQKWMAVKCVHRTQQD------KPEICFMKGAYEQVIKYCTTYNSKGQTFPLTQQQRELYLQETAYMGTAGLRVIALASGPELGQLTFLGLVGMIDPPRTGVKEAVSTLIRSGVAIKMITGDSQETAVAIASRLGFYSKGL-QSLSGEDVDMMDIQQLSQMVSKVSVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGIAMGKTGTDVCKEAADMILVEDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNLKDSILTKNLIVKILLSSIIIVCGTLFVFWRELRDNLITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSIQDLVFLIGLTSSVCIVSEIIKKLERS 945          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2C1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:NCBI gene;Acc:100487845])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 498/881 (56.53%), Postives = 652/881 (74.01%), Query Frame = 2
Query:   62 MSNTDQTPKI-MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTE 2701
            ++NT+    I +L+S KAS +     +E++ +L  +L  GL++ E   R+  +G N+F+  + EPLW KY  QFK P+++LLL SA +S+ M+QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G+    +A +LVPGD V L VGDR+PADLRLFE +DL +DESS TGET P  K+       +  D    +    N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMDILGKQLSLYSFGIIG+I+++G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV     +G  +  + +   I K+IE GC+CN+A I +  L G+PTEGA I L  K+ L  L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +     QE  ++G++G+RVI LA G +  Q+ F G+VG+IDPP+  V+E+V+ + +SGV + MITGD+ ETA +IAS+LG +  GL   +SG+++D++    +S+ + +V+VFYR SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR + +SIL + LI+ ++LS+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE
Sbjct:   53 LTNTENDTMIPVLSSKKASELP---VSEVAWILKADLQSGLNNPEVCHRRAAHGWNEFDISEGEPLWKKYIEQFKNPLLMLLLASAVISILMQQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCIREGRMEHTLARDLVPGDTVCLTVGDRVPADLRLFEAMDLSVDESSLTGETAPCAKSTAPQPCASNGDLTSRS----NIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDILGKQLSLYSFGIIGVIMLVGWLQGKHILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNRFGEV---IHDGEIIHGFCNP-SISKVIEAGCVCNDAEIRNNTLMGKPTEGALIALSMKMGLEALRHDYIRRAEYPFSSEQKWMAVKCVHRTQQD------KPEICFMKGAYEQVIKYCTTYNSKGQTFPLTQQQRELYLQETAYMGTAGLRVIALASGPELGQLTFLGLVGMIDPPRTGVKEAVSTLIRSGVAIKMITGDSQETAVAIASRLGFYSKGL-QSLSGEDVDMMDIQQLSQMVSKVSVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGIAMGKTGTDVCKEAADMILVEDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNLKDSILTKNLIVKILLSSIIIVCGTLFVFWRELRDNLITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTE 915          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2C1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:NCBI gene;Acc:100487845])

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 487/881 (55.28%), Postives = 639/881 (72.53%), Query Frame = 2
Query:   62 MSNTDQTPKI-MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTE 2701
            ++NT+    I +L+S KAS +     +E++ +L  +L  GL++ E   R+  +G N+F+  + EPLW KY  QFK P+++LLL SA +S+ M+QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G+    +A +LVPGD V L VGDR+PADLRLFE +DL +DESS TGET P  K+       +  D    +    N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMDILGKQLSLYSFGIIG+I+++G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A           EV I     ++ +               C+CN+A I +  L G+PTEGA I L  K+ L  L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +     QE  ++G++G+RVI LA G +  Q+ F G+VG+IDPP+  V+E+V+ + +SGV + MITGD+ ETA +IAS+LG +  GL   +SG+++D++    +S+ + +V+VFYR SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR + +SIL + LI+ ++LS+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE
Sbjct:    9 LTNTENDTMIPVLSSKKASELP---VSEVAWILKADLQSGLNNPEVCHRRAAHGWNEFDISEGEPLWKKYIEQFKNPLLMLLLASAVISILMQQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCIREGRMEHTLARDLVPGDTVCLTVGDRVPADLRLFEAMDLSVDESSLTGETAPCAKSTAPQPCASNGDLTSRS----NIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDILGKQLSLYSFGIIGVIMLVGWLQGKHILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHA-----------EV-ISCHCHVKKYR--------------CVCNDAEIRNNTLMGKPTEGALIALSMKMGLEALRHDYIRRAEYPFSSEQKWMAVKCVHRTQQD------KPEICFMKGAYEQVIKYCTTYNSKGQTFPLTQQQRELYLQETAYMGTAGLRVIALASGPELGQLTFLGLVGMIDPPRTGVKEAVSTLIRSGVAIKMITGDSQETAVAIASRLGFYSKGL-QSLSGEDVDMMDIQQLSQMVSKVSVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGIAMGKTGTDVCKEAADMILVEDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNLKDSILTKNLIVKILLSSIIIVCGTLFVFWRELRDNLITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTE 849          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: ATP2C1 (ATPase, Ca++ transporting, type 2C, member 1 [Source:NCBI gene;Acc:100487845])

HSP 1 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 490/898 (54.57%), Postives = 635/898 (70.71%), Query Frame = 2
Query:   11 TIFNFNEFYILYCYLI*MSNTDQTPKI-MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTE 2701
            ++F  N FY+       ++NT+    I +L+S KAS +     +E++ +L  +L  GL++ E   R+  +G N+F+  + EPLW KY  QFK P+++LLL SA +S+ M+QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G+    +A +LVPGD V L VGDR+PADLRLFE +DL +DESS TGET P  K+       +  D        +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMDILGKQLSLYSFGIIG+I+++G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV     +G  +  + +   I K+IE GC+CN+A I +  L G+PTEGA I L  K+ L  L   Y R  E+PFSSE K M VK   +          Q +I F+KGA E+V+  CT Y +      LT  +     QE  ++G++G+RVI LA G +  Q+ F G+VG+IDPP+  V+E+V+ + +SGV + MITGD+ ETA +I                G E   + +               +SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIGIAMG  GTDVCKEAA ++L +D+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR + +SIL + LI+ ++LS+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE
Sbjct:   15 SLFFPNSFYMQASRFQQLTNTENDTMIPVLSSKKASELP---VSEVAWILKADLQSGLNNPEVCHRRAAHGWNEFDISEGEPLWKKYIEQFKNPLLMLLLASAVISILMQQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCIREGRMEHTLARDLVPGDTVCLTVGDRVPADLRLFEAMDLSVDESSLTGETAPCAKSTAPQPCASNGDLTSR----SNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDILGKQLSLYSFGIIGVIMLVGWLQGKHILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNRFGEV---IHDGEIIHGFCNP-SISKVIEAGCVCNDAEIRNNTLMGKPTEGALIALSMKMGLEALRHDYIRRAEYPFSSEQKWMAVKCVHRTQ--------QPEICFMKGAYEQVIKYCTTYNSKGQTFPLTQQQRELYLQETAYMGTAGLRVIALASGPELGQLTFLGLVGMIDPPRTGVKEAVSTLIRSGVAIKMITGDSQETAVAI----------------GKEQKYIVN---------------SSPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGIAMGKTGTDVCKEAADMILVEDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNLKDSILTKNLIVKILLSSIIIVCGTLFVFWRELRDNLITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTE 862          
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Match: atp2c2 (ATPase, Ca++ transporting, type 2C, member 2 [Source:NCBI gene;Acc:779979])

HSP 1 Score: 857.825 bits (2215), Expect = 0.000e+0
Identity = 506/896 (56.47%), Postives = 648/896 (72.32%), Query Frame = 2
Query:  104 LKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERN 2791
            L A   S  N NE+ + L V++  GLS     QR++ +  N+F+ D  +P+W KY  QF  P+ILLLL SA VS+  ++++DA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ +CIRDG+   ++A ELVPGDVV L+VGDR+PAD+RL ET DL +DESSFTGETEP  KT          D       ++N+ +MGTLVR G GKG+V+G G+ S+FGE+FKMMQ+EE PKTPLQKSMD LGKQLSL+SFGIIGLI++IG LQG+ L+++FTIGVSLAVAAIPEGLPIVVTVTLA+G  RMA +  IVKKLP VETLGC NVICSDKTGTLT NEMT T +++S G +A  TGVGY   G V +  P+   +  ++  + I K++E GC+ NNA I +  L GQPTEGA + LG K+ L++++  Y R KE PFSSE + M VK   +          +++IYF+KGA E V+  CT Y +      +T  + S   QE   +G  G+RV+ LA G +  ++ F G+VGIIDPP+  V E+V I+ +SGV V MITGDA+ETA +I   +G+   G    +SG+ELD +  + +S  + +V+VFYRTSPKHK  I+K  Q    IV MTGDGVNDA+ALKSADIG+AMG  GTDV KEAA ++L DD+F TI++A+EEGK IF+NI+NFVRFQLSTSI+ALSLIT ST+   PNPLN MQILWINI+MDGPPAQSLGVEP D D IKQPPR   E+IL+R LI+ ++LSAT I+ GTL++F +E+ D KVTPR TTMTFTCFV FDMFNAL+CRS  K+IF IG   N++F  SV  S++GQ+ VIY PPLQ +F T+ L+  DLL L  +ASSVFV SE+ K  E++
Sbjct:  125 LPAKEASRLNANELVKYLQVDVESGLSECSVLQRRIKHSWNEFQVDNTDPIWKKYLGQFTNPLILLLLGSALVSIITKEYEDAVSITVAILIVVTVAFVQEYRSEKSLEELNKLVPPECNCIRDGKQQHLLARELVPGDVVCLSVGDRVPADIRLIETTDLLVDESSFTGETEPCSKT------HGSVDEASGIATLSNIVFMGTLVRYGRGKGLVIGVGEKSQFGEVFKMMQAEETPKTPLQKSMDRLGKQLSLFSFGIIGLIMLIGWLQGKPLLSMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMANKRVIVKKLPIVETLGCCNVICSDKTGTLTANEMTATKLVTSDGLHAEVTGVGYEGKGYVSL-LPSNEEVHEFSS-VSIGKLVEAGCIANNAVIQNNTLMGQPTEGALVVLGMKMGLSNVSDNYIRKKEIPFSSEQRWMAVKCIERHN--------KEEIYFMKGAFEEVIQHCTMYNSSGRSLPVTPQQKSLYLQEEKNMGMQGLRVLALASGSELGKLTFLGLVGIIDPPRAGVSEAVQILLESGVSVKMITGDALETAQAIGRNIGLSN-GHLKAISGEELDQIDESTLSSIVTKVSVFYRTSPKHKLKIIKALQKTGAIVGMTGDGVNDAVALKSADIGVAMGKTGTDVSKEAADMILVDDDFSTIMNAIEEGKGIFYNIKNFVRFQLSTSISALSLITLSTVMNLPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDAIKQPPRNAKEAILSRALILKILLSATIIISGTLFVFWKEIPDGKVTPRTTTMTFTCFVFFDMFNALACRSLNKTIFEIGLFKNRMFWYSVLGSILGQMAVIYIPPLQKVFLTQNLHALDLLFLAGLASSVFVASELIKFCEQH 1003          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2c1 (ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:MGI:1889008])

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 506/901 (56.16%), Postives = 663/901 (73.58%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS +AS ++    +E++ LL  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ MRQFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL +DESS TGET P  K      +  +   +      +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I++S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +VSEI K +ER+ 
Sbjct:   54 VLTSKRASELA---VSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETAPCSKV-----TAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEVDTMEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKKVERSR 935          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2c1 (ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:MGI:1889008])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 506/901 (56.16%), Postives = 663/901 (73.58%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS +AS ++    +E++ LL  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ MRQFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL +DESS TGET P  K      +  +   +      +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I++S G +A  TGVGY   GEV ++   G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +VSEI K +ER+ 
Sbjct:   20 VLTSKRASELA---VSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETAPCSKV-----TAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGLHAEVTGVGYNQFGEVIVD---GDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEVDTMEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKKVERSR 901          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2c1 (ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:MGI:1889008])

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 506/901 (56.16%), Postives = 663/901 (73.58%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS +AS ++    +E++ LL  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ MRQFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL +DESS TGET P  K      +  +   +      +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I++S G +A  TGVGY   GEV ++   G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +VSEI K +ER+ 
Sbjct:   20 VLTSKRASELA---VSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETAPCSKV-----TAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGLHAEVTGVGYNQFGEVIVD---GDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEVDTMEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKKVERSR 901          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2c1 (ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:MGI:1889008])

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 490/870 (56.32%), Postives = 641/870 (73.68%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTE 2701
            +LTS +AS ++    +E++ LL  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ MRQFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL +DESS TGET P  K      +  +   +      +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I++S G +A  TGVGY   GEV ++   G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE
Sbjct:   20 VLTSKRASELA---VSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETAPCSKV-----TAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGLHAEVTGVGYNQFGEVIVD---GDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEVDTMEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTE 870          
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Match: Atp2c2 (ATPase, Ca++ transporting, type 2C, member 2 [Source:MGI Symbol;Acc:MGI:1916297])

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 489/884 (55.32%), Postives = 642/884 (72.62%), Query Frame = 2
Query:  140 EISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKV-TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            E++   HV+L  GLS     QR+LV+G N+F  D  EP+W KY  QF+ P+ILLLL S+ VS+  ++++DA+SI +A++IVVTV FIQEYRSEK+LE L +L+PP+ +C+RDG+   ++A +LVPGD+V L++GDRIPAD+RL E  DL +DESSFTGE EP  KT   L    +         ++NV +MGTLV+CG G+GVV+GTG+ S+FGE+FKMM++EE PKTPLQKSMD LGKQL+++SFGIIGL++++G +QG+  +++FT+GVSLAVAAIPEGLPIVV VTL +G  RMAK+  IVKKLP VETLGC NVICSDKTGTLT NEMT T +++S G +A  +GVGY+ +G V +  P+   +  + D++ + K++E GC+ NNA I    + GQPTEGA + L  K+ L  +   Y R KE PFSSE K M V+   K +E GE      DIYF+KGA E V+  C+ Y     P  LT  + S  +QE   +GS G+RV+ LA G +  ++ F G+VGIIDPP+  V+E+V ++ +SGV V M+TGDA+ETA +I   +G+    L   MSG+E++      ++  + +V+VF+RTSPKHK  I+K  Q    IVAMTGDGVND++ALKSADIGIAMG  GTDV KEAA ++L DD+F  I+ A+EEGK IF+NI+NFVRFQLSTSIAALSLIT ST+   P+PLN MQILW+NI+MDGPPAQSLGVEP D D +++PPR V ++ILNR LI+ V++SA  I+ GTL+IF RE+  N   TPR TTM FTCFV FD+FNALSCRSQ K IF IGF  N++F+ SV  SL+GQ+ VIY PPLQ +FQTE L   DLLLL  +ASSVF++SE+ K  E+
Sbjct:   62 ELARAFHVDLDSGLSEFAVAQRRLVHGWNEFVTDNAEPVWKKYLDQFRNPLILLLLGSSVVSVLTKEYEDAVSIALAVLIVVTVGFIQEYRSEKSLEELTKLVPPECNCLRDGKLRHMLARDLVPGDIVSLSMGDRIPADIRLTEVTDLLVDESSFTGEVEPCGKTDSPLADGGDLST------LSNVVFMGTLVQCGKGQGVVIGTGEQSQFGEVFKMMRAEETPKTPLQKSMDKLGKQLTIFSFGIIGLLMLVGWVQGKPFLSMFTVGVSLAVAAIPEGLPIVVMVTLVLGVLRMAKKRVIVKKLPIVETLGCCNVICSDKTGTLTANEMTATQLVTSDGFHAEVSGVGYSGEGTVCL-LPSKEVIKGF-DNVSVGKLVEAGCVANNAVIRKNAVMGQPTEGALVVLAMKMNLGSIKDSYVRKKEIPFSSEQKWMAVRCGPK-SEDGE------DIYFMKGAFEEVIHHCSMYNNGGIPLPLTPQQKSYCQQEEKKMGSLGLRVLALASGPELGRLTFLGLVGIIDPPRAGVKEAVQVLSESGVSVKMVTGDALETALAIGRTIGLCNEKL-KAMSGEEVEGTEQGALAARVRQVSVFFRTSPKHKVKIIKALQESGAIVAMTGDGVNDSVALKSADIGIAMGQTGTDVSKEAANMILVDDDFSAIMSAVEEGKGIFYNIKNFVRFQLSTSIAALSLITLSTVCNLPSPLNAMQILWVNIIMDGPPAQSLGVEPVDRDALRRPPRSVGDTILNRALILRVLMSAAVIIGGTLFIFWREIPANGTSTPRTTTMAFTCFVFFDLFNALSCRSQTKLIFEIGFFRNRMFLYSVLGSLLGQLAVIYAPPLQKVFQTENLSALDLLLLTGLASSVFILSELLKLWEK 929          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P57709|AT2C1_BOVIN (Calcium-transporting ATPase type 2C member 1 OS=Bos taurus OX=9913 GN=ATP2C1 PE=2 SV=1)

HSP 1 Score: 915.22 bits (2364), Expect = 0.000e+0
Identity = 509/903 (56.37%), Postives = 661/903 (73.20%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIE--TPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +LMPP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL +DESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G  A  TGVGY P GEV ++    +G     YN    + +I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y++      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   54 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLMPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLRAEVTGVGYNPFGEVIVDGDVVHGF----YNPS--VSRIVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYHSKGQTLTLTQQQRDLYQQEKAQMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 936          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q64566|AT2C1_RAT (Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus OX=10116 GN=Atp2c1 PE=2 SV=1)

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 509/901 (56.49%), Postives = 662/901 (73.47%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS +AS ++    +E++ LL  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ MRQFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I++S G +A  TGVGY   GEV ++   G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G D  Q+   G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +VSEI K +ER+ 
Sbjct:   20 VLTSKRASELA---VSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMRQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGLHAEVTGVGYNQFGEVIVD---GDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKAQMGSAGLRVLALASGPDLGQLTLLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEVDTMEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKKVERSR 902          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q80XR2|AT2C1_MOUSE (Calcium-transporting ATPase type 2C member 1 OS=Mus musculus OX=10090 GN=Atp2c1 PE=1 SV=2)

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 506/901 (56.16%), Postives = 663/901 (73.58%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS +AS ++    +E++ LL  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ MRQFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL +DESS TGET P  K      +  +   +      +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I++S G +A  TGVGY   GEV ++   G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +VSEI K +ER+ 
Sbjct:   20 VLTSKRASELA---VSEVAGLLQADLQNGLNKSEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISILMRQFDDAVSITVAIVIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSVDESSLTGETAPCSKV-----TAPQPAANGDLASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHILTSDGLHAEVTGVGYNQFGEVIVD---GDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYNSKGQTLALTQQQRDLYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEVDTMEVQHLSQIVPKVAVFYRASPRHKMKIIKSLQKNGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVSEIIKKVERSR 901          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|P98194|AT2C1_HUMAN (Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1 PE=1 SV=3)

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 507/901 (56.27%), Postives = 660/901 (73.25%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +    +QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +N++F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   20 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQRDVYQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAVAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 902          
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Match: sp|Q5R5K5|AT2C1_PONAB (Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii OX=9601 GN=ATP2C1 PE=2 SV=1)

HSP 1 Score: 908.286 bits (2346), Expect = 0.000e+0
Identity = 508/901 (56.38%), Postives = 661/901 (73.36%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +LTS KAS +     +E++ +L  +L  GL+  E   R+  +G N+F+  ++EPLW KY  QFK P+I+LLL SA +S+ M QFDDA+SITVAI+IVVTVAF+QEYRSEK+LE L +L+PP+ HC+R+G+    +A +LVPGD V L+VGDR+PADLRLFE VDL IDESS TGET P  K      + T  D    +    N+A+MGTLVRCG  KGVV+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLS YSFGIIG+I+++G L G+ ++ +FTI VSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY   GEV +   +G  +  + +  + R I+E GC+CN+A I +  L G+PTEGA I L  K+ L+ L   Y R  E+PFSSE K M VK   +  +       + +I F+KGA E+V+  CT Y +      LT  +   ++QE   +GS+G+RV+ LA G +  Q+ F G+VGIIDPP+  V+E+V  +  SGV + MITGD+ ETA +IAS+LG++       +SG+E+D +    +S+ + +V VFYR SP+HK  I+K  Q    +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR   +SIL + LI+ +++S+  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F IG  +NK+F  +V  S++GQ+LVIY PPLQ +FQTE+L I DLL L+ + SSV +V+EI K +ER+ 
Sbjct:   20 VLTSKKASELP---VSEVASILQADLQNGLNKCEVSHRRAFHGWNEFDISEDEPLWKKYISQFKNPLIMLLLASAVISVLMHQFDDAVSITVAILIVVTVAFVQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRS----NIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSFYSFGIIGIIMLVGWLLGKDILEMFTISVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIV---DGDVVHGFYNPAVSR-IVEAGCVCNDAVIRNNTLMGKPTEGALIALAMKMGLDGLQQDYIRKAEYPFSSEQKWMAVKCVHRTQQD------RPEICFMKGAYEQVIKYCTTYQSKGQTLTLTQQQ-RDVQQEKARMGSAGLRVLALASGPELGQLTFLGLVGIIDPPRTGVKEAVTTLIASGVSIKMITGDSQETAIAIASRLGLYSK-TSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRKPPRNWKDSILTKNLILKILVSSIIIVCGTLFVFWRELRDNVITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFEIGLCSNKMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILDLLFLLGLTSSVCIVAEIIKKVERSR 901          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A1S3I6J3 (Calcium-transporting ATPase OS=Lingula unguis OX=7574 GN=LOC106161145 PE=3 SV=1)

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 546/899 (60.73%), Postives = 686/899 (76.31%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            M+  + + H + ++  E++   +V++  GLS  EA+ R+  +G N+FE  +EE L  KY  QFK+P+I+LLL SA VS+ M+QFDDAISITVAI IVVTVAFIQEYRSEK+LEALKQL+PPK HC+RDG     +A  LVPGD+V L +GDR+PAD+RLFET DL IDESSFTGET+P  KT+ +  ++     +       N+ +MGTLVRCG GKG+V+GT +NSEFGE+FKMMQ+EEPPKTPLQ+SMD LGKQLS YSF II +I++IG LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RMAKR AIVKKLP VETLGCVNVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY  +GE++    NG  +  Y     I K++E+ CLCNNA I +  L GQPTEGA +    K+ L +L   Y RL+EWPF+S+TK M+VK   K   QG     + ++YFVKGA+ER+L  C  YY+   P  LT A+      E   +G +G+RV+ +A G   + ++F G+VG+IDPP+  V ESV ++  SGV + M+TGDA ETA +I S+LG++  G  H +SG++LD +  + +   ++RV VFYR SP+HK  IVK  Q+ K IV MTGDGVNDA+AL+SADIGIAMG  GTDVCKEAA ++L DD F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LIT ST+F  PNPLN MQILWINI+MDGPPAQSLGVEP D D+I+QPPR+V +SIL+R+L+ NVVLSA  IV GTLW+F REMSDNK+TPRDTTMTFTCFV FDMFNALSCRSQKKS+F+IG  +N++F+++VG SL+GQ+LVIY PPLQ IFQTEALY++D L LIA+ SSVFVV+EI+K IER
Sbjct:   39 MMYCMTSEHAAGEDYTEVARHFNVDVKTGLSHAEAEARQKAHGYNEFEIIEEETLLKKYLGQFKDPLIMLLLGSALVSVLMKQFDDAISITVAITIVVTVAFIQEYRSEKSLEALKQLVPPKCHCLRDGHLETFLARNLVPGDIVHLTIGDRVPADIRLFETTDLSIDESSFTGETQPANKTSAVQGAK----INNGIADRRNIGFMGTLVRCGRGKGIVIGTAENSEFGEVFKMMQAEEPPKTPLQRSMDTLGKQLSFYSFCIIAVIMLIGWLQGKHMLEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRKAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTHIYTSDGLHAEVTGVGYNGNGEIRC---NGNLVKDYTHP-SISKLMEVSCLCNNAEIENNTLLGQPTEGALLAAAMKMNLYNLRDGYDRLQEWPFTSDTKKMVVKCVPK---QGP----RQEMYFVKGALERLLQQCKTYYSRGAPLPLTGAQQHAYTLEASRMGVAGLRVLAMAYGPSMDNLMFVGMVGMIDPPRPGVRESVEVLVSSGVAIKMVTGDAEETAAAIGSRLGLYSLG-GHTLSGEQLDQMDISELQRIINRVAVFYRASPRHKHKIVKALQNNKYIVGMTGDGVNDAVALRSADIGIAMGTVGTDVCKEAADMILVDDEFSTIMSAIEEGKGIFYNIRNFVRFQLSTSIAALTLITLSTVFGLPNPLNAMQILWINIIMDGPPAQSLGVEPVDHDVIRQPPRRVNDSILSRKLLSNVVLSALIIVTGTLWVFWREMSDNKITPRDTTMTFTCFVFFDMFNALSCRSQKKSVFSIGLFSNRMFLLAVGGSLLGQLLVIYFPPLQAIFQTEALYLTDFLFLIALTSSVFVVTEIRKLIER 921          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A1S3I5B6 (Calcium-transporting ATPase OS=Lingula unguis OX=7574 GN=LOC106161145 PE=3 SV=1)

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 546/899 (60.73%), Postives = 686/899 (76.31%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            M+  + + H + ++  E++   +V++  GLS  EA+ R+  +G N+FE  +EE L  KY  QFK+P+I+LLL SA VS+ M+QFDDAISITVAI IVVTVAFIQEYRSEK+LEALKQL+PPK HC+RDG     +A  LVPGD+V L +GDR+PAD+RLFET DL IDESSFTGET+P  KT+ +  ++     +       N+ +MGTLVRCG GKG+V+GT +NSEFGE+FKMMQ+EEPPKTPLQ+SMD LGKQLS YSF II +I++IG LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RMAKR AIVKKLP VETLGCVNVICSDKTGTLTKNEMT+T+I +S G +A  TGVGY  +GE++    NG  +  Y     I K++E+ CLCNNA I +  L GQPTEGA +    K+ L +L   Y RL+EWPF+S+TK M+VK   K   QG     + ++YFVKGA+ER+L  C  YY+   P  LT A+      E   +G +G+RV+ +A G   + ++F G+VG+IDPP+  V ESV ++  SGV + M+TGDA ETA +I S+LG++  G  H +SG++LD +  + +   ++RV VFYR SP+HK  IVK  Q+ K IV MTGDGVNDA+AL+SADIGIAMG  GTDVCKEAA ++L DD F TI+ A+EEGK IF+NIRNFVRFQLSTSIAAL+LIT ST+F  PNPLN MQILWINI+MDGPPAQSLGVEP D D+I+QPPR+V +SIL+R+L+ NVVLSA  IV GTLW+F REMSDNK+TPRDTTMTFTCFV FDMFNALSCRSQKKS+F+IG  +N++F+++VG SL+GQ+LVIY PPLQ IFQTEALY++D L LIA+ SSVFVV+EI+K IER
Sbjct:   40 MMYCMTSEHAAGEDYTEVARHFNVDVKTGLSHAEAEARQKAHGYNEFEIIEEETLLKKYLGQFKDPLIMLLLGSALVSVLMKQFDDAISITVAITIVVTVAFIQEYRSEKSLEALKQLVPPKCHCLRDGHLETFLARNLVPGDIVHLTIGDRVPADIRLFETTDLSIDESSFTGETQPANKTSAVQGAK----INNGIADRRNIGFMGTLVRCGRGKGIVIGTAENSEFGEVFKMMQAEEPPKTPLQRSMDTLGKQLSFYSFCIIAVIMLIGWLQGKHMLEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRKAIVKKLPIVETLGCVNVICSDKTGTLTKNEMTVTHIYTSDGLHAEVTGVGYNGNGEIRC---NGNLVKDYTHP-SISKLMEVSCLCNNAEIENNTLLGQPTEGALLAAAMKMNLYNLRDGYDRLQEWPFTSDTKKMVVKCVPK---QGP----RQEMYFVKGALERLLQQCKTYYSRGAPLPLTGAQQHAYTLEASRMGVAGLRVLAMAYGPSMDNLMFVGMVGMIDPPRPGVRESVEVLVSSGVAIKMVTGDAEETAAAIGSRLGLYSLG-GHTLSGEQLDQMDISELQRIINRVAVFYRASPRHKHKIVKALQNNKYIVGMTGDGVNDAVALRSADIGIAMGTVGTDVCKEAADMILVDDEFSTIMSAIEEGKGIFYNIRNFVRFQLSTSIAALTLITLSTVFGLPNPLNAMQILWINIIMDGPPAQSLGVEPVDHDVIRQPPRRVNDSILSRKLLSNVVLSALIIVTGTLWVFWREMSDNKITPRDTTMTFTCFVFFDMFNALSCRSQKKSVFSIGLFSNRMFLLAVGGSLLGQLLVIYFPPLQAIFQTEALYLTDFLFLIALTSSVFVVTEIRKLIER 922          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: V3ZPC3 (Calcium-transporting ATPase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_211332 PE=3 SV=1)

HSP 1 Score: 974.156 bits (2517), Expect = 0.000e+0
Identity = 534/924 (57.79%), Postives = 680/924 (73.59%), Query Frame = 2
Query:   17 FNFNEFYILYCYLI*MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            + F +++ L C        +   + M+ S K+      +  EI+++L  +L  GL+  EAKQR  +YG NDFE  ++EPLW KY  QFK+P+ILLLL SA VS+ M+QFDDA+SITVAI IVVTVAFIQEYRSEK+LEAL +L+PPK HC+R+G+     A +LVPGD+V L+VGDR+PADLRLFE VD+ IDESSFTGETEPV K   IL   +           TN+A+MGTL+RCG GKGVV+GTG++SEFGEIFKMM +E+ PKTPLQKSMD LGKQLS YSF IIG+I++IG +QGR L+ +FTIGVSLAVAAIPEGLPIVVTVTLAIG  RMAK+ AI+KKLP VETLGCV V+CSDKTGTLTKNEMT+T I +S  + A  TGVGY  DG+V I         S      + K++E+GC+CNN+ IT+  L GQPTEG+ + L  K+ + D    YTRL+EW FSSETK M VK Q K     E       +YFVKGA+ERVL  CTH       Q LT+  + +  Q+   +GS+G+RV+ +A G + N+++F G+VGIIDPP+  V E++  +  SGV + M+TGD+ ETA ++ ++LG++  G    +SGD++D +    + + +++V VFYR +P+HK  IVK  QS   +V MTGDGVNDA+ALKS++IGI+MG  GTDV KEAA ++L DD+F TI+ A+EEGK IF+NI+NFVRFQLSTS+AALSLI  ST+   PNPLN MQILWINI+MDGPPAQSLGVEP D D+I+QPPRKV + IL ++LI N +LSA  IV GTLW+F REMSDNK+TPRDTTMTFTCFV FDMFNAL CRSQ KSIF IG  TNK+F+++VG S++GQ+LVIY PPLQ +FQTEAL I D + LI++ S+VF+ SE++K  +R
Sbjct:    3 YQFTDYFFLQC--------EDKKEDMMASFKSERACLLDYEEIADILKTSLDHGLTETEAKQRLKLYGVNDFEISQDEPLWKKYLGQFKDPLILLLLASAVVSVFMKQFDDAVSITVAITIVVTVAFIQEYRSEKSLEALSKLVPPKCHCLRNGKVETFFARDLVPGDIVYLSVGDRVPADLRLFEAVDMSIDESSFTGETEPVNKQTNILNKGST----NGISSRTNIAFMGTLIRCGRGKGVVIGTGESSEFGEIFKMMNAEDAPKTPLQKSMDTLGKQLSFYSFCIIGVIMLIGWIQGRGLLDMFTIGVSLAVAAIPEGLPIVVTVTLAIGVIRMAKQKAIIKKLPIVETLGCVTVVCSDKTGTLTKNEMTVTQIYTSDDQQAEVTGVGYNGDGQV-ISGGEA----SKGGASTLSKVVEVGCVCNNSDITNEGLRGQPTEGSLLALAIKMHVQDYREKYTRLQEWSFSSETKYMTVKCQPKFGNDNE------PVYFVKGALERVLQMCTHILYNGTTQPLTEKNVQKYTQQASRMGSAGLRVLSMAYGKEMNKLIFVGMVGIIDPPREGVREAIWTLLSSGVSIKMLTGDSEETAKAVGARLGLYSSGASS-LSGDQIDQMDIKDLRKIINQVGVFYRVTPRHKLKIVKALQSNGAVVGMTGDGVNDAVALKSSEIGISMGKSGTDVSKEAADMILVDDDFSTILSAIEEGKGIFYNIKNFVRFQLSTSMAALSLIALSTVMSLPNPLNAMQILWINIIMDGPPAQSLGVEPVDHDVIRQPPRKVRDPILTKQLIFNALLSAVIIVSGTLWVFWREMSDNKITPRDTTMTFTCFVFFDMFNALGCRSQSKSIFQIGLFTNKVFLLAVGGSILGQLLVIYFPPLQLVFQTEALSIVDFVFLISLTSTVFIASELRKWRQR 902          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: R7VEJ7 (Calcium-transporting ATPase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_176941 PE=3 SV=1)

HSP 1 Score: 962.6 bits (2487), Expect = 0.000e+0
Identity = 534/938 (56.93%), Postives = 688/938 (73.35%), Query Frame = 2
Query:  101 SLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISS----AGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAG-PQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTT----SDEYV*DHL 2887
            +L A   +  +   +  +L  +L  GLSS E ++R+  +G N+FE  K+EPLW KY  QFK+P+ILLLL SA VS+ M+QFDDA+SITVAIIIVV+VAF+QEYRSEK+LEAL +L+PPK HC+RDG+    +A ELVPGD++ L++GDR+PAD+RLFE  DL IDESSFTGETEP  K   +L +      +     + NVA+MGTLVRCG+GKG+V+GTG++SEFGE+FKMMQ+EEPPKTPLQ SMD LGKQLS YSF IIG I+ +G +QGR L+ +FTIGVSLAVAAIPEGLPIVVTVTLAIG  RMA R AIVKKLP VETLGCV VIC DKTGTLTKNEMT+T I+++    A  ++  +GVGY+  G +  +      +   +    I K+I+IG LCNNA I  G L GQPTEGA +    K+ L  +   Y RL+EWPF+S+TK M VK   +  +  E       +++VKGAVE ++ S THYY   G PQ +T+ +I+   ++   +GS+G+RV+ LA G   +Q+VF G+VGI+DPP+  V E+V  +  SG ++ M+TGD+++TA +IAS+LG++  G   C+SGD++D +  + +S+ +  + VFYR SP+HK  IV+  Q+   +V MTGDGVNDA+AL+SADIGIAMG+ GTDV KEAA ++L DDNF TI+ A+EEGK IF+NI+NFVRFQLSTSIAAL+LIT ST+F  PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR+  + I+ R L++NV++SA  IV GTLW+F REM DNK+TPRDTTMTFTCFV FDMFNALSCRSQ KSI T+GF +N++FI++VG SL+GQ+LVIY PPLQ +FQTEALY+SD + LI + S+VF VSE KK IER              RN S+ +K T     DEY  D L
Sbjct:    2 NLTAHGAAGMDVGRLVSILRTSLSSGLSSAEVRRRRGQHGFNEFEIQKDEPLWKKYLGQFKDPLILLLLASAVVSVAMKQFDDAVSITVAIIIVVSVAFVQEYRSEKSLEALTKLVPPKCHCVRDGRLETFLARELVPGDIINLSIGDRVPADIRLFEAFDLAIDESSFTGETEPASKHTNVLTTTK----NNGISHMANVAFMGTLVRCGNGKGIVLGTGESSEFGEVFKMMQAEEPPKTPLQVSMDQLGKQLSFYSFCIIGGIMFLGWIQGRHLLDMFTIGVSLAVAAIPEGLPIVVTVTLAIGVMRMANRKAIVKKLPIVETLGCVKVICCDKTGTLTKNEMTVTKIMTADDKVAEVDSGVSGVGYSTHGVIVCDH----NVVQKDSHPSITKVIQIGVLCNNAQIIEGDLQGQPTEGALLACAFKMDLESMRQEYIRLQEWPFNSDTKYMAVKCVPRDQKGPE-------VFYVKGAVEPIMRSSTHYYVSRGQPQPITEKQINHFMEQASHMGSAGLRVLALAYGDSMSQLVFAGLVGIMDPPRDGVREAVQTLISSGTQLKMLTGDSLDTAVAIASRLGLYASG-GRCLSGDDIDQMDISSLSQIIGMIPVFYRVSPRHKHKIVRAIQNNGLVVGMTGDGVNDAVALRSADIGIAMGVTGTDVSKEAADMILVDDNFSTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLSTMFSLPNPLNAMQILWINIIMDGPPAQSLGVEPVDHDVIRKPPRRAKDPIITRPLLVNVIISAAIIVSGTLWVFWREMQDNKITPRDTTMTFTCFVFFDMFNALSCRSQIKSILTVGFFSNRMFILAVGGSLIGQLLVIYFPPLQQVFQTEALYLSDFIFLICLTSTVFFVSEAKKFIER--------------RNESRIRKRTVSIGDDEYHRDDL 909          
BLAST of Calcium-transporting ATPase vs. TrEMBL
Match: A0A3S1ADV7 (Calcium-transporting ATPase OS=Elysia chlorotica OX=188477 GN=EGW08_002880 PE=3 SV=1)

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 531/947 (56.07%), Postives = 690/947 (72.86%), Query Frame = 2
Query:   80 TPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLI--IRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH-----------FYQVNIL-------LRYLLRNHSQKKKTT 2860
            +P +M++ L+++       NE+ + L  +   GL+S EA +R+ V+GPN+FE   E+PLW KY  QFK P+I+LLL SA +SL M+QFDDAISIT+AIIIVVTVAFIQEYRSEK+LEAL +L+PPK HCIRD Q    +A +LVPGD+V ++VGDR+PAD+RLFE   L IDESSFTGE EPV K  E L   +  D  +      NVA+MGTLVRCG GKG+V+GTG++SEFGEIFKMMQ+EE PKTPLQKSMD LGKQLS YSF +IG+IVIIG +QGR+++ +FTIGVSLAVAAIPEGLPIVVTVTLAIG  +MAKR AIVKKLP VETLGC +VIC DKTGTLTKNEMT+T II+S   +A  TGVGY   G+V I +       S +D+ +   +K+IE+G +CNNA +T   L G PTEGA +    K++L D+   Y R++EWPFSS+TKMMMV+      +        +D++FVKGA+ERVL +C+HYY       L++ +     ++   LG  G+RV+G+A G  P  +VF G+VGI+DPP+  V E++  +   G+ V M+TGD  +TA ++A+++G++  G+   MSG EL+ +    +S+ ++ + +FYR +P+HK  IVK  Q+R+ +VAMTGDGVNDA+ALK+A+IGI+MG  GTDV KEAA ++L DD+  T++ A+EEGK IF+NI+NFVRFQLSTSIAALSL+  + + + PNPLN MQILWINI+MDGPPAQSLGVEP D D+++QPPRKV E+I+ R LI+  + SA  IV GT+WIF+ EM D K+TPRDTTMTFTCFV FDMFNALSCRS  KSIF IGF TN++F+ +VG S++GQ+LVIY PPLQ IFQTEALY SD  LLI++ S+VF+VSEI+K   R             FY  N+L       + ++LR HSQ +  T
Sbjct:   36 SPVVMMSLLRSNAAVGMTVNEVVDQLRTDTAAGLTSAEALRRRKVHGPNNFEISVEDPLWKKYLDQFKNPLIMLLLASAGISLFMKQFDDAISITMAIIIVVTVAFIQEYRSEKSLEALTKLVPPKCHCIRDNQLTTFLAEDLVPGDIVSISVGDRVPADVRLFEASGLSIDESSFTGEIEPVGKYVEALQVSSSNDLSERR----NVAFMGTLVRCGKGKGIVIGTGQDSEFGEIFKMMQAEEAPKTPLQKSMDTLGKQLSFYSFLVIGIIVIIGWIQGRKILDMFTIGVSLAVAAIPEGLPIVVTVTLAIGVMKMAKRKAIVKKLPVVETLGCTDVICCDKTGTLTKNEMTVTQIITSDYHHAELTGVGYDSMGQVNIISST-----SDHDEAMRSFKKVIEVGLVCNNAELTQQGLMGSPTEGAILGAAMKLQLPDVRAQYLRVEEWPFSSDTKMMMVRCHPIDDKN-------NDMWFVKGAIERVLDNCSHYYERGQSVTLSEKQCHYYNEQAQMLGLRGLRVLGMAYGDSPTSLVFIGLVGIMDPPREGVREAIHTLMGMGLSVKMLTGDGEDTAKAVAARIGLYAEGV-RTMSGSELETIDVGRLSQSIESIAIFYRVTPRHKLKIVKALQARQHVVAMTGDGVNDAVALKTAEIGISMGKTGTDVSKEAADMILVDDDLSTVLAAIEEGKGIFYNIKNFVRFQLSTSIAALSLVAIAMILRLPNPLNAMQILWINIIMDGPPAQSLGVEPVDHDVLRQPPRKVTENIITRPLILTTLTSAFIIVCGTMWIFHEEMEDGKITPRDTTMTFTCFVFFDMFNALSCRSHNKSIFQIGFFTNRMFLYAVGGSILGQLLVIYFPPLQKIFQTEALYASDFALLISLTSTVFIVSEIRKFFTRRQEDQLLHQREMAFYPENMLSSNLNPNIPHVLR-HSQSEDDT 964          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 504/907 (55.57%), Postives = 658/907 (72.55%), Query Frame = 2
Query:   74 DQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKI--ETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            D+T   +LTS KAS +     NE +  L  +L  GLS  E  +R++ +G N+F+  +EEPLW KY  QFK+P+I+LLL SA +S+ MRQFDDA+SITVAIIIVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G+   ++A ELVPGD V L+VG+R+PADLRLFE VDL +DESS TGET P  KT+    + T  D        +N+A+MGTLVRCG  KG+V+GTG+NSEFGE+FKMMQ+EE PKTPLQKSMD+LGKQLSLYSF IIG+I+++G LQG+ ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM ++ AIVKKLP VETL C NVICSDKTGTLTKNEMT+T I +S G++A  TGVGY   GEV +  E  +G   FS +    I KI+E GC+CN+A I +G L G+PTEGA I+L  K+ L  +   + RL+E PFSSE K M V+   + T+Q                  R++SS    Y F          ++ +   + +  ++   V+  A G +   + F G+VGIIDPP+  V+++V+ +  SGV V MITGD+ ETA +IAS+LG++  G   C+SG+E+D++    +S+ + R+ VFYR SP+HK  IVK  Q+   +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR V +SI+ R LI+ ++ SA  IV GTL++F RE+ DN++TPRDTTMTFTCFV FDMFNALS RSQ + +  +G  +N+ F  +V  S++GQ+LVIY PPLQ +FQTE+L I D+L L+ + SSV  VSE+ K +ER
Sbjct:   12 DETMVPVLTSKKASELP---VNEAACALQADLQFGLSHDEVLRRRVYHGWNEFDISEEEPLWKKYISQFKDPLIMLLLASAVISVLMRQFDDAVSITVAIIIVVTVAFVQEYRSEKSLEELGKLVPPECHCIREGRLEHLLARELVPGDTVCLSVGERVPADLRLFEAVDLSLDESSLTGETTPCSKTSAPQPAATNGDITSR----SNIAFMGTLVRCGKAKGIVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQLSLYSFCIIGVIMMVGWLQGKYILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVQKRAIVKKLPIVETLSCCNVICSDKTGTLTKNEMTVTQIFTSDGQHAEVTGVGYNSAGEVLLDGEVVHG---FSNSG---ISKIVEAGCVCNDALIRNGTLMGRPTEGALISLAMKMGLEGVQQEFVRLEEIPFSSEQKWMAVRCVHR-TQQ-----------------VRIISSYKKIYIF-----FFYIYVNILNPIIVYCLAA---VLAFASGAETGNLSFLGLVGIIDPPRAGVKDAVSTLISSGVAVKMITGDSQETAVAIASRLGLYTKG-SQCLSGEEVDVMDIQQLSQIVSRIVVFYRASPRHKLKIVKSLQNIGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTILSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDGDVIRKPPRNVRDSIITRSLIVKILASAFIIVCGTLFVFWRELRDNEITPRDTTMTFTCFVFFDMFNALSSRSQTRMVHEMGLCSNRTFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSIFDMLFLVGLTSSVCFVSEVIKKLER 878          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 407.142 bits (1045), Expect = 6.946e-126
Identity = 340/1012 (33.60%), Postives = 512/1012 (50.59%), Query Frame = 2
Query:  119 ISNKNTNEISELLH---VNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPP--KTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXX---------XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII-------SSAGENAFA-TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRL---------------------KEW--PFSSETKMMMVKYQ-TKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSG--MRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLW-IFNRE---------------MSDNKV----------TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            + N +T   SE+L    VN   GL+  + K  +  YGPN+   ++ + LW     QF++ ++ +LLL+A VS  +  F++    T A +  + +  I          QE  +E A+EALK+  P   K + +       I A E+VPGD+V + VGD++PAD+R+   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG ++E G+I   M   E  KTPLQ+ +D  G+QLS + S   + + V         + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +        SS   + F  TG  YAP+G+V      G++     D   + ++  I  +CN++S+      G+    G+ TE A  TL  K     +N++ T L                     KE+   FS + K M V    TK+  Q +         FVKGA E V+  CTH    +G   LT A   ++   +   G+    +R + LA    P                  + + F G VG++DPP+  V  SV +  ++G++V+MITGD   TA +I  ++GIF    D      +G E D +A     E + R   F R  P HKS IV   QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL+DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  + +   P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R L I   +    +   T W +F+ +                 DN +          +   TTM  +  V  +MFNAL+  S+ +S+  +    N   + ++ LSL    L++Y  PL  IFQ   L+ S  ++++ I+  V ++ E  K + R+H 
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVL----KGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEK-----MNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTPTKSGSQSK--------MFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHHL 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: atp2a3 (sarcoplasmic/endoplasmic reticulum calcium ATPase 1 [Source:NCBI gene;Acc:103024029])

HSP 1 Score: 406.757 bits (1044), Expect = 1.318e-125
Identity = 340/1012 (33.60%), Postives = 512/1012 (50.59%), Query Frame = 2
Query:  119 ISNKNTNEISELLH---VNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPP--KTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXX---------XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII-------SSAGENAFA-TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRL---------------------KEW--PFSSETKMMMVKYQ-TKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSG--MRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLW-IFNRE---------------MSDNKV----------TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            + N +T   SE+L    VN   GL+  + K  +  YGPN+   ++ + LW     QF++ ++ +LLL+A VS  +  F++    T A +  + +  I          QE  +E A+EALK+  P   K + +       I A E+VPGD+V + VGD++PAD+R+   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG ++E G+I   M   E  KTPLQ+ +D  G+QLS + S   + + V         + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +        SS   + F  TG  YAP+G+V      G++     D   + ++  I  +CN++S+      G+    G+ TE A  TL  K     +N++ T L                     KE+   FS + K M V    TK+  Q +         FVKGA E V+  CTH    +G   LT A   ++   +   G+    +R + LA    P                  + + F G VG++DPP+  V  SV +  ++G++V+MITGD   TA +I  ++GIF    D      +G E D +A     E + R   F R  P HKS IV   QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL+DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  + +   P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R L I   +    +   T W +F+ +                 DN +          +   TTM  +  V  +MFNAL+  S+ +S+  +    N   + ++ LSL    L++Y  PL  IFQ   L+ S  ++++ I+  V ++ E  K + R+H 
Sbjct:    1 MENAHTKSASEVLRNFDVNENTGLTLEQVKTNQERYGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACVSFVLALFEEGEESTTAFVEPLVILLILIANAVIGVWQERNAENAIEALKEYEPEMGKVYRMNRKAVQRIKAREIVPGDIVEVAVGDKVPADIRIVSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGRAIGVVVCTGVSTEIGKIRNQMACTEQEKTPLQQKLDEFGQQLSKVISLICVAVWVINIGHFGDPVHGGSWVRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDKADSSSCSLHEFNITGSTYAPEGQVL----KGVKPVQCGDFDGLLELATICSMCNDSSLDYNEAKGVYEKVGEATETALTTLVEK-----MNVFKTDLSGLSKVERAGACNSVIRQLMKKEFTLEFSRDRKSMSVYCTPTKSGSQSK--------MFVKGAPESVIDRCTHVRIGSGKAELTIAAKEELMSTIRDWGTGKDTLRCLALATRDTPPRKQDMDLENATKFAAYESDLTFVGCVGMLDPPRKEVIGSVKLCSEAGIRVIMITGDNKGTAVAICRRIGIFTEHEDVEGKAYTGREFDDLAPEAQREAVKRARCFARVEPAHKSKIVGYLQSFDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLSDDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAILGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDKPPRNPKEPLISGWLFFRYLAIGGYVGLGTVGAATWWYLFDEQGPQVSFNQLRHFMQCTEDNPMFKGIDCEVFESRYPTTMALSVLVTIEMFNALNSLSENQSLLRMPPWVNIWLLGAIILSLSLHFLILYVEPLPLIFQVTPLHCSQWIVVLKISIPVILLDEALKYVSRHHL 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: ENSAMXT00000046993.1 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:103040450])

HSP 1 Score: 385.571 bits (989), Expect = 9.208e-118
Identity = 326/998 (32.67%), Postives = 494/998 (49.50%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXX---------XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII--------SSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKL--NDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIY-------------FVKGAVERVLSSCTHYYTFAGPQILTDA---KISQIKQEVGFLGSSGMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVL---------------------SATCIVIGTLWIFNREMSDNK----------VTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            K   E+     VN   GL   + K++K  +GPN+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R  +     I A ++VPGD+V + VGD++PAD+RL   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG N+E G+I   M S E  +TPLQ+ +D  G+QLS + S   I + +         + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +         S +      TG  YAP+GEV  +    ++   Y D L+  ++  I  LCN++S+      G+    G+ TE A   L  K+ +  NDL       +    +S  K +M K  T    +    +    +Y             FVKGA E V+  CTH    +    LT     KI  + +E G  G   +R + LA   +P                    + F G VG++DPP+  V  S+ + + +G++V+MITGD   TA +I  ++GIF    D      +G E D ++     E +     F R  P HKS IV+  QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  +    +P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++  L    +                          +    L  F +   DN            +P   TM  +  V  +M NAL+  S+ +S+  +    N   + ++ LS+    L++Y  PL  IFQ   L ++  L+++ I+  V ++ E+ K   RN+ 
Sbjct:    7 KTVEEVYSYFSVNESTGLGLDQLKRQKEKWGPNELPAEEGKSLWELVVEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEVAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMASTEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDQVQGDSCSLREFTVTGSTYAPEGEV-YQDGKPVKCSKY-DALV--EMATICALCNDSSLDFNEAKGVYEKVGEATETALTCLVEKMNVFDNDLKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSM---SVYCTPNKARSSIGKMFVKGAPEGVIDRCTHIRVGSNKVPLTPGIKEKILSVIREYG-TGRDTLRCLALATRDNPISKEDLVLEDSTRFVEYETDLTFVGCVGMLDPPRAEVAASMKLCRLAGIRVIMITGDNKGTAVAICRRIGIFGENDDVSSMAFTGREFDDLSPATQREAVLTARCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKTASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNAREPLISGWLFFRYLAIGGYVGAATVGAAAWWFIAAEDGPRVTFYQLSHFLQCGPDNPEYKGVNCEIFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGAICLSMSLHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDEVLKFAARNYL 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:103021660])

HSP 1 Score: 385.571 bits (989), Expect = 3.292e-117
Identity = 329/1034 (31.82%), Postives = 497/1034 (48.07%), Query Frame = 2
Query:  119 ISNKNTNEISELLH---VNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS---------LYSFXXXX-XXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISS---AGE----NAFA-TGVGYAPDGEVKIETPNGLRLFSYNDDLIIR--------KIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRLKE------------------WPFSSETKMMMV-----KYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQI-LTDAKISQIKQEVGFLGSS--GMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGI-------------FRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLWIFNR---------------EMSDNKV-----------TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVN 2809
            + N +T  + E+L    VN   GLSS + ++ +  +GPN+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R  +     + A ++VPGD+V + VGD++PAD+RL    +  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG  +E G+I   M + +P +TPLQ+ +D  G+QLS         ++   I      + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMA++NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +       GE    N F  TG  YAP+GEV            Y D  ++R        ++  I  LCN++S+    + G+    G+ TE A   L  K+ + D +L      E                    FS + K M V     K    AT  G  +       FVKGA E VL  C       G ++ LT     Q+   V   GS    +R + +A    P                  + + F G VG++DPP+  V  +V + +Q+G++V+MITGD   TA SI  ++GI             F  GL    +G E D +  ++  +       F R  P HKS IV+  QS   I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ ++L DDNF TIV A+EEG+AI++N++ F+R+ +S++I  +  I  +     P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R LII   +    +     W                   + S+              +P   TM  +  V  +M NAL+  S+ +S+  +   +N   + ++ LS+    L++Y  PL  IFQ   L     + ++ ++  V ++ E  K + RN+    N
Sbjct:    1 MDNAHTKTVEEVLGYFGVNESTGLSSEQLRKSRERWGPNELPAEEGKSLWELVLEQFEDLLVRILLLAACISFTLAWFEEGEGTITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRVRARDIVPGDIVEVAVGDKVPADIRLTSIRSTTLRVDQSILTGESVSVLKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGRAIGVVVATGVQTEIGKIRDEMAATDPERTPLQQKLDQFGEQLSKVITVICVAVWGINIGHFSDPVHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVDLVVGERCVMNEFTVTGSTYAPEGEV------------YKDGAVVRCSQFDSLVEMATICALCNDSSLDYNESKGVYEKVGEATETALCCLVEKMNVFDTDLRSLTPVERATACCSVIKQLMRKELTLEFSRDRKSMSVFCSPNKLTRSAT--GAKM-------FVKGAPESVLERCRWIRVGGGARVPLTTDLREQLLGTVREWGSGRDTLRCLAMATRDSPPDPRTLNLENSSAFTEYESDLTFVGCVGMLDPPRKEVLSAVRMCRQAGIRVIMITGDNKGTALSICRRVGIITEQEEEEAEGAPFGGGL----TGREFDELPPHMQRQACRTARCFARVEPTHKSRIVEYLQSLSDITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMILADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMSRPPRSPKEPLISGWLFCRYLIIGCYVGVATVGAAAWWFMAAHDGPKLSFYQLSHYLQCSEGHADFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWSNPWLVGAICLSMALHFLILYVDPLPVIFQIRPLSWPQWVTVLKMSLPVILMDEALKFLARNYIEPSN 1003          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 493.426 bits (1269), Expect = 2.186e-166
Identity = 245/431 (56.84%), Postives = 324/431 (75.17%), Query Frame = 2
Query: 1508 DIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFY 2800
            ++YFVKGA ERV+  C  +        L+  ++   KQE  ++G+SG+RV+ +A G +  Q+ F G+VGIIDPP+  V +SVAI+  SGV V M+TGD+META +IA++LG+   G    +SG+E DL+ +  +S+ + +V+VFYR SP+HK  IVK  Q   ++V MTGDGVNDA+AL++ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK IF+NI+NFVRFQLSTSIAAL+LIT +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I+QPPR V +SIL R LI  +++SA  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F  GF +N++F  +VG S++GQ+ VIY PPLQ +FQTE L   DLL L+ + S+V++ SE+ K +ER   +
Sbjct:   12 EVYFVKGAFERVIDMCCSFRGQGHTLPLSAQQLVLYKQEETYMGASGLRVLAMASGPELGQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGLSSNGGGAAISGEE-DLMETTQLSQIIRKVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISAIIIVSGTLFVFWRELQDNMITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAVERRRLF 441          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:ZFIN;Acc:ZDB-GENE-060503-615])

HSP 1 Score: 468.774 bits (1205), Expect = 3.868e-157
Identity = 237/424 (55.90%), Postives = 311/424 (73.35%), Query Frame = 2
Query: 1529 AVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFY 2800
            A ERV+  C  +        L+  ++   KQE  ++G+SG+RV+ +A G +  Q+ F G+VGIIDPP+  V +SVAI+  SGV V M+TGD+META +IA++LG+   G    +SG+E         +  + +V+VFYR SP+HK  IVK  Q   ++V MTGDGVNDA+AL++ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK IF+NI+NFVRFQLSTSIAAL+LIT +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I+QPPR V +SIL R LI  +++SA  IV GTL++F RE+ DN +TPRDTTMTFTCFV FDMFNALS RSQ KS+F  GF +N++F  +VG S++GQ+ VIY PPLQ +FQTE L   DLL L+ + S+V++ SE+ K +ER   +
Sbjct:    1 AFERVIDMCCSFRGQGHTLPLSAQQLVLYKQEETYMGASGLRVLAMASGPELGQLTFLGLVGIIDPPRPGVRKSVAILVSSGVSVKMVTGDSMETAVAIANRLGLSSNGGGAAISGEEAWGGRHPAAAFVVLQVSVFYRASPRHKLKIVKALQKNGEVVGMTGDGVNDAVALRAADIGVAMGRSGTDVCKEAADMILVDDDFYTIMSAIEEGKGIFYNIKNFVRFQLSTSIAALTLITLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDKDVIRQPPRNVKDSILTRSLISKILISAIIIVSGTLFVFWRELQDNMITPRDTTMTFTCFVFFDMFNALSSRSQTKSVFESGFFSNRMFCYAVGGSIMGQMAVIYFPPLQQVFQTENLSAVDLLFLLGLTSTVWIASEVMKAVERRRLF 424          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 1.700e-96
Identity = 290/866 (33.49%), Postives = 423/866 (48.85%), Query Frame = 2
Query:  530 LNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXXXXX---------XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITN--IISSA-GENA-----FATGVGYAPDGEVKIETPNGLRLFSYNDDLIIR--------KIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRLKE------------------WPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDA---KISQIKQEVGFLGSSGMRVIGLAEGWDPNQ--------------------MVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPG---LDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIG-------------------TLWIFNREMS-----------DNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHF 2797
            L VGD++PAD+RL   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG N+E G+I   M + E  KTPLQ+ +D  G+QLS + S   I + +         + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++    II  A GEN        TG  YAP+GEV            Y +D ++R        ++  I  LCN++S+      G+    G+ TE A      K+ + D +L      E                    FS + K M V Y T       ++    +  FVKGA E V+  C+H         +T     KI    +E G  G   +R + LA    P +                     V C  VG++DPP+  V  S+ + +++G++V+   GD   TA +I  ++GIF       D   +G E D +          R   F R  P HKS IV+  QS  +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL DDNF +IV A+EEG+AI++N++ F+R+ +S+++  +  I  +    +P  L P+Q+LW+N++ DG PA +LG  P D DI+++PPR   E +++  L     L+  C V                     T +  +  M            D  V  +P   TM  +  V  +M NAL+  S+ +S+  +    N   + ++ LS+    L++Y  PL  IFQ   L +   L+++ I+  V ++ E  K I RN+ 
Sbjct:    1 LAVGDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEV------------YKNDKLVRCGEYDGLIELATICALCNDSSLDFNEAKGVYEKVGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSV-YCTPVKPSRSSV---GNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYG-TGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVGMLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGEDEDVKDKAYTGREFDDLPLEEQRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNPKEPLISGWLFFR-YLAIGCYVGAATVGAAAWWFMAADDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIARNYL 839          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 2.808e-49
Identity = 161/577 (27.90%), Postives = 260/577 (45.06%), Query Frame = 2
Query: 1334 GQPTEGAFI-----TLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFV--KGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAE------------GWDPNQMVF-------CGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHC-----------------------MSGDELDLVASNLMSEELDRVT--VFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKV-AESILNRRLIINVVLSATCIV--IGTLWIFNREMSDNKVTP-----------------------------RDTTMTFTCFVLF-------DMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            G  +E A +      +GN   + D+     ++ E PF S      +KYQ    E  E     D  Y +  KGA ER+L  C+        + L +      +     LG  G RV+GL +             +D   + F        G++ +IDPP+  V ++V   + +G+KV+M TGD   TA +IA  +GI   G +                         + G +L  +    + + L   T  VF RTSP+ K +IV+  Q +  IVA+TGDGVND++ALK ADIGIAMG+ G+DV K+AA ++L DDNF +IV  +EEG+ IF N++  + + L+++I  ++   F  L   P PL  + IL I++  D  PA SL  E A+ DI+K+ PR V  + ++N RL I++      ++  +G  + +   M++N   P                             +   + +TC   F          + + C++++ S+F  G   NK+ I  +         + YCP +    +   L +S        +  +FV  E++K I R +
Sbjct:    6 GDASESALLRCVELCVGN---VRDMRSRNQKVAEIPFDS-----TIKYQLSIHESDEP---NDPRYLLVMKGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGERVLGLCQLRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVRVDKLVNERL-ISIAYGQIGMIQALGGFFTYFVIMAENGFLPSKLMGLRIEWNTRSQNELEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGM-KNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKLSWWFCAFPYSILIFVYDEVRKLIIRRN 569          
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 8.418e-39
Identity = 119/403 (29.53%), Postives = 191/403 (47.39%), Query Frame = 2
Query: 1778 KVVMITGDAMETACSIASKLGIFRPGLDHCMS-GDELDLVASNL-----------------MSE-ELDRV------TVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKV-AESILNRRLIINVVLSATCIV--IGTLWIFNREMSDNKVTPRD------------------------------------TTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            +V+M+TGD   TA +IA  +GI   G +        L++  S +                 M+E +LD +       VF RTSP+ K +IV+  Q +  IVA+TGDGVND+ ALK ADIGIAMG+ G+DV K+AA ++L DDNF +IV  +EEG+ IF N++  + + L+++I  ++   F  L   P PL  + IL I++  D  PA SL  E A+ DI+K+ PR    + ++N RL I++      ++  +G  + +   +++N   P +                                     T  F   V+    + + C++++ S+F  G   NK+ I  +         + YCP +    +   L  S        +  +FV  E++K I R H
Sbjct:    1 QVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTEIQLDDILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNARVDKLVNERL-ISIAYGQIGMIQALGGFFSYFVILAENGFLPWNLIGIRINWDDKSLNDLEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGM-KNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEVRKFILRRH 401          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 446/896 (49.78%), Postives = 607/896 (67.75%), Query Frame = 2
Query:  182 SSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEP-MIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQ----PTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNI--ISSAGENAFATGVGYAPDGEVKIETPNG-LRLFSYNDDLIIRKIIEIGCLCNNASITS--GILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQI--LTDAKISQIKQEVGFLGSSGMRVIG-----LAEGWDP------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMS-DNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            SS EA  R+ +YGPN+   + +E L+ K+   F E  MILLL+ SA VSL M   DDA+SIT+AI IVVTV F+QEYRSEK+LEAL +L+P + H +R GQ   ++A+ LVPGD+V   +GDRIPAD+R+ E +DL IDES+ TGE EPV KT++ +  ++ F+       P  + + +AYMGTLV+ G GKG+VVGTG N+ FG +F+MM + E PKTPLQ +MD LGK LSL SF +IG+I ++G++QGR  + +F I VSLAVAAIPEGLPI+VTVTLA+G  RMAKR AIV++LP+VETLG VNVICSDKTGTLT N MT++ +  + S         +    D   K +  NG L+ +   D   +R+ + IG LCNNAS +    I  G PT+ A +      ++ D+     +++E PF+S+ K+M  K          N +      +VKGA ER+L   T Y    G +   LT+A+ + I +    + S G+RV G     L++   P        + F G++G+ DPP+  V+ ++  + Q GV ++MITGD+  TA +IA ++GI  P +D     +SGD+LD ++ + ++  +D V +F R +P+HK  IV+  + R  +VAMTGDGVNDA ALK +DIG++MG  GTDV KEA+ +VLTDD+F TI+ A+EEGK IF+NI+NF+ FQLSTS+AALSL+  ST F+ PNPLN MQILWINILMDGPPAQSLGVEP D +++K+PPRK  + IL   ++  ++ +A CI++GT++IF +EM+ D KVT RDTTMTFTCFV FDMFNAL+CR   KSIF IGF TNK+F  +VGLSL+GQ+  IY P  Q IF+TE L ISD+LLL+ I+SSVF+V E++K   R
Sbjct:   60 SSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSITLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTI-EKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSL----DKNKKTKNSNGNLKNYLTED---VRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSKRKLMATKIL--------NPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI--PVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKVTARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTR 937          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 345.51 bits (885), Expect = 3.075e-103
Identity = 280/916 (30.57%), Postives = 444/916 (48.47%), Query Frame = 2
Query:  134 TNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQ------SEEPPK-----------------------TPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEM--------TITNIISSAGENAFATGVG-------YAP-------DGEVKIETPNGLRLFSYN-----DDLIIRKIIEIGCLCNNASITSGILS------GQPTEGAFITLGNKVKL----------------NDLN-----------LYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQI--LTDAKISQIKQEVGFLGSSGMRVIGLA-EGWDPNQ-------------------MVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH---------CMSGDELDLVASNLMSEELDRVTVF----YRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPN-----PLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIIN-----VVLSATCIV--IGTLWIFN 2473
            T E +E +  +L  GL+  E+ +R    G N    D +         Q    MI++L++S  +S  +R +     I+  I + V +  +QEY++ K + +LK L  P  H IR+G++  I + ++VPGD+ ++ VGD IPADLRL ET +   DES  TGE+ PV K A ++F + E           N+A+  + V  G  KG+V+ T  NSE G+I K +Q      S +P K                       TPL + +  L   L   +     +++        + +A++ I V+L++  IP  L +V+T+T+++G   M  RN IV+KL ++E LG VN ICSDKTGTLT+ +M            I  S  ++ F    G       ++P       DG+V I      RL+  +     D  + +K +E   L N A++     +      G PTE A      K+ L                ND +             +  + E+PF S  K M   Y     E         +IY  KGA E ++S C+ +Y   G +I  LTD  +  I++ V  L + G+RV+G A + +  +Q                   +VF G++GI DPP++    +V    Q+G+ V M+TGD + TA +IA ++GI    L H          M+G + D     L  EE+D + V      R SP+ K  +++    RK+  AMTGDGVND+ +LK A++GIAMG+ G+DV KEA+ IVL+DDNF +I++A+EEG+ +  NI+ FV   L+ ++A    +    +F+  N     PL+P+++LWI ++    PA  LG+E A PD++ +PP      I    +II+     ++++ +C+    G+L+  N
Sbjct:   22 TEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEE---ETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETY-------NIYG-KGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFD----GLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGIN 920          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 345.125 bits (884), Expect = 4.510e-103
Identity = 280/916 (30.57%), Postives = 444/916 (48.47%), Query Frame = 2
Query:  134 TNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQ------SEEPPK-----------------------TPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEM--------TITNIISSAGENAFATGVG-------YAP-------DGEVKIETPNGLRLFSYN-----DDLIIRKIIEIGCLCNNASITSGILS------GQPTEGAFITLGNKVKL----------------NDLN-----------LYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQI--LTDAKISQIKQEVGFLGSSGMRVIGLA-EGWDPNQ-------------------MVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH---------CMSGDELDLVASNLMSEELDRVTVF----YRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPN-----PLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIIN-----VVLSATCIV--IGTLWIFN 2473
            T E +E +  +L  GL+  E+ +R    G N    D +         Q    MI++L++S  +S  +R +     I+  I + V +  +QEY++ K + +LK L  P  H IR+G++  I + ++VPGD+ ++ VGD IPADLRL ET +   DES  TGE+ PV K A ++F + E           N+A+  + V  G  KG+V+ T  NSE G+I K +Q      S +P K                       TPL + +  L   L   +     +++        + +A++ I V+L++  IP  L +V+T+T+++G   M  RN IV+KL ++E LG VN ICSDKTGTLT+ +M            I  S  ++ F    G       ++P       DG+V I      RL+  +     D  + +K +E   L N A++     +      G PTE A      K+ L                ND +             +  + E+PF S  K M   Y     E         +IY  KGA E ++S C+ +Y   G +I  LTD  +  I++ V  L + G+RV+G A + +  +Q                   +VF G++GI DPP++    +V    Q+G+ V M+TGD + TA +IA ++GI    L H          M+G + D     L  EE+D + V      R SP+ K  +++    RK+  AMTGDGVND+ +LK A++GIAMG+ G+DV KEA+ IVL+DDNF +I++A+EEG+ +  NI+ FV   L+ ++A    +    +F+  N     PL+P+++LWI ++    PA  LG+E A PD++ +PP      I    +II+     ++++ +C+    G+L+  N
Sbjct:   22 TEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEE---ETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETY-------NIYG-KGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFD----GLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGIN 920          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: ENA1 (P-type ATPase sodium pump; involved in Na+ and Li+ efflux to allow salt tolerance [Source:SGD;Acc:S000002447])

HSP 1 Score: 341.273 bits (874), Expect = 1.213e-101
Identity = 279/914 (30.53%), Postives = 439/914 (48.03%), Query Frame = 2
Query:  140 EISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQ------SEEPPK-----------------------TPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEM--------TITNIISSAGENAFATGVG-------YAP-------DGEVKIETPNGLRLFSYN-----DDLIIRKIIEIGCLCNNASITSGILS------GQPTEGAFITLGNKVKL----------------NDLN-----------LYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQI--LTDAKISQIKQEVGFLGSSGMRVIGLA-EGWDPNQ-------------------MVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH---------CMSGDELDLVASNLMSEELDRVTVF----YRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPN-----PLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIIN-----VVLSATCIV--IGTLWIFN 2473
            E +E +  +L  GL+  E   R    G N    D +         Q    MI++LL+S  +S  M  +     I+  I + V +  +QEY++ K + +LK L  P  H IR+G++  I + ++VPGD+ ++ VGD IPADLRL ET +   DES  TGE+ PV K A ++F + E           N+A+  + V  G  KG+V+ T  NSE G+I K +Q      S +P K                       TPL + +  L   L   +     +++        + +A++ I V+L++  IP  L +V+T+T+++G   M  RN IV+KL ++E LG VN ICSDKTGTLT+ +M            I  S  ++ F    G       ++P       DG+V I      RL+  +     D  + +K +E   L N A++     +      G PTE A      K+ L                ND +             +  + E+PF S  K M   Y     E         +IY  KGA E ++S C+ +Y   G +I  LTD  +  I++ V  L + G+RV+G A + +  +Q                   +VF G++GI DPP++    +V    Q+G+ V M+TGD + TA +IA ++GI    L H          M+G + D     L  EE+D + V      R SP+ K  +++    RK+   MTGDGVND+ +LK A++GIAMG+ G+DV KEA+ IVL+DDNF +I++A+EEG+ +  NI+ FV   L+ ++A    +    +F+  N     PL+P+++LWI ++    PA  LG+E A PD++ +PP      I    +II+     ++++ +C+    G+L+  N
Sbjct:   24 EAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKIDYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEE---ETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRVAIYAICVALSM--IPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETY-------NIYG-KGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFD----GLSEEEVDDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLYGIN 920          
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Match: PMA1 (Plasma membrane P2-type H+-ATPase; pumps protons out of cell; major regulator of cytoplasmic pH and plasma membrane potential; long-lived protein asymmetrically distributed at plasma membrane between mother cells and buds; accumulates at high levels in mother cells during aging, buds emerge with very low levels of Pma1p, newborn cells have low levels of Pma1p; Hsp30p plays a role in Pma1p regulation; interactions with Std1p appear to propagate [GAR+] [Source:SGD;Acc:S000002976])

HSP 1 Score: 197.978 bits (502), Expect = 8.053e-53
Identity = 189/695 (27.19%), Postives = 324/695 (46.62%), Query Frame = 2
Query:  149 ELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLF-ETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFI-TLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRP--GLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSI 2221
            E L  +   GL+S E  +R+  YG N    D++E L  K+   F  P+  ++  +A ++  +  + D   I   +++   V F+QE+++   ++ LK+ +      IRDGQ + I A E+VPGD++ L  G  IP D R+  E   L ID+S+ TGE+  V+K                     +  +  + V+ G G  VV  TG N+  G    ++      +    + ++ +G  L +     + L+      +   ++ +    + + +  +P GLP VVT T+A+G   +AK+ AIV+KL A+E+L  V ++CSDKTGTLTKN++++    +  G +                            DDL++       CL  +     G+      + AF+ +L    K  D    Y  L+  PF   +K +    ++   E+         I  VKGA   VL +    +    P+ + +      + +V  L S G R +G+A           GV+  +DPP+    ++V+  +  G++V M+TGDA+  A     +LG+       +    G   D+  S L ++ ++    F    P+HK  +V++ Q+R  +VAMTGDGVNDA +LK AD GIA+    TD  + AA IV        I+DA++  + IFH + ++V ++++ S+
Sbjct:   78 EYLQTDPSYGLTSDEVLKRRKKYGLNQMA-DEKESLVVKFVMFFVGPIQFVMEAAAILAAGLSDWVDFGVICGLLMLNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDK------------------HYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVLVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSP---------------------------DDLML-----TACLAASRK-KKGL---DAIDKAFLKSLKQYPKAKDALTKYKVLEFHPFDPVSKKVTAVVESPEGER---------IVCVKGAPLFVLKTVEEDHPI--PEDVHE----NYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLGLGGGGDMPGSEL-ADFVENADGFAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL 700          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 919.842 bits (2376), Expect = 0.000e+0
Identity = 518/899 (57.62%), Postives = 658/899 (73.19%), Query Frame = 2
Query:   89 IMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKI-ETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCI 2782
            +M T + +   S     E+ +  + +  RGLS+ E ++R++++G N+F+  +E+ LW KY  QFKEPMILLLL S FVS+CM QFDDA SITVAI+IVVTVAF+QEYRS+K++EA+ +L+PP+ HC+R G+    +A  LVPGD+V +++GDR+PAD+RL E VDL IDESSFTGE EP  KT          +         N+A+MGTLVR G GKGVV+GTG+NSEFGEIFK+M++EE PKTPLQKSMD LGKQLS YS  IIGLIV++G +Q R ++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RMAKRNAIVKKLP VETLGC +VICSDKTGTLTKNEMT++ I ++ G  A ATGVGY+P GEV + E P      +Y  +  I K +E G LCNNASI +G+L GQPTEGA +T+  K       + + R+ E PFSSE K+M VK + K        I +D IY+VKGA E V+  CT YY       +T   + +I   V  + S G+RVI  A G D  Q+ + G++G++DPP++ V E+V  +  SGV+V MITGD+ ETA +IA  LGI   G    +SG+EL+ +    +S  +D+V+VFYR SP+HK  IVK  Q    +VAMTGDGVNDA+ALK ADIGIAMG  GTDV KEAA ++L DD+F TI+ A+EEGK IF+NI+NFVRFQLSTSIAA+SLIT ST  + PNPLN MQILWINI+MDGPPAQSLGVEP D D++++PPR V   ++ + LI  V+ +A  IV GTLW+F REM DN +TPRDTTMTFTCFV FDMFNALSCRSQ+KSIF +GF TN++F+ +VG SL+GQ LVIY  PLQ +FQTEAL+I+D+LLL+A++SSVF+V EI+K I
Sbjct:    1 MMATVISSCAASAMAVEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASGFVSICMGQFDDAFSITVAILIVVTVAFVQEYRSDKSVEAITKLVPPQCHCVRAGKMFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLEIDESSFTGEMEPASKTT---LPIPAVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLSFYSLCIIGLIVLLGWIQKRAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPLGEVILNEDP-----ITYTSNSSIAKTVEAGYLCNNASIRNGVLYGQPTEGAIVTVAQKASTFTCGIDFVRVDERPFSSEKKLMAVKCRRKHRSSAMAEIARD-IYYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGDAVLAMSSRGLRVIAFAHGEDLQQLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKG-RPTLSGEELEALDGLQLSTIIDQVSVFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVKSPMITKTLIAKVISAALLIVCGTLWVFWREMRDNIITPRDTTMTFTCFVFFDMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFI 889          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 380.178 bits (975), Expect = 3.937e-116
Identity = 313/997 (31.39%), Postives = 493/997 (49.45%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQT--MAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS---------LYSFXXXX-XXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIIS----SAGENAF----ATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILS------GQPTEGAFITLGNKVKLNDLNL------------------YYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSG--MRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH---CMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIG-TLWIFNREMSDNKVTP-------------------------RDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            K   EI +  +V+  +GL   + KQ +  +GPN+   +  +PLW     QF + ++ +LL++A +S  +  F++    T A +  + +  I          QE  +E A+EALK+  P      R  ++    I A +LVPGD+V + VGD++PAD+R+   ++  L +D+S  TGE+  V K  + +      D        TN+ + GT +  G   GVVVGTG +++ G+I   M   +  +TPLQ+ +D  G+QLS         +++  I      I G    +  +  F I V+LAVAAIPEGLP VVT+ LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++         S G   F      G  Y P G++   T +G R  + +D  ++ +   I  LCN++S+    +       G+ TE A I L  K+ + +++L                  ++ +     FS + K M V Y     +   + +      FVKGA E +L  C           +T    +QI   +   G+    +R + LA   DP                  + M F GV G++DPP+  V +++ +  ++G++V++ITGD   TA +I  ++ +F    D      SG E D +  +   E   R  +F R  P HKS IV   Q   +I AMTGDGVNDA ALK A+IG+AMG  GT V K A+ ++L DDNF TIV A+EEG++I+ N + F+R+ +S++I  +  I  +     P  L P+Q+LW+N++ DGPPA +L   P D DI+ +PPR   + +++     R L I V +   C  +G + W F    +  KV+                             TM  +  V  +MFNAL+  ++ +S+ T+    N   + ++  S +   L++Y P    IF+   L   + + ++  +  V ++ E+ K I R
Sbjct:    7 KPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKPLWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTAFVEPIVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQMIKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIP-----DERAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVHKFFVMKDISRGRAEFHEFEVEGTTYDPVGDI---TKDG-RNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSV-YCVPQKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYESHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDTTGLSYSGREFDDLTPSEQREACLRARLFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMG-SGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPRQPLISGWLFFRYLAIGVYVG--CATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPSFGLDCAVFGDLHPMTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISR 990          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 298.13 bits (762), Expect = 7.092e-86
Identity = 266/908 (29.30%), Postives = 419/908 (46.15%), Query Frame = 2
Query:  395 FIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMD-----ILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSG----------ILSGQPTEGAFIT-----LGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGW---------------DPN----QMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHC-----------------------MSGDELDLVASNLMSEELDRV------TVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRK-VAESILNRRLI------------------INVVLSATCIVIGTLWIFN-REMSDNKVT-------------PRDTTMTFTC-------FVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            + QE +S K +++ K ++P +   +RDG+ +   A ++V GD++ + +GDR+PAD+R+ E+    +D SS TGE+EP  +  E          H+   +  N+A+  T    G+  G+VV TG N+  G I  +       KTP+   +      I G  ++L   G+   I+ + L        +F IG+   VA +PEGL   VTV L +   RMA +N +VK L AVETLG  + ICSDKTGTLT+N MT+ ++          T    +     K ET   L                I  LCN A   SG           + G  +E A +      +G+  K+ +    + R+ E PF+S  K  +  ++       EN  +   +  +KGA ERVL  C+        + L D      +     LG  G RV+G A+ +               +PN     + F G++ +IDPP+  V ++VA  + +G+KV M+TGD   TA +IA  +GI   G +                         + G EL     ++  +++D +       VF RTSP+ K +IV+  Q    IVA+TGDGVND+ ALK ADIGIAMG+ G+DV K+AA ++L DDNF +IV  +EEG+ IF N++  + + L+++I  ++      +   P PL  + IL I++  D  PA SL  E A+ DI+K+ PR    E ++N RLI                    V+++    + G L  FN R + ++K                +   + FTC        V+    + + C++++ SI T     N I II +         ++Y P L        L  S   + +  +  +FV  E+++ I R +
Sbjct:  183 YYQESKSSKIMDSFKNMVPQEATILRDGKKVVKNAEQVVIGDIIFVAIGDRVPADIRVIESKGFKVDNSSLTGESEPQARGPEF--------THENPLETKNLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVAL---GVTFFIISLVLGYTILQAVIFLIGI--IVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQSGTAMEKTETWTALG--------------RIAGLCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVELQVGSVTKMRE---EFHRVAEIPFNSTNKYHVSIHEI----NDENSTYSHHL-LMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVLGFAQHYLDKENFPIGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGEL----KDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLISMTYGQIGFMQASAGFLTYFVIMAENGFLPGDL--FNIRGLWEDKTNNTLLDSYGQEWGYAQRKVLEFTCHSAFFVSIVVVQWADLIICKTRRNSIITQKM-NNHILIIGLIFETALAAFLLYTPGLSTALSLYGLNASWWFIGVPYSILIFVYDEVRRYILRKY 1048          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 294.278 bits (752), Expect = 1.637e-84
Identity = 251/853 (29.43%), Postives = 396/853 (46.42%), Query Frame = 2
Query:  140 EISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDA-------------ISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDC-HQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMD-----------ILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGI---------LSGQPTEGAFI-----TLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQ-----TKATEQGENLIFQD----DIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQ--------------------MVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHC--------MSGDELDLVASNLM-----------SEELDRV------TVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRK-VAESILNRRLI 2416
            E+   L  N+  GL+  EA  R    GPN        P W K+  Q      +LL + A +    +   +A             I +   +I+    ++ QE +S K +E+ K L+P + + +R G    + A  LV GDVV +  GDR+P D+R+ E     +D SS TGE+EP  +           DC H+   +  N+A+  T    G+  GVVV TG N+  G I  +       KTP+   ++            LG    + +F +    +            +F IG+   VA +PEGL   VTV L +   RMA +N +VK L AVETLG  + ICSDKTGTLT+N MT+ ++        +   +  A   E + +     +  ++        +  +  LCN A   +            +G  +E A +      +GN +        + ++ E PF+S  K  +  ++         E+G ++  ++     I  +KGA ER+L  C+        Q L D +     Q    LG  G RV+G    + P +                    + F G++ +IDPP+  V ++V+  + +G+KV+M+TGD   TA +IA  +GI   G +          +  +E+D   +  +            E++D +       VF RTSP+ K +IV+  Q    IVA+TGDGVND+ ALK ADIG+AMG+ G+DV K+AA ++L DDNF +IV  +EEG+ IF N++  + + L+++I  +S      +   P PL  + IL I++  D  PA SL  E A+ DI+K+ PR  + + ++N RLI
Sbjct:   78 ELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPPPTTPEWVKFMKQMFGGFAMLLWIGAILCFIAQGIMEATEEEPLRDNLYLGIVLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLRSGGRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKSFKVDNSSLTGESEPQSRGP---------DCTHENPLETRNLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAFILKYKWLEA---------VIFLIGI--IVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLW-------YDNNIVEADTSEDQKQASGEKKSTTW------YALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVELAIGNVISFRK---NHKKVCEIPFNSTNKYQVSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQAYLDLGGLGERVLGFCHFYLPTEQFPLGFEFDPEDNPNFPLEGLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQEKIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPRDPINDKLVNERLI 894          
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Match: EDO41775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I0])

HSP 1 Score: 240.736 bits (613), Expect = 6.514e-66
Identity = 192/643 (29.86%), Postives = 309/643 (48.06%), Query Frame = 2
Query:  938 FTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGC--LCNNASITSGILSGQPTEGAFITLGNKVK----------------LNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAG-PQILTDAK-ISQIKQEVGFLGSSGMRVIGLA---------------EGWDP-----NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDH-CMSGDELD--------LVASNLMSEELDRVTVFYRTSPKHKSVIVK-VYQSR----KQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINV-------VLSATCIVIGTLWIFNRE---MSDNKVTP-RDTTMTFTCFVLFDMFNALSCR--SQKKSIFTIGFTTNKIFIISVGLSLVGQILVI 2665
            F  G+++ V A+PEGLP+ VT++LA    +M   N +V+ L A ET+G    ICSDKTGTLT N MT+  + +                G+     P   + FS        +++EI C  +  N+S  S  +     E   + +GNK +                  D N   T +K + F+S  K M      +  + G  L       F KGA E +LS CT      G P+  +    +S ++  +  + S G+R I +A                 WD      ++M    + GI DP +  V  ++   QQ+G+ V M+TGD + TA SIA K GI  P  D   + G E +         V+     E   R+ V  R+SP+ K  +VK +  S+    ++IVA+TGDG ND  ALK AD+G AMG+ GTDV KEA+ I+LTDDNF +IV A+  G+ ++ +I  F++FQL+ ++ A+ +          +PL   Q+LW+N++MD   + +L  EP   +++ + P    + ++ R +I N+       ++    +V      F+ E   + + +  P + + + F  FVL  +FN ++ R    ++++F  G   N IF+  +G + + QIL+I
Sbjct:  388 FITGLTVLVVAVPEGLPLAVTISLAYSVKKMLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLYTM---------------GQHHKTIPENPKEFS-------PELLEILCKGIALNSSYASNCVVNGGREILPMQVGNKTECALLGLVLDLGDTYQDYRDNNPESTFVKVYTFNSSRKSM--STAIRMPDGGYRL-------FSKGASEILLSRCTSIIGRNGQPEPFSSQDCLSLVQSVIEPMASDGLRTICMAYRDFPPTGKDHDDTPPDWDDEAGILSEMTAIAIAGIEDPVRQEVPAAIKKCQQAGIVVRMVTGDNVNTARSIAGKCGILEPDKDFLVLDGKEFNKLIRDSNGRVSQKKFDEIWPRLRVLARSSPEDKYTLVKGIIDSKLNPAREIVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFRSIVMAVMWGRNVYDSISKFLQFQLTVNLVAIVIAFVGACVVEVSPLTGTQLLWVNLIMDSFASLALATEPPTEELLTRKPYGRTKPLITRTMIRNILGHGVYQIIVLFVLVFKGAEFFDIEDGFLEETRCKPTQHSAVIFNTFVLMQLFNEINSRMVHGERNVFK-GIFRNPIFVGIMGGTFIVQILII 998          

HSP 2 Score: 61.6178 bits (148), Expect = 1.635e-9
Identity = 52/178 (29.21%), Postives = 89/178 (50.00%), Query Frame = 2
Query:  155 LHVNLLRGLSSV--EAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFD--------------DAISXXXXXXXXXXXXFIQEYRSEKALEALKQL--MPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEK 634
            LH +  +G+S    + + RK V+GPN       +  W       K+  +++L ++A VSL +  F               D  +I +A+ IV  V  + +Y+ E+    L+    +  K   IR+G    I+ +E+V GD+  +  GD +PAD  + ++ DL +DESS TGE++ V+K
Sbjct:   63 LHTSTEKGISGFPEDIENRKRVFGPNVIPPKPPKTFWEFLVDACKDTTLIILTVAAVVSLLLGIFAPEECGGSEANTGWIDGFAILIAVCIVALVTAVNDYQKEQQFRGLQSKIELEHKFTVIRNGDAKEILNSEIVVGDLCQIKYGDLLPADGVVVQSNDLKVDESSLTGESDMVKK 240          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: atp2c1 (ATPase secretory pathway Ca2+ transporting 1 [Source:NCBI gene;Acc:101159413])

HSP 1 Score: 907.901 bits (2345), Expect = 0.000e+0
Identity = 510/903 (56.48%), Postives = 662/903 (73.31%), Query Frame = 2
Query:   92 MLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKI--ETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVK--YQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIER 2788
            +LTS +AS +     NE+   L  +L  GL+  E  +R+  +G N+F+  ++EPLW KY  QFK+P+ILLLL SA +S+ MRQFDDAISITVAIIIVVTVAF+QEYRSEK+LE L +L+PP+ HCIR+G+   ++A +LVPGD V L+VG+R+PADLRLFE +DL +DESS TGET P  K+     + +  D        +N+A+MGTLVRCG  KG+V+GTG+NSEFGEIFKMMQ+EE PKTPLQKSMD+LGKQLSLYSF IIG+I+++G LQG++++ +FTIGVSLAVAAIPEGLPIVVTVTLA+G  RM K+ AIVKKLP VETLGC NVICSDKTGTLTKNEMT+T + ++ G +A  TGVGY   GEV +  E   G    S      I KI+E GC+CN++ I +  L G+PTEGA + L  K+ L  +   Y RL+E PFSSE K M V+  ++T+  + G        +YFVKGA E+V+  C+ Y +      L   +    +Q++ ++GSSG+RV+  A G     + F G+ GI+DPP+  V+E+++ +  SGV V MITGD+ ETA SIAS+LG+   G    +SG+E+D +    +S  + R+ VFYR SP+HK  IVK  QS   +VAMTGDGVNDA+ALK+ADIG+AMG  GTDVCKEAA ++L DD+F TI+ A+EEGK I++NI+NFVRFQLSTSIAAL+LI+ +TL  +PNPLN MQILWINI+MDGPPAQSLGVEP D D+I++PPR V +SI+ R LI  V++SA  IV GTL++F RE+ DN +TPRDTTMTFTCFVLFDMFNALS RSQ + +  IG  +N+ F  +V  SL+GQ+LVIY PPLQ +FQTE+L + DLL L+A+ S+V +VSE+ K +ER
Sbjct:   24 VLTSRRASELP---VNEVVCTLQADLQGGLTQEEVCRRRAYHGWNEFDISEDEPLWRKYMSQFKDPLILLLLASAVISVLMRQFDDAISITVAIIIVVTVAFVQEYRSEKSLEELGKLVPPECHCIREGRLEQMLARDLVPGDTVCLSVGERVPADLRLFEALDLSVDESSLTGETTPCSKSTAPQPTASNRD----IASRSNIAFMGTLVRCGKAKGIVIGTGENSEFGEIFKMMQAEEAPKTPLQKSMDLLGKQLSLYSFCIIGVIMLVGWLQGKKILDMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMVKKRAIVKKLPIVETLGCCNVICSDKTGTLTKNEMTVTQLFTADGLHAEVTGVGYNGAGEVLLSGEVVQGFSCPS------ISKIVEAGCVCNDSVIRNNNLLGRPTEGALVALAMKMGLEGVQQEYVRLEEQPFSSEQKWMAVRCVHRTQQDKAG--------VYFVKGAFEQVVRFCSSYSSRGAALPLNSQQRELYQQQISYMGSSGLRVLAFASGSQMGNLTFLGLAGIMDPPREGVKEAISALTSSGVTVKMITGDSQETAMSIASRLGLLSKGC-QSLSGEEVDHLDLQQLSHVVLRIAVFYRASPRHKLKIVKSLQSLGAVVAMTGDGVNDAVALKAADIGVAMGQTGTDVCKEAADMILVDDDFQTIMSAIEEGKGIYNNIKNFVRFQLSTSIAALTLISLATLMNFPNPLNAMQILWINIIMDGPPAQSLGVEPVDRDVIRKPPRNVKDSIITRGLIAKVLVSAMIIVCGTLFVFWRELQDNVITPRDTTMTFTCFVLFDMFNALSSRSQTRMVHEIGLCSNRTFCYAVLASLMGQLLVIYFPPLQSVFQTESLSVFDLLFLVALTSTVCIVSELIKKVER 904          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000013513.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101161069])

HSP 1 Score: 395.586 bits (1015), Expect = 1.245e-121
Identity = 333/1000 (33.30%), Postives = 499/1000 (49.90%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXX---------XXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITN--IISSAG-ENAFA-----TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRLKE------------------WPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDA---KISQIKQEVGFLGSSGMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATC----------------IVIGTLWIFNREMSDN--------KV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            K   E+    +VN   GLS  E ++++  +GPN+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R  +     I A ++VPGD+V + VGD++PAD+RL   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV T  N+E G+I   M S E  +TPLQ+ +D  G+QLS + S   I             + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++    I+  AG ++ F      TG  YAPDG V       ++   Y D L+  ++  I  LCN++++      G+    G+ TE A   L  K+ + D +L      E                    FS + K M V             +F      VKGA E V+  CTH    +    +T A   KI  + +E G  G   +R + LA   +P                    + F G VG++DPP+  V  S+ + + +G++V+MITGD   TA +I  ++GIF    D      +G E D ++     E + +   F R  P HKS IV+  QS  +I AMTGDGVNDA ALK ++IGIAMG  GT V K A+ +VL DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  +    +P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R LII   + A                  I    L  F +   DN        KV  +P   TM  +  V  +M NAL+  S+ +S+  +    N   + S+ LS+    L++Y  PL  IFQ   L ++  L+++ I+  V ++ E+ K   RN+
Sbjct:    7 KTVEEVLSFFNVNESTGLSLEEVRKQRDRFGPNELPAEEGKSLWELVLEQFEDLLVRILLLAACISFALAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEIAVGDKVPADIRLVSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGKAVGVVVATAGNTEIGKIRDEMASTEQERTPLQQKLDEFGQQLSKVISLICIAVWIINIGHFSDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKAGSDHCFLKEFTITGSTYAPDGAV-FHNEKPVKCSQY-DGLV--ELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKSLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSLGKMF------VKGAPEGVIDRCTHIRVGSTKMPMTPAIKDKIMSVIREYG-TGRDTLRCLALATRDEPLHKDRLVLEDSTRFIEYETDLTFVGCVGMLDPPRAEVAASIRLCRLAGIRVIMITGDNKGTAVAICRRIGIFGEEDDVSSMAFTGREFDDLSPAAQREAVVKARCFARVEPAHKSKIVEYLQSYDEITAMTGDGVNDAPALKKSEIGIAMG-SGTAVAKSASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTKPPRNAREPLISGWLFFRYLIIGCYVGAATVGAAAWWFVAAEDGPRITFYQLSHFLQCAPDNPDYLNVDCKVFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGSICLSMALHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDELLKFAARNY 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000013512.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101161069])

HSP 1 Score: 396.356 bits (1017), Expect = 1.888e-121
Identity = 333/1000 (33.30%), Postives = 499/1000 (49.90%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS-LYSFXXXX---------XXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITN--IISSAG-ENAFA-----TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRLKE------------------WPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDA---KISQIKQEVGFLGSSGMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATC----------------IVIGTLWIFNREMSDN--------KV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            K   E+    +VN   GLS  E ++++  +GPN+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R  +     I A ++VPGD+V + VGD++PAD+RL   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV T  N+E G+I   M S E  +TPLQ+ +D  G+QLS + S   I             + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++    I+  AG ++ F      TG  YAPDG V       ++   Y D L+  ++  I  LCN++++      G+    G+ TE A   L  K+ + D +L      E                    FS + K M V             +F      VKGA E V+  CTH    +    +T A   KI  + +E G  G   +R + LA   +P                    + F G VG++DPP+  V  S+ + + +G++V+MITGD   TA +I  ++GIF    D      +G E D ++     E + +   F R  P HKS IV+  QS  +I AMTGDGVNDA ALK ++IGIAMG  GT V K A+ +VL DDNF TIV A+EEG+AI++N++ F+R+ +S+++  +  I  +    +P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R LII   + A                  I    L  F +   DN        KV  +P   TM  +  V  +M NAL+  S+ +S+  +    N   + S+ LS+    L++Y  PL  IFQ   L ++  L+++ I+  V ++ E+ K   RN+
Sbjct:    7 KTVEEVLSFFNVNESTGLSLEEVRKQRDRFGPNELPAEEGKSLWELVLEQFEDLLVRILLLAACISFALAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDRKSVQRIKARDIVPGDIVEIAVGDKVPADIRLVSIKSTTLRVDQSILTGESVSVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGKAVGVVVATAGNTEIGKIRDEMASTEQERTPLQQKLDEFGQQLSKVISLICIAVWIINIGHFSDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDKAGSDHCFLKEFTITGSTYAPDGAV-FHNEKPVKCSQY-DGLV--ELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLKSLSKVERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKARSSLGKMF------VKGAPEGVIDRCTHIRVGSTKMPMTPAIKDKIMSVIREYG-TGRDTLRCLALATRDEPLHKDRLVLEDSTRFIEYETDLTFVGCVGMLDPPRAEVAASIRLCRLAGIRVIMITGDNKGTAVAICRRIGIFGEEDDVSSMAFTGREFDDLSPAAQREAVVKARCFARVEPAHKSKIVEYLQSYDEITAMTGDGVNDAPALKKSEIGIAMG-SGTAVAKSASEMVLADDNFATIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMTKPPRNAREPLISGWLFFRYLIIGCYVGAATVGAAAWWFVAAEDGPRITFYQLSHFLQCAPDNPDYLNVDCKVFESPYPMTMALSVLVTIEMCNALNSVSENQSLLRMPPWENVWLLGSICLSMALHFLILYVEPLPMIFQITPLNLTQWLMVLKISLPVILLDELLKFAARNY 989          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: si:dkey-28b4.8 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like [Source:NCBI gene;Acc:101159722])

HSP 1 Score: 386.341 bits (991), Expect = 1.456e-117
Identity = 319/1014 (31.46%), Postives = 497/1014 (49.01%), Query Frame = 2
Query:  119 ISNKNTNEISELL---HVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQ--TMAIMATELVPGDVVILNVGDRIPADLRLFE--TVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLS---------LYSFXXXXXXX-XXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNII---SSAGE----NAFA-TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRLKE------------------WPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQI-----LTDAKISQIKQEVGFLGSSGMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFR--------PGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLWIFNREMSDNKV---------------------------TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            + N +T  + E+L    VN   GLS  + K+ +  +GPN+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R  +     I A ++VPGD+V + VGD++PAD+RL    +  L +D+S  TGE+  + K  + +      D         N+ + GT +  G   GVV+ TG  +E G+I   M + EP +TPLQ+ +D  G+QLS         +++  +      + G    R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMA++NAIV+ LP+VETLGC +VICSDKTGTLT N+M++  +    S +GE    N F+ TG  YAP+G+V       ++   Y     + ++  I  LCN++S+    + G+    G+ TE A   L  K+ + D +L      E                    FS + K M V   T    +  +        FVKGA E VL  C++       ++     + +  +S ++      G   +R + +A    P                    + F G VG++DPP+  V  +V + +Q+G++V+MITGD   TA SI  ++GI           G+   ++G E D +   L  +    V  F R  P HKS IV+  QS   I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ ++L DDNF TIV A+EEG+AI++N++ F+R+ +S++I  +  I  +     P  L P+Q+LW+N++ DG PA +LG  P D DI+ +PPR   E +++     R LII   +     V    W F       KV                           +P   TM  +  V  +M NAL+  S+ +S+  +    N   + ++ LS+    L++Y  PL  +FQ   L  +  ++++ ++  V ++ E  K + RN+
Sbjct:    1 MDNAHTKTVEEVLCFFGVNESTGLSCEQLKKNRDQWGPNELPAEEGKSLWELILEQFEDLLVRILLLAACISFTLAWFEEGEGTITAFVEPFVILLILIANAIVGVWQERNAENAIEALKEYEPEMGKVYRQDKKSVQRIRARDIVPGDIVEVAVGDKVPADIRLTSICSTTLRVDQSILTGESVSILKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGRAIGVVIATGVQTEIGKIRDEMAATEPERTPLQQKLDQFGEQLSKVISVICVAVWAINVGHFNDPVHGGSWLRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIVDSVSGETCSLNDFSVTGSTYAPEGDV-FRDGVAVKCSQYEG---LVEMASICALCNDSSLDYNESKGVFEKVGEATETALCCLVEKMNVFDTDLRGLSRAERATACCSVIKQLMRKELTLEFSRDRKSMSVFCSTNKLSRSPS----GAKMFVKGAPESVLERCSYIRVKGSARVPMSMAVREQLLSTVRDWTS--GRDTLRCLAMATRDTPPDINSLNLENSATFVDYETDLTFVGCVGMLDPPRKEVLGAVRMCRQAGIRVIMITGDNKGTALSICRRVGIITEQEEEQGGAGIMGGLTGREFDELPPALQRQACQTVRCFARVEPAHKSRIVEYLQSLSDITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMILADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGFPATALGFNPPDLDIMLRPPRSPKEPLISNWLFFRYLIIGCYVGGA-TVGAAAWWFMAAHDGPKVSFYQLSHYLQCSEGHAEFAGVQCSVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLKMPPWANPWLVGAICLSMALHFLILYVDPLPVVFQIRPLSWTQWVVVLKLSLPVILMDEALKFLARNY 997          
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Match: ENSORLT00000019901.2 (sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Source:NCBI gene;Acc:101160819])

HSP 1 Score: 383.259 bits (983), Expect = 5.343e-117
Identity = 324/1000 (32.40%), Postives = 506/1000 (50.60%), Query Frame = 2
Query:  128 KNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIR-DGQTMA-IMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXX----------XXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITN--IISSAGENAFA------TGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLNLYYTRL----------------KE--WPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDA---KISQIKQEVGFLGSSGMRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD---HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVV------------LSATCIVIG------TLWIFNREMS-----------DNKV--TPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNH 2794
            K+  E+     VN   GLS  E K++K  +G N+   ++ + LW     QF++ ++ +LLL+A +S  +  F++      A +    +  I          QE  +E A+EALK+  P      R D +T+  I A ++VPGD+V + VGD++PAD+R+   ++  L +D+S  TGE+  V K  + +      D         N+ + GT +  G   GVVV TG N+E G+I   M + E  KTPLQ+ +D  G+QLS     I   + II +             R  +  F I V+LAVAAIPEGLP V+T  LA+G  RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+M++    +++ A  ++ +      TG  YAP+GEV  +    L   S  D L+  ++  I  LCN++S+      G+    G+ TE A   L  K+ + D  ++   +                KE    FS + K M V      +      +F      +KGA E V+  CT+         L+     KI  + +E G  G   +R + LA   +P                  + + F G VG++DPP+  V  S+ +  Q+G++V+MITGD   TA +I  ++GI     D      +G E D ++     E + R   F R  P HKS IV+  Q   +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL DDNF +IV A+EEG+AI++N++ F+R+ +S+++  +  I  +    +P  L P+Q+LW+N++ DG PA +LG  P D DI+++PPR   E++++  L    +             +A   ++       TL+  +  +            D +V  +P   TM  +  V  +M NAL+  S+ +S+  +    N   + ++ LS+    L++Y  PL  IFQ   L ++  ++++ I+  V ++ E+ K + RN+
Sbjct:    7 KSVEEVYSYFCVNESTGLSLEEVKRQKDKWGLNELPAEEGKSLWELVLEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAEDAIEALKEYEPEMGKVYRQDRKTVQRIKARDIVPGDIVEVAVGDKVPADIRICSIKSTTLRVDQSILTGESISVIKHTDPVP-----DPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQEKTPLQQKLDEFGEQLSKVISVICIAVWIINIGHFNDPVHGGSWIRGAVYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFVVNKAEGDSCSLSEFTITGSTYAPEGEVYQD--GNLVKCSQFDALV--ELATICALCNDSSLDFNEVKGVYEKVGEATETALTCLVEKMNVFDTEVHSLSMIDRANACNSVIKQLMKKECTLEFSRDRKSMSVYCTPNKSRSSMGKMF------IKGAPEGVIDRCTYIRVGNNKIPLSQGSKDKILSVIREYG-TGRDTLRCLALATRDNPPKLEDMILSDTARFSQYESDLTFVGCVGMLDPPRQEVAASIKLCHQAGIRVIMITGDNKGTAVAICRRIGILTEDDDVEQMAFTGREFDELSPYAQREAVTRARCFARVEPSHKSKIVEYLQGFDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKPPRNAKEALISGWLFFRYLAIGGYVGAATVGAAAWWFIVSEDGPQLTLYQLSHYLQCSPENPEFEGLDCQVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLLGAICLSMSLHFLILYVEPLPVIFQITPLDMTQWMMVLKISLPVILLDELLKFVARNY 989          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000023077.1 (SMESG000023077.1)

HSP 1 Score: 1793.09 bits (4643), Expect = 0.000e+0
Identity = 935/938 (99.68%), Postives = 938/938 (100.00%), Query Frame = 2
Query:   62 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV 2875
            MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASIT+GILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLS+CTHYYTFAGPQILTDAKISQIKQEVGFLG+SGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV
Sbjct:    1 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITNGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSNCTHYYTFAGPQILTDAKISQIKQEVGFLGNSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV 938          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000023077.1 (SMESG000023077.1)

HSP 1 Score: 1769.21 bits (4581), Expect = 0.000e+0
Identity = 927/938 (98.83%), Postives = 930/938 (99.15%), Query Frame = 2
Query:   62 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV 2875
            MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASIT+GILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATE        DDIYFVKGAVERVLS+CTHYYTFAGPQILTDAKISQIKQEVGFLG+SGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV
Sbjct:    1 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITNGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATE--------DDIYFVKGAVERVLSNCTHYYTFAGPQILTDAKISQIKQEVGFLGNSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV 930          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000023077.1 (SMESG000023077.1)

HSP 1 Score: 1754.18 bits (4542), Expect = 0.000e+0
Identity = 921/938 (98.19%), Postives = 924/938 (98.51%), Query Frame = 2
Query:   62 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV 2875
            MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASIT+GILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLS+CTHYYTFAGPQILTDAKISQIKQEVGFLG+SGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFY              QKKKTTSDEYV
Sbjct:    1 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITNGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSNCTHYYTFAGPQILTDAKISQIKQEVGFLGNSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFY--------------QKKKTTSDEYV 924          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000023077.1 (SMESG000023077.1)

HSP 1 Score: 1731.46 bits (4483), Expect = 0.000e+0
Identity = 913/938 (97.33%), Postives = 916/938 (97.65%), Query Frame = 2
Query:   62 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXXXXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV 2875
            MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASIT+GILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATE        DDIYFVKGAVERVLS+CTHYYTFAGPQILTDAKISQIKQEVGFLG+SGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFY              QKKKTTSDEYV
Sbjct:    1 MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISITVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELVPGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASITNGILSGQPTEGAFITLGNKVKLNDLNLYYTRLKEWPFSSETKMMMVKYQTKATE--------DDIYFVKGAVERVLSNCTHYYTFAGPQILTDAKISQIKQEVGFLGNSGMRVIGLAEGWDPNQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTLWIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVVSEIKKCIERNHFY--------------QKKKTTSDEYV 916          
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Match: SMESG000010260.1 (SMESG000010260.1)

HSP 1 Score: 385.185 bits (988), Expect = 1.568e-117
Identity = 314/1012 (31.03%), Postives = 503/1012 (49.70%), Query Frame = 2
Query:  125 NKNTNEISELLHVNLLRGLSSVEAKQRKLVYGPNDFEHDKEEPLWYKYACQFKEPMIXXXXXSAFVSLCMRQFDDAISXXXXXXXXXXXXFI----------QEYRSEKALEALKQLMPPKTHCIRDGQT--MAIMATELVPGDVVILNVGDRIPADLRL--FETVDLYIDESSFTGETEPVEKTAEILFSRTEFDCHQPTHQVTNVAYMGTLVRCXXXXXXXXXXXXNSEFGEIFKMMQSEEPPKTPLQKSMDILGKQLSLYSFXXXXXXXXXXX----------XXXXXXMALFTIGVSLAVAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKTGTLTKNEMTITNIISSAGENAFAT--------GVGYAPDGEVKIETPNGLRLFSYNDDLIIRKIIEIGCLCNNASI----TSGILS--GQPTEGAFITLGNKVKLNDLN----------------LYYTRLKEWPFS-SETKMMMVKYQTKATEQGE------NLIFQDDIYFVKGAVERVLSSCTHYYTFAGPQILTDAKISQIKQEVGFLGSSG--MRVIGLAEGWDP------------------NQMVFCGVVGIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIF---RPGLDHCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAMTGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEEGKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILMDGPPAQSLGVEPADPDIIKQPPRKVAESILN-----RRLIINVVLSATCIVIGTLWIFNR----EMSDNKVT--------PRD--------------TTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTNKIFIISVGLSLVGQILVIYCPPLQFIFQTEXXXXXXXXXXXXXXXXVFVVSEIKKCIERNHFYQVNIL 2815
            +K+ +++ +   V+   GL+  + +  +  YG N    ++ +PLW     QF + ++ +LL +A +S  +  FD +   T A +    +  I          QE  +E A++ALK+        IR        I A +LVPGD+V ++VGD++PAD+R+    +  L ID+S  TGE+  V K ++ +      D         N+ + GT V  G  +GVV   G N+E G+I   +   +  KTPL K +D   +QLS     I  ++ +I +             R  +  F I V+LAVAAIPEGLP V+T  L++G +RMAK+NAIV+ LP+VETLGC +VICSDKTGTLT N+MT++ +      N   T        G  Y+PDG++  +     +    +D   + ++ EI  LCN++S+    + G+    G+ TE A + L  K+ + ++N                +  T  KE+    S  +  M  + +    +G+      N         VKGA E +L  CT   T  G   +T++   QI ++V   G+    +R + LA   +P                  + M F G+VG++DPP+  V +S+   + +G++V++ITGD   TA +I  ++GIF      +    +G E D ++       +   ++F R  P HKS I++  Q   +I AMTGDGVNDA ALK A+IGIAMG  GT V K A+ +VL DDNF TIV A+EEG+AI++N++ F+R+ +S++I  +  I  +     P  L P+Q+LW+N++ DG PA +LG  P D DI+++PPR   ES+++     R + I   + A  +     W  +      +S  ++T        P D               TM  +  VL +M NAL+  S+ +S+  +    N   I+++ LS+    L++    L  +FQ   L  S+ L ++  +  V ++ E  K I RN  +  +I 
Sbjct:    6 SKSVHDVLDFFDVSDEFGLTDKQIELSQETYGVNGLPDEEGKPLWKLVLEQFDDLLVKILLSAAIISFILAWFDHSEDSTTAFVEPFVILLILILNAVVGVWQEKNAESAIDALKEYESENAKVIRSNHKGIQTIKAAQLVPGDIVEVSVGDKVPADIRIVKIHSTTLQIDQSILTGESRSVIKHSDAID-----DLLAVNQDKINMLFSGTNVASGKCRGVVTSIGLNTEIGKIRDQIMHTDQVKTPLTKKLDNFAEQLSKVITVICIVVWLINIGHFNDPIHGGSVLRGAIYYFKIAVALAVAAIPEGLPAVITTCLSLGTWRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMTVSRMFIVRNVNKDGTDIQEFEISGSKYSPDGDIFCQE----KRVKCSDIPQLYEVAEICSLCNDSSVEFNESKGVYEKVGEATETALVCLVEKMNMTNINKSTYSKKQLSTVCNSKIQSTVNKEFTLEFSRDRKSMSAFVSPINPEGDVQTTVRNHNITGPRLLVKGAPEGILDRCTFVRTSQGRVEMTNSIKDQIMKKVAAYGTGKDTLRCLALACVDEPVSRSRMDFANAGNFYKYESNMTFVGLVGMLDPPRSEVLDSIGACRNAGIRVIVITGDNKATAEAICRRIGIFGEDESTVGKSYTGREFDQLSDFEQRNAVRNASLFARVEPAHKSKIIEHLQRDGEISAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASDMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNIGEVVCIFLTAALGMPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRSPKESLISGWLFFRYMAIGCYVGAATVGSAAWWFMSSPNGPSVSYYQLTHHLQCATEPNDFIGVDCKVFLHSKPMTMALSVLVLIEMLNALNSLSENQSLVKMPPWRNIWLILAITLSMSLHFLILEVGFLSKVFQISPLSFSEWLTVMKFSFPVLLLDESLKIISRNQQHHKSIF 1007          
The following BLAST results are available for this feature:
BLAST of Calcium-transporting ATPase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2C10.000e+056.27ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ATP2C10.000e+056.27ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ATP2C10.000e+056.27ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ATP2C10.000e+056.27ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ATP2C10.000e+056.27ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pmr-10.000e+055.00Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
pmr-10.000e+054.95Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
pmr-10.000e+052.73Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-15.340e-11532.10Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
sca-15.340e-11532.10Calcium-transporting ATPase [Source:UniProtKB/TrE... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPoCk0.000e+057.17gene:FBgn0052451 transcript:FBtr0306600[more]
SPoCk0.000e+057.17gene:FBgn0052451 transcript:FBtr0302134[more]
SPoCk0.000e+056.94gene:FBgn0052451 transcript:FBtr0113437[more]
SPoCk0.000e+056.40gene:FBgn0052451 transcript:FBtr0474170[more]
SPoCk0.000e+057.17gene:FBgn0052451 transcript:FBtr0078532[more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2c10.000e+056.42ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2c10.000e+056.55ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2a34.910e-12233.53ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a36.230e-12233.53ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
atp2a2b8.139e-12033.20ATPase sarcoplasmic/endoplasmic reticulum Ca2+ tra... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP2C10.000e+056.42ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
ATP2C10.000e+056.53ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
ATP2C10.000e+055.28ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
ATP2C10.000e+054.57ATPase, Ca++ transporting, type 2C, member 1 [Sour... [more]
atp2c20.000e+056.47ATPase, Ca++ transporting, type 2C, member 2 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp2c10.000e+056.16ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:M... [more]
Atp2c10.000e+056.16ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:M... [more]
Atp2c10.000e+056.16ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:M... [more]
Atp2c10.000e+056.32ATPase, Ca++-sequestering [Source:MGI Symbol;Acc:M... [more]
Atp2c20.000e+055.32ATPase, Ca++ transporting, type 2C, member 2 [Sour... [more]
back to top
BLAST of Calcium-transporting ATPase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P57709|AT2C1_BOVIN0.000e+056.37Calcium-transporting ATPase type 2C member 1 OS=Bo... [more]
sp|Q64566|AT2C1_RAT0.000e+056.49Calcium-transporting ATPase type 2C member 1 OS=Ra... [more]
sp|Q80XR2|AT2C1_MOUSE0.000e+056.16Calcium-transporting ATPase type 2C member 1 OS=Mu... [more]
sp|P98194|AT2C1_HUMAN0.000e+056.27Calcium-transporting ATPase type 2C member 1 OS=Ho... [more]
sp|Q5R5K5|AT2C1_PONAB0.000e+056.38Calcium-transporting ATPase type 2C member 1 OS=Po... [more]
back to top
BLAST of Calcium-transporting ATPase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I6J30.000e+060.73Calcium-transporting ATPase OS=Lingula unguis OX=7... [more]
A0A1S3I5B60.000e+060.73Calcium-transporting ATPase OS=Lingula unguis OX=7... [more]
V3ZPC30.000e+057.79Calcium-transporting ATPase OS=Lottia gigantea OX=... [more]
R7VEJ70.000e+056.93Calcium-transporting ATPase OS=Capitella teleta OX... [more]
A0A3S1ADV70.000e+056.07Calcium-transporting ATPase OS=Elysia chlorotica O... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2c10.000e+055.57ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2a36.946e-12633.60sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
atp2a31.318e-12533.60sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSAMXT00000046993.19.208e-11832.67sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
si:dkey-28b4.83.292e-11731.82sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2c12.186e-16656.84ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
atp2c13.868e-15755.90ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ENSPMAT00000010373.11.700e-9633.49pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
ENSPMAT00000002888.12.808e-4927.90pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.18.418e-3929.53pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR10.000e+049.78High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
ENA53.075e-10330.57Protein with similarity to P-type ATPase sodium pu... [more]
ENA24.510e-10330.57P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA11.213e-10130.53P-type ATPase sodium pump; involved in Na+ and Li+... [more]
PMA18.053e-5327.19Plasma membrane P2-type H+-ATPase; pumps protons o... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356160.000e+057.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474653.937e-11631.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364557.092e-8629.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406801.637e-8429.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417756.514e-6629.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp2c10.000e+056.48ATPase secretory pathway Ca2+ transporting 1 [Sour... [more]
ENSORLT00000013513.21.245e-12133.30sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000013512.21.888e-12133.30sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
si:dkey-28b4.81.456e-11731.46sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
ENSORLT00000019901.25.343e-11732.40sarcoplasmic/endoplasmic reticulum calcium ATPase ... [more]
back to top
BLAST of Calcium-transporting ATPase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023077.10.000e+099.68SMESG000023077.1[more]
SMESG000023077.10.000e+098.83SMESG000023077.1[more]
SMESG000023077.10.000e+098.19SMESG000023077.1[more]
SMESG000023077.10.000e+097.33SMESG000023077.1[more]
SMESG000010260.11.568e-11731.03SMESG000010260.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035069 ID=SMED30035069|Name=Calcium-transporting ATPase|organism=Schmidtea mediterranea sexual|type=transcript|length=2908bp
CTAATCTGATACAATATTCAATTTTAATGAGTTTTATATTTTATATTGTT
ATTTGATATAAATGTCTAATACTGACCAAACACCCAAAATCATGTTAACA
TCTCTTAAAGCATCTCACATATCGAACAAGAACACTAACGAAATATCTGA
ACTTCTACATGTAAATTTACTAAGAGGGTTATCAAGTGTTGAAGCTAAAC
AACGGAAATTAGTTTATGGGCCAAATGATTTTGAACACGATAAAGAAGAA
CCGCTATGGTATAAATATGCATGCCAATTTAAAGAGCCCATGATTCTTTT
GCTACTTTTATCAGCCTTTGTCAGTCTTTGTATGCGCCAGTTTGACGATG
CTATCAGCATTACTGTTGCCATTATTATTGTCGTTACAGTAGCATTTATT
CAAGAGTATCGTTCTGAAAAAGCTTTGGAAGCACTCAAACAACTTATGCC
TCCTAAAACCCATTGTATTCGTGATGGCCAAACAATGGCAATAATGGCCA
CGGAATTAGTTCCCGGGGATGTTGTGATTCTCAATGTTGGAGATCGAATT
CCTGCCGATCTTCGGTTATTTGAAACCGTGGATTTATACATTGATGAATC
CAGTTTTACGGGTGAGACAGAACCAGTGGAAAAAACTGCGGAAATTTTAT
TTTCTCGAACTGAATTCGATTGTCATCAACCGACGCATCAAGTCACCAAT
GTGGCCTACATGGGAACTCTGGTACGCTGTGGATCCGGCAAGGGTGTCGT
GGTTGGCACTGGGAAAAATTCTGAATTCGGTGAAATATTTAAAATGATGC
AATCAGAGGAACCTCCGAAAACTCCTTTACAAAAGAGTATGGACATTCTT
GGCAAGCAATTGTCACTTTATTCGTTCGGTATCATCGGGTTGATTGTTAT
AATTGGTTTGTTACAAGGCAGGCAATTGATGGCACTGTTCACTATTGGAG
TGAGTTTGGCAGTAGCTGCAATACCAGAAGGACTGCCAATTGTGGTCACA
GTGACGTTGGCAATCGGGCAATTTAGAATGGCTAAAAGAAATGCCATTGT
TAAAAAGTTACCGGCTGTTGAAACACTTGGTTGTGTAAATGTTATTTGTT
CTGATAAAACTGGTACTCTTACAAAAAATGAGATGACAATCACCAACATT
ATTTCATCAGCGGGAGAAAACGCGTTTGCGACTGGAGTCGGGTACGCCCC
AGATGGGGAGGTGAAAATTGAAACACCGAATGGTTTGCGACTATTCAGTT
ACAATGATGATTTGATTATAAGGAAAATAATTGAGATTGGTTGTTTATGC
AACAATGCATCGATAACCAGCGGTATACTCAGTGGACAGCCTACAGAAGG
CGCTTTTATTACTTTAGGAAACAAAGTTAAACTCAATGATCTCAATCTTT
ACTATACAAGACTTAAAGAGTGGCCATTTTCTTCGGAAACTAAAATGATG
ATGGTTAAATATCAAACTAAAGCAACAGAACAAGGTGAAAATTTAATTTT
TCAAGATGACATCTATTTTGTGAAAGGTGCCGTTGAAAGGGTTTTGAGCA
GTTGTACCCATTACTATACATTCGCAGGTCCTCAAATATTGACGGATGCA
AAGATTTCACAGATCAAACAAGAAGTTGGTTTCCTAGGAAGCAGTGGAAT
GAGGGTTATTGGGTTAGCTGAAGGGTGGGATCCAAATCAAATGGTTTTTT
GTGGTGTTGTCGGTATTATTGATCCGCCGAAACATCGAGTTGAAGAGTCC
GTGGCTATCGTTCAGCAGTCAGGAGTCAAAGTTGTAATGATAACTGGAGA
TGCTATGGAGACTGCTTGTTCAATTGCTTCGAAACTTGGAATTTTTCGAC
CGGGTCTTGACCATTGCATGAGCGGGGATGAATTGGATCTCGTGGCATCA
AATTTAATGTCTGAAGAATTGGACCGAGTCACCGTTTTTTATCGGACATC
TCCTAAGCATAAATCTGTTATTGTAAAAGTTTATCAATCGAGAAAACAGA
TAGTTGCAATGACAGGCGATGGAGTCAACGATGCAATAGCTTTGAAATCA
GCTGATATTGGGATAGCAATGGGTTTGCAGGGAACCGACGTTTGCAAAGA
GGCTGCTGGTATTGTTCTCACTGATGACAATTTCGGAACAATCGTTGATG
CCATGGAAGAAGGGAAAGCCATTTTTCACAATATCAGAAATTTTGTCAGA
TTCCAATTGAGCACATCAATTGCTGCACTCTCGTTGATTACATTTTCCAC
TTTATTCCAATGGCCGAATCCGTTAAATCCCATGCAAATATTATGGATCA
ATATCCTAATGGACGGCCCTCCGGCACAGAGTTTAGGAGTGGAACCCGCT
GATCCTGATATTATCAAACAGCCGCCACGCAAGGTTGCTGAATCTATATT
AAATAGACGACTAATCATAAATGTGGTATTGTCAGCGACTTGCATTGTCA
TTGGTACTTTGTGGATATTCAATAGGGAAATGAGTGACAACAAAGTCACA
CCAAGAGACACTACCATGACATTTACATGCTTCGTTCTGTTTGACATGTT
TAATGCTCTTAGCTGTCGATCTCAGAAAAAATCCATTTTTACAATTGGGT
TTACAACAAATAAAATTTTTATAATATCTGTTGGATTGTCTCTCGTCGGG
CAAATATTGGTGATATATTGTCCTCCTTTACAATTTATTTTTCAGACTGA
AGCACTCTATATTTCAGATTTGTTATTACTGATCGCAATCGCTTCATCTG
TGTTTGTTGTATCTGAAATTAAAAAGTGTATTGAAAGAAATCATTTTTAT
CAAGTAAATATACTTTTGCGGTATCTTTTACGTAATCATTCCCAGAAAAA
GAAAACGACATCAGATGAATATGTATGAGACCATTTATTTTAATAAATTG
TTCAAATA
back to top

protein sequence of SMED30035069-orf-1

>SMED30035069-orf-1 ID=SMED30035069-orf-1|Name=SMED30035069-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=939bp
MSNTDQTPKIMLTSLKASHISNKNTNEISELLHVNLLRGLSSVEAKQRKL
VYGPNDFEHDKEEPLWYKYACQFKEPMILLLLLSAFVSLCMRQFDDAISI
TVAIIIVVTVAFIQEYRSEKALEALKQLMPPKTHCIRDGQTMAIMATELV
PGDVVILNVGDRIPADLRLFETVDLYIDESSFTGETEPVEKTAEILFSRT
EFDCHQPTHQVTNVAYMGTLVRCGSGKGVVVGTGKNSEFGEIFKMMQSEE
PPKTPLQKSMDILGKQLSLYSFGIIGLIVIIGLLQGRQLMALFTIGVSLA
VAAIPEGLPIVVTVTLAIGQFRMAKRNAIVKKLPAVETLGCVNVICSDKT
GTLTKNEMTITNIISSAGENAFATGVGYAPDGEVKIETPNGLRLFSYNDD
LIIRKIIEIGCLCNNASITSGILSGQPTEGAFITLGNKVKLNDLNLYYTR
LKEWPFSSETKMMMVKYQTKATEQGENLIFQDDIYFVKGAVERVLSSCTH
YYTFAGPQILTDAKISQIKQEVGFLGSSGMRVIGLAEGWDPNQMVFCGVV
GIIDPPKHRVEESVAIVQQSGVKVVMITGDAMETACSIASKLGIFRPGLD
HCMSGDELDLVASNLMSEELDRVTVFYRTSPKHKSVIVKVYQSRKQIVAM
TGDGVNDAIALKSADIGIAMGLQGTDVCKEAAGIVLTDDNFGTIVDAMEE
GKAIFHNIRNFVRFQLSTSIAALSLITFSTLFQWPNPLNPMQILWINILM
DGPPAQSLGVEPADPDIIKQPPRKVAESILNRRLIINVVLSATCIVIGTL
WIFNREMSDNKVTPRDTTMTFTCFVLFDMFNALSCRSQKKSIFTIGFTTN
KIFIISVGLSLVGQILVIYCPPLQFIFQTEALYISDLLLLIAIASSVFVV
SEIKKCIERNHFYQVNILLRYLLRNHSQKKKTTSDEYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: INTERPRO
TermDefinition
IPR001757P_typ_ATPase
IPR004014ATPase_P-typ_cation-transptr_N
IPR023298ATPase_P-typ_TM_dom_sf
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR006068ATPase_P-typ_cation-transptr_C
IPR018303ATPase_P-typ_P_site
IPR023214HAD_sf
IPR023299ATPase_P-typ_cyto_dom_N
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0070588calcium ion transmembrane transport
GO:0099132ATP hydrolysis coupled cation transmembrane transport