axis inhibition protein B

Overview
Nameaxis inhibition protein B (ADW27178.1)
Smed IDSMED30035066
Length (bp)2767
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of axis inhibition protein B (SMED30035066) t-SNE clustered cells

Violin plots show distribution of expression levels for axis inhibition protein B (SMED30035066) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of axis inhibition protein B (SMED30035066) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for axis inhibition protein B (SMED30035066) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035066

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 30

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30035066SMESG000025925.1 dd_Smed_v4_5531_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30035066SMESG000025925.1 dd_Smed_v4_5531_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30035066SMESG000025925.1 dd_Smed_v4_5531_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30035066SMESG000025925.1 SmedASXL_015468SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
esophagusSMED30035066SMESG000025925.1 axinBsmed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30035066SMESG000025925.1 axinBsmed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30035066SMESG000025925.1 axinBsmed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
posterior muscle cellSMED30035066SMESG000025925.1 dd_Smed_v4_5818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30035066SMESG000025925.1 dd_Smed_v4_5818_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30035066SMESG000025925.1 dd_Smed_v4_5531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30035066SMESG000025925.1 dd_Smed_v4_5531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30035066SMESG000025925.1 dd_Smed_v6_5818_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30035066SMESG000025925.1 dd_Smed_v6_5531_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
ventral nerve cordSMED30035066SMESG000025925.1 GU808529.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30035066SMESG000025925.1 GU808529.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035066SMESG000025925.1 GU808529.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30035066SMESG000025925.1 GU808529.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30035066SMESG000025925.1 SMED30035066smed_20140614PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30035066SMESG000025925.1 SMED30035066smed_20140614PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035066SMESG000025925.1 SMED30035066smed_20140614PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30035066SMESG000025925.1 SMED30035066smed_20140614PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30035066SMESG000025925.1 ADW27178.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30035066SMESG000025925.1 ADW27178.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30035066SMESG000025925.1 ADW27178.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30035066SMESG000025925.1 ADW27178.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30035066SMESG000025925.1 OX_Smed_1.0.17841ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035066SMESG000025925.1 GU808529.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30035066SMESG000025925.1 GU808529.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30035066SMESG000025925.1 dd_Smed_v4_5818_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035066SMESG000025925.1 dd_Smed_v4_5531_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of axis inhibition protein B vs. Ensembl Human
Match: AXIN1 (axin 1 [Source:HGNC Symbol;Acc:HGNC:903])

HSP 1 Score: 100.523 bits (249), Expect = 6.801e-21
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  783 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 862          

HSP 2 Score: 75.485 bits (184), Expect = 3.448e-13
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. Ensembl Human
Match: AXIN1 (axin 1 [Source:HGNC Symbol;Acc:HGNC:903])

HSP 1 Score: 100.138 bits (248), Expect = 6.917e-21
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  747 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 826          

HSP 2 Score: 75.0998 bits (183), Expect = 3.823e-13
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. Ensembl Human
Match: AXIN2 (axin 2 [Source:HGNC Symbol;Acc:HGNC:904])

HSP 1 Score: 88.1965 bits (217), Expect = 3.911e-17
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            LVV Y+   + +PYR  +  +Q +TLG FK  ++KKG +RY+FK+  DEF CG V EEI  D+ +LP++EG+++ K+E+
Sbjct:  699 LVVTYFFCGEEIPYRRML-KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVER 776          

HSP 2 Score: 77.411 bits (189), Expect = 7.233e-14
Identity = 46/132 (34.85%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR +L+       LDFWFAC GF+  +  DT  L ++ K IY+ YI + S  +  LK  TK  I D +  ++  D  +FD AQ EI+ ++       FL SD Y+E
Sbjct:   69 ASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTL-RVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQ-IDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLE 198          
BLAST of axis inhibition protein B vs. Ensembl Human
Match: AXIN2 (axin 2 [Source:HGNC Symbol;Acc:HGNC:904])

HSP 1 Score: 88.1965 bits (217), Expect = 3.911e-17
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            LVV Y+   + +PYR  +  +Q +TLG FK  ++KKG +RY+FK+  DEF CG V EEI  D+ +LP++EG+++ K+E+
Sbjct:  699 LVVTYFFCGEEIPYRRML-KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVER 776          

HSP 2 Score: 77.411 bits (189), Expect = 7.233e-14
Identity = 46/132 (34.85%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR +L+       LDFWFAC GF+  +  DT  L ++ K IY+ YI + S  +  LK  TK  I D +  ++  D  +FD AQ EI+ ++       FL SD Y+E
Sbjct:   69 ASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTL-RVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQ-IDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLE 198          
BLAST of axis inhibition protein B vs. Ensembl Human
Match: AXIN2 (axin 2 [Source:HGNC Symbol;Acc:HGNC:904])

HSP 1 Score: 88.1965 bits (217), Expect = 4.008e-17
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            LVV Y+   + +PYR  +  +Q +TLG FK  ++KKG +RY+FK+  DEF CG V EEI  D+ +LP++EG+++ K+E+
Sbjct:  764 LVVTYFFCGEEIPYRRML-KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVER 841          

HSP 2 Score: 77.411 bits (189), Expect = 8.305e-14
Identity = 46/132 (34.85%), Postives = 68/132 (51.52%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR +L+       LDFWFAC GF+  +  DT  L ++ K IY+ YI + S  +  LK  TK  I D +  ++  D  +FD AQ EI+ ++       FL SD Y+E
Sbjct:   69 ASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTL-RVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQ-IDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLE 198          
BLAST of axis inhibition protein B vs. Ensembl Fly
Match: Axn (gene:FBgn0026597 transcript:FBtr0085554)

HSP 1 Score: 70.4774 bits (171), Expect = 5.858e-12
Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +V +    +PVPYR +IP +Q  TL QFK  + ++G FR+FFK +C++ D  V+ EEI+ D  ILPL+  K +  ++ ++
Sbjct:  661 IVVFSFCEEPVPYRIKIPGTQ-PTLRQFKDYLPRRGHFRFFFKTHCEDPDSPVIQEEIVNDSDILPLFGDKAMGLVKPSD 739          
BLAST of axis inhibition protein B vs. Ensembl Fly
Match: Axn (gene:FBgn0026597 transcript:FBtr0334703)

HSP 1 Score: 70.4774 bits (171), Expect = 5.858e-12
Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +V +    +PVPYR +IP +Q  TL QFK  + ++G FR+FFK +C++ D  V+ EEI+ D  ILPL+  K +  ++ ++
Sbjct:  661 IVVFSFCEEPVPYRIKIPGTQ-PTLRQFKDYLPRRGHFRFFFKTHCEDPDSPVIQEEIVNDSDILPLFGDKAMGLVKPSD 739          
BLAST of axis inhibition protein B vs. Ensembl Fly
Match: Axn (gene:FBgn0026597 transcript:FBtr0085553)

HSP 1 Score: 70.0922 bits (170), Expect = 6.093e-12
Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +V +    +PVPYR +IP +Q  TL QFK  + ++G FR+FFK +C++ D  V+ EEI+ D  ILPL+  K +  ++ ++
Sbjct:  667 IVVFSFCEEPVPYRIKIPGTQ-PTLRQFKDYLPRRGHFRFFFKTHCEDPDSPVIQEEIVNDSDILPLFGDKAMGLVKPSD 745          
BLAST of axis inhibition protein B vs. Ensembl Fly
Match: Axn (gene:FBgn0026597 transcript:FBtr0085555)

HSP 1 Score: 70.0922 bits (170), Expect = 6.093e-12
Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +V +    +PVPYR +IP +Q  TL QFK  + ++G FR+FFK +C++ D  V+ EEI+ D  ILPL+  K +  ++ ++
Sbjct:  667 IVVFSFCEEPVPYRIKIPGTQ-PTLRQFKDYLPRRGHFRFFFKTHCEDPDSPVIQEEIVNDSDILPLFGDKAMGLVKPSD 745          
BLAST of axis inhibition protein B vs. Ensembl Fly
Match: Axn (gene:FBgn0026597 transcript:FBtr0334702)

HSP 1 Score: 70.0922 bits (170), Expect = 6.894e-12
Identity = 32/80 (40.00%), Postives = 52/80 (65.00%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +V +    +PVPYR +IP +Q  TL QFK  + ++G FR+FFK +C++ D  V+ EEI+ D  ILPL+  K +  ++ ++
Sbjct:  615 IVVFSFCEEPVPYRIKIPGTQ-PTLRQFKDYLPRRGHFRFFFKTHCEDPDSPVIQEEIVNDSDILPLFGDKAMGLVKPSD 693          
BLAST of axis inhibition protein B vs. Ensembl Zebrafish
Match: axin1 (axin 1 [Source:NCBI gene;Acc:57931])

HSP 1 Score: 97.0561 bits (240), Expect = 4.651e-20
Identity = 41/81 (50.62%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            + V YY   +P+PYRT +   + +TLGQFK L+ KKG ++Y+FK+   EFDCGVV EE+  DDAILP++E K++ K+EK +
Sbjct:  756 ITVAYYFCGEPIPYRTSV-KGRIVTLGQFKELLTKKGSYKYYFKKVSYEFDCGVVFEEVREDDAILPIFEEKIIGKVEKVD 835          

HSP 2 Score: 69.707 bits (169), Expect = 1.370e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSD-THKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L        LDFWFAC GF+  + +D   K+ +L K IY+ YI   +       +   KS +     +   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   80 ASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEECADMLDFWFACSGFRKQEANDGNEKMLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLE 212          
BLAST of axis inhibition protein B vs. Ensembl Zebrafish
Match: axin1 (axin 1 [Source:NCBI gene;Acc:57931])

HSP 1 Score: 97.0561 bits (240), Expect = 4.651e-20
Identity = 41/81 (50.62%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            + V YY   +P+PYRT +   + +TLGQFK L+ KKG ++Y+FK+   EFDCGVV EE+  DDAILP++E K++ K+EK +
Sbjct:  756 ITVAYYFCGEPIPYRTSV-KGRIVTLGQFKELLTKKGSYKYYFKKVSYEFDCGVVFEEVREDDAILPIFEEKIIGKVEKVD 835          

HSP 2 Score: 69.707 bits (169), Expect = 1.370e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSD-THKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L        LDFWFAC GF+  + +D   K+ +L K IY+ YI   +       +   KS +     +   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   80 ASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEECADMLDFWFACSGFRKQEANDGNEKMLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLE 212          
BLAST of axis inhibition protein B vs. Ensembl Zebrafish
Match: axin1 (axin 1 [Source:NCBI gene;Acc:57931])

HSP 1 Score: 97.0561 bits (240), Expect = 4.651e-20
Identity = 41/81 (50.62%), Postives = 59/81 (72.84%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            + V YY   +P+PYRT +   + +TLGQFK L+ KKG ++Y+FK+   EFDCGVV EE+  DDAILP++E K++ K+EK +
Sbjct:  756 ITVAYYFCGEPIPYRTSV-KGRIVTLGQFKELLTKKGSYKYYFKKVSYEFDCGVVFEEVREDDAILPIFEEKIIGKVEKVD 835          

HSP 2 Score: 69.707 bits (169), Expect = 1.370e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSD-THKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L        LDFWFAC GF+  + +D   K+ +L K IY+ YI   +       +   KS +     +   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   80 ASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEECADMLDFWFACSGFRKQEANDGNEKMLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLE 212          
BLAST of axis inhibition protein B vs. Ensembl Zebrafish
Match: axin2 (axin 2 (conductin, axil) [Source:NCBI gene;Acc:58080])

HSP 1 Score: 89.7373 bits (221), Expect = 7.603e-19
Identity = 51/132 (38.64%), Postives = 70/132 (53.03%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR YL+       LDFWFAC GF+  D  DT K H++ K IY+ YI + S  A  LK  TK  I D +  R+  D ++FD AQ+EI+  +       FL SD Y+E
Sbjct:   72 ASPDSPLARWTKSLHFLLGDQDGAQLFRAYLEREKCVDTLDFWFACNGFRQMDLKDT-KTHRVAKAIYKRYIENNSIVAKQLKPATKTFIRDNIK-RQQIDSAMFDQAQMEIQTAMEENAYQMFLTSDIYLE 201          
BLAST of axis inhibition protein B vs. Ensembl Zebrafish
Match: axin2 (axin 2 (conductin, axil) [Source:NCBI gene;Acc:58080])

HSP 1 Score: 90.1225 bits (222), Expect = 6.005e-18
Identity = 51/132 (38.64%), Postives = 70/132 (53.03%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR YL+       LDFWFAC GF+  D  DT K H++ K IY+ YI + S  A  LK  TK  I D +  R+  D ++FD AQ+EI+  +       FL SD Y+E
Sbjct:   72 ASPDSPLARWTKSLHFLLGDQDGAQLFRAYLEREKCVDTLDFWFACNGFRQMDLKDT-KTHRVAKAIYKRYIENNSIVAKQLKPATKTFIRDNIK-RQQIDSAMFDQAQMEIQTAMEENAYQMFLTSDIYLE 201          

HSP 2 Score: 84.3445 bits (207), Expect = 4.120e-16
Identity = 35/80 (43.75%), Postives = 54/80 (67.50%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            VV Y+   + +PYR  +  +  +TLG FK  + KKG +RYFFKR  DEF+CG V EE+  D  +LP++EGK++ K+++ +
Sbjct:  734 VVTYFFCGEEIPYRRMM-KTHSLTLGHFKEQLRKKGNYRYFFKRASDEFECGAVFEEVWDDCTVLPMYEGKILGKVDRMD 812          
BLAST of axis inhibition protein B vs. Ensembl Xenopus
Match: pak3 (p21 protein (Cdc42/Rac)-activated kinase 3 [Source:Xenbase;Acc:XB-GENE-961764])

HSP 1 Score: 101.679 bits (252), Expect = 2.336e-21
Identity = 43/79 (54.43%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  DD ILP++E K++ K+EK
Sbjct:  762 IVVAYYFCGEPIPYRTMV-KGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDMILPIYEEKIIGKVEK 839          

HSP 2 Score: 75.8702 bits (185), Expect = 2.227e-13
Identity = 43/134 (32.09%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   N    LDFWFAC GF+  + +D+   K  +L K IY+ YI   +       +   KS +     R+  D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGINLFRTFLQQENCADLLDFWFACSGFRKLEPNDSKVEKRLKLAKAIYKKYILDSNGIVSRQIKPATKSFIKDCVLRQQIDPAMFDQAQTEIQSMMEDNTYPVFLKSDTYLE 209          
BLAST of axis inhibition protein B vs. Ensembl Xenopus
Match: pak3 (p21 protein (Cdc42/Rac)-activated kinase 3 [Source:Xenbase;Acc:XB-GENE-961764])

HSP 1 Score: 101.679 bits (252), Expect = 2.565e-21
Identity = 43/79 (54.43%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  DD ILP++E K++ K+EK
Sbjct:  798 IVVAYYFCGEPIPYRTMV-KGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDMILPIYEEKIIGKVEK 875          

HSP 2 Score: 75.8702 bits (185), Expect = 2.112e-13
Identity = 43/134 (32.09%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   N    LDFWFAC GF+  + +D+   K  +L K IY+ YI   +       +   KS +     R+  D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGINLFRTFLQQENCADLLDFWFACSGFRKLEPNDSKVEKRLKLAKAIYKKYILDSNGIVSRQIKPATKSFIKDCVLRQQIDPAMFDQAQTEIQSMMEDNTYPVFLKSDTYLE 209          
BLAST of axis inhibition protein B vs. Ensembl Xenopus
Match: ENSXETT00000012979.1 (axin 2 (conductin, axil) [Source:NCBI gene;Acc:100380149])

HSP 1 Score: 78.1814 bits (191), Expect = 3.767e-14
Identity = 34/82 (41.46%), Postives = 56/82 (68.29%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPY--RTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKA 2454
            L + YY   + +PY  RT+ P    +TL +FK L++KKG ++Y+FK+   EF+C  V +E+  +DA+LPL+E K++ K+E+A
Sbjct:  628 LAIVYYFCGERIPYMIRTKEPS---LTLQEFKELLSKKGSYKYYFKKESHEFECNAVFQEVSEEDAVLPLFEEKIICKVERA 706          

HSP 2 Score: 77.7962 bits (190), Expect = 5.788e-14
Identity = 42/120 (35.00%), Postives = 69/120 (57.50%), Query Frame = 1
Query:  238 NLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +L+LLL + D  T FR+YL+       L FWFAC GF+  D  +  K  +  K IYR Y+++ S  +  LK +T+  + + + +++  ++++FD AQ EI+  +  E   +FLQSD   E
Sbjct:   72 SLNLLLDDQDGATLFRMYLEGEGLVDLLSFWFACNGFRAMDPLEP-KTSKTAKAIYRWYVQNSSAVSCRLKPSTRTQVKECVKNQQ-LNKTVFDQAQQEIQRAMEQEAFTSFLQSDICKE 189          
BLAST of axis inhibition protein B vs. Ensembl Xenopus
Match: ampd2 (adenosine monophosphate deaminase 2 [Source:Xenbase;Acc:XB-GENE-982645])

HSP 1 Score: 71.633 bits (174), Expect = 8.255e-13
Identity = 45/134 (33.58%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVP--LKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + +    FR +L+       LDFWFAC GF+  D  D   L ++ K IY+ YI S     V   LK  TK  + D +  ++  D S+FD AQ E++  +       FL SD Y+E
Sbjct:   67 ASPDSPLARWAKSLHSLLGDKEGADLFRRFLERQRCVDTLDFWFACNGFRQMDPGDAKTL-RVAKAIYKRYIESGGGGTVAKQLKPPTKSFLRDCVKGQR-LDPSMFDQAQAEVQASMEDNAYRLFLSSDIYLE 198          
BLAST of axis inhibition protein B vs. Ensembl Xenopus
Match: ENSXETT00000001825.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461245.1:5708:13762:1 gene:ENSXETG00000006251.1 transcript:ENSXETT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 2.544e-9
Identity = 30/78 (38.46%), Postives = 43/78 (55.13%), Query Frame = 1
Query: 2221 VGYYIGNDPVPYRTQIPDS-QYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            V Y+      P+   IP     +TL  F++ + ++G  RY FK    EF  G V EE+  DD I+P WEGK+VA +E+
Sbjct:  112 VLYFTDRSLTPFMVTIPKRLGEVTLRDFRAAIGREGSHRYHFKALDPEF--GTVKEEVFHDDDIIPGWEGKIVAWVEE 187          
BLAST of axis inhibition protein B vs. Ensembl Mouse
Match: Axin1 (axin 1 [Source:MGI Symbol;Acc:MGI:1096327])

HSP 1 Score: 100.908 bits (250), Expect = 2.783e-21
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  753 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 832          

HSP 2 Score: 75.8702 bits (185), Expect = 1.905e-13
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   81 ASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLE 214          
BLAST of axis inhibition protein B vs. Ensembl Mouse
Match: Axin1 (axin 1 [Source:MGI Symbol;Acc:MGI:1096327])

HSP 1 Score: 100.908 bits (250), Expect = 2.783e-21
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  753 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 832          

HSP 2 Score: 75.8702 bits (185), Expect = 1.905e-13
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   81 ASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLE 214          
BLAST of axis inhibition protein B vs. Ensembl Mouse
Match: Axin1 (axin 1 [Source:MGI Symbol;Acc:MGI:1096327])

HSP 1 Score: 101.293 bits (251), Expect = 2.831e-21
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  789 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 868          

HSP 2 Score: 75.8702 bits (185), Expect = 1.563e-13
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   81 ASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLE 214          
BLAST of axis inhibition protein B vs. Ensembl Mouse
Match: Axin2 (axin 2 [Source:MGI Symbol;Acc:MGI:1270862])

HSP 1 Score: 87.4261 bits (215), Expect = 4.285e-17
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            LVV Y+   + +PYR  +  +Q +TLG FK  ++KKG +RY+FK+  DEF CG V EEI  D+ +LP++EG+++ K+E+
Sbjct:  761 LVVTYFFCGEEIPYRRML-KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVER 838          

HSP 2 Score: 74.7146 bits (182), Expect = 3.862e-13
Identity = 45/132 (34.09%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR +L+       LDFWFAC GF+  +  DT  L ++ K IY+ YI + S  +  LK  TK  I D +  ++     +FD AQ EI+ ++       FL SD Y+E
Sbjct:   69 ASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTL-RVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQ-IGSVMFDQAQTEIQAVMEENAYQVFLTSDIYLE 198          
BLAST of axis inhibition protein B vs. Ensembl Mouse
Match: Axin2 (axin 2 [Source:MGI Symbol;Acc:MGI:1270862])

HSP 1 Score: 87.4261 bits (215), Expect = 4.442e-17
Identity = 36/79 (45.57%), Postives = 56/79 (70.89%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            LVV Y+   + +PYR  +  +Q +TLG FK  ++KKG +RY+FK+  DEF CG V EEI  D+ +LP++EG+++ K+E+
Sbjct:  696 LVVTYFFCGEEIPYRRML-KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVER 773          

HSP 2 Score: 74.7146 bits (182), Expect = 3.901e-13
Identity = 45/132 (34.09%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+     +L  LL + D    FR +L+       LDFWFAC GF+  +  DT  L ++ K IY+ YI + S  +  LK  TK  I D +  ++     +FD AQ EI+ ++       FL SD Y+E
Sbjct:   69 ASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQMNLKDTKTL-RVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQ-IGSVMFDQAQTEIQAVMEENAYQVFLTSDIYLE 198          
BLAST of axis inhibition protein B vs. UniProt/SwissProt
Match: sp|O70239|AXIN1_RAT (Axin-1 OS=Rattus norvegicus OX=10116 GN=Axin1 PE=1 SV=3)

HSP 1 Score: 101.679 bits (252), Expect = 1.359e-20
Identity = 43/81 (53.09%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+AILP++E K++ K+EK +
Sbjct:  748 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD 827          

HSP 2 Score: 75.8702 bits (185), Expect = 1.362e-12
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   76 ASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. UniProt/SwissProt
Match: sp|O42400|AXIN1_CHICK (Axin-1 OS=Gallus gallus OX=9031 GN=AXIN1 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.164e-20
Identity = 43/79 (54.43%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  DD ILP++E K++ K+EK
Sbjct:  762 IVVAYYFCGEPIPYRTLV-KGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDTILPIFEEKIIGKVEK 839          

HSP 2 Score: 68.1662 bits (165), Expect = 3.231e-10
Identity = 41/134 (30.60%), Postives = 64/134 (47.76%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDR--SDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   +    LDFWFAC GF+  +   S+  K  +L K IY+ YI   +       +   KS +     +   D  +FD AQ EI+ ++       FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFACSGFRKLEPCVSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLQIDPDMFDQAQTEIQCMIEDNTYPLFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. UniProt/SwissProt
Match: sp|O35625|AXIN1_MOUSE (Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3)

HSP 1 Score: 100.908 bits (250), Expect = 2.165e-20
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  784 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 863          

HSP 2 Score: 75.8702 bits (185), Expect = 1.229e-12
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   76 ASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. UniProt/SwissProt
Match: sp|O15169|AXIN1_HUMAN (Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 3.266e-20
Identity = 42/81 (51.85%), Postives = 61/81 (75.31%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  D+A+LP++E K++ K+EK +
Sbjct:  783 IVVAYYFCGEPIPYRTLV-RGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD 862          

HSP 2 Score: 75.485 bits (184), Expect = 1.656e-12
Identity = 41/134 (30.60%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D ++ FR +L        LDFWFAC GF+  +  D+   K  +L + IYR YI   +       +   KS +     ++  D ++FD AQ EI+  +      +FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. UniProt/SwissProt
Match: sp|Q9YGY0|AXIN1_XENLA (Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.418e-20
Identity = 42/79 (53.16%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            +VV YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  DD ILP++E K++ ++EK
Sbjct:  763 IVVAYYFCGEPIPYRTMV-KGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDMILPIYEEKIIGQVEK 840          

HSP 2 Score: 77.411 bits (189), Expect = 4.304e-13
Identity = 42/134 (31.34%), Postives = 68/134 (50.75%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDT--HKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   N    LDFWFAC GF+  + +D+   K  +L K IY+ Y+   +       +   KS +     R+  D ++FD AQ+EI+ ++       FL+SD Y+E
Sbjct:   76 ASPTPPYLKWAESLHSLLDDQDGIHLFRTFLQQENCADLLDFWFACSGFRKLEPNDSKVEKRLKLAKAIYKKYVLDSNGIVSRQIKPATKSFIKDCVLRQQIDPAMFDQAQMEIQSMMEDNTYPVFLKSDIYLE 209          
BLAST of axis inhibition protein B vs. TrEMBL
Match: G3C7W9 (Axis inhibition protein B OS=Schmidtea mediterranea OX=79327 GN=axinB PE=2 SV=1)

HSP 1 Score: 1489.55 bits (3855), Expect = 0.000e+0
Identity = 776/778 (99.74%), Postives = 777/778 (99.87%), Query Frame = 1
Query:  124 MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIEPKSFERNLLSNNSRIQEQISDIPVXXXXXXXXXXXXXXXXXXXXXXXXXXEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNGSGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQMKFEKILRLVKSVPTEXXXXXXXXXAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKLKTTYRPGDLRDDHAQDILENHCLRIGLDEPATRHLKRELSDGKNRWRREHDLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGIDNSPSSHRYXXXXXXXXXKNHFPLPKNQIVMESTDTSGFSYFKDSPTKKNNISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHEYDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQVNLYSPVPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQKPCFCTNTAGINDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQIXXXXXXXXXXXLVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIEPKSFERNLLSN+SRIQEQISDIPVSSCSSSGHIGRKSSSARINAIASRGSEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNGSGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQMKFEKILRLVKSVPTESDTDDSSSSAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKLKTTYRPGDLRDDHAQDILENHCLRIGLDEPATRHLKRELSDGKNRWRREHDLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGIDNSPSSHRYHHHHHHHHHKNHFPLPKNQIVMESTD SGFSYFKDSPTKKNNISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHEYDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQVNLYSPVPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQKPCFCTNTAGINDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQITKTNTSSKSNSLVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE
Sbjct:    1 MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIEPKSFERNLLSNSSRIQEQISDIPVSSCSSSGHIGRKSSSARINAIASRGSEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNGSGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQMKFEKILRLVKSVPTESDTDDSSSSAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKLKTTYRPGDLRDDHAQDILENHCLRIGLDEPATRHLKRELSDGKNRWRREHDLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGIDNSPSSHRYHHHHHHHHHKNHFPLPKNQIVMESTDASGFSYFKDSPTKKNNISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHEYDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQVNLYSPVPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQKPCFCTNTAGINDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQITKTNTSSKSNSLVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 778          
BLAST of axis inhibition protein B vs. TrEMBL
Match: G3C7W8 (Axis inhibition protein A OS=Schmidtea mediterranea OX=79327 GN=axinA PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.307e-31
Identity = 68/118 (57.63%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  238 NLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFY 591
            +  +LL +S  V  FR +L+S    H+L+FWFACQGFK+ DR    K++QL KVIYRAYIRSES  AVPL+ NTKK+IVDK+S ++C DQSIFDTAQ+EIRD+L  EF + F++S+ +
Sbjct:   46 DFKVLLNDSQGVEIFRGFLESERVTHYLEFWFACQGFKSADR---EKVYQLIKVIYRAYIRSESKTAVPLQPNTKKNIVDKISSKQCLDQSIFDTAQMEIRDVLIKEFYIRFIKSESF 160          

HSP 2 Score: 81.6481 bits (200), Expect = 4.205e-12
Identity = 40/81 (49.38%), Postives = 53/81 (65.43%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQY-ITLGQFKSLVAKKGPFRYFFKRYCDEFD-CGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            ++VGYY   DPVPYRTQ+P  +   TLGQFK L+ ++GP+RYFFKR CDEFD  G V EE  +        + K + K++K
Sbjct:  528 IIVGYYFCGDPVPYRTQVPIGESGFTLGQFKMLLPRRGPYRYFFKRPCDEFDGGGAVQEEYTKMKMFFLCGKEKSLRKLKK 608          
BLAST of axis inhibition protein B vs. TrEMBL
Match: A0A0X3PP83 (DIX domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR165548 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.047e-28
Identity = 56/81 (69.14%), Postives = 67/81 (82.72%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            L+VGYY+ +DPVPYR+Q PD + ITLGQFK LV KKGPFR+FFK+  DEFD GVV +EI  DDA LPLW+GKVVAK+E+ E
Sbjct:   38 LIVGYYLCDDPVPYRSQWPDPE-ITLGQFKHLVPKKGPFRFFFKKASDEFDSGVVQQEISNDDATLPLWDGKVVAKVERIE 117          
BLAST of axis inhibition protein B vs. TrEMBL
Match: A0A5K3FJ31 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.087e-27
Identity = 60/81 (74.07%), Postives = 66/81 (81.48%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            LVVGYY+ +DPVPYR+Q P S  ITLGQFK LV KKG FR+FFK   DEFD GVVH+EI  DDAILPLWEGKVVAKIE+ E
Sbjct:  390 LVVGYYLCDDPVPYRSQWP-SHEITLGQFKHLVPKKGLFRFFFKTTSDEFDSGVVHQEISNDDAILPLWEGKVVAKIERVE 469          
BLAST of axis inhibition protein B vs. TrEMBL
Match: A0A3P8GCP7 (DIX domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS15844 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 7.860e-27
Identity = 55/82 (67.07%), Postives = 67/82 (81.71%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLV-AKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            LV+GYY+G+DPVPYR+  P S+ ITLGQFK L+  KKG FRYFFK+  DEFD GVVH+EI  DD ILPLWEGK+VAK+E+ +
Sbjct:  148 LVIGYYMGDDPVPYRSLWPSSE-ITLGQFKQLIPKKKGLFRYFFKKASDEFDSGVVHQEITNDDTILPLWEGKIVAKVERID 228          
BLAST of axis inhibition protein B vs. Ensembl Cavefish
Match: axin1 (axin 1 [Source:NCBI gene;Acc:103045152])

HSP 1 Score: 102.834 bits (255), Expect = 6.432e-22
Identity = 43/79 (54.43%), Postives = 60/79 (75.95%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            ++V YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  DDAILP++E K++ K+EK
Sbjct:  752 IIVAYYFCGEPIPYRTSV-KGRIVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDDAILPIFEEKIIGKVEK 829          

HSP 2 Score: 70.8626 bits (172), Expect = 4.411e-12
Identity = 42/134 (31.34%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSD--THKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   +    LDFWFAC GF+  + SD    K  +L K IY+ YI   +       +   KS +     +   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   82 ASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEDCADMLDFWFACSGFRKLETSDGNEEKKLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLE 215          
BLAST of axis inhibition protein B vs. Ensembl Cavefish
Match: axin1 (axin 1 [Source:NCBI gene;Acc:103045152])

HSP 1 Score: 102.834 bits (255), Expect = 6.604e-22
Identity = 43/79 (54.43%), Postives = 60/79 (75.95%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            ++V YY   +P+PYRT +   + +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EE+  DDAILP++E K++ K+EK
Sbjct:  787 IIVAYYFCGEPIPYRTSV-KGRIVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDDAILPIFEEKIIGKVEK 864          

HSP 2 Score: 71.2478 bits (173), Expect = 4.138e-12
Identity = 42/134 (31.34%), Postives = 65/134 (48.51%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSD--THKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   +    LDFWFAC GF+  + SD    K  +L K IY+ YI   +       +   KS +     +   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   82 ASPTPPYLKWAESLHSLLDDQDGIHLFRTFLKQEDCADMLDFWFACSGFRKLETSDGNEEKKLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLHIDPAMFDQAQTEIQTMMEENTYPLFLKSDIYLE 215          
BLAST of axis inhibition protein B vs. Ensembl Cavefish
Match: ENSAMXT00000037125.1 (axin-1-like [Source:NCBI gene;Acc:103030717])

HSP 1 Score: 97.0561 bits (240), Expect = 3.434e-20
Identity = 39/79 (49.37%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            + V YY   +P+PY T +   + +TLGQFK L+ KKG +R++FK+  DEFDCGVV+EE+  DDA+LP++E +++ K+EK
Sbjct:  616 ITVAYYFCGEPIPYMTSV-KGRVVTLGQFKELLTKKGSYRFYFKKVSDEFDCGVVYEEVNEDDAVLPIFEERIIGKVEK 693          

HSP 2 Score: 66.6254 bits (161), Expect = 9.179e-11
Identity = 45/140 (32.14%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNF---DRSDTHKLHQLTKVIYRAYIRSESPYAVP--LKQNTKKSIVDKLSD----RKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYI 594
            +S   P +   ++L  LL + D  + FR +L        LDFWFAC GF+     D  D  +L +L K IYR YI   S   V   +K  TK  I + +      R   D  +F+ AQ+E++ ++       FL+SD Y+
Sbjct:   67 ASPAPPHLRWAESLHFLLDDQDGTSLFRAFLLQEGCSDLLDFWFACSGFRKLPATDGQDGRRL-KLAKAIYRKYIADNSSGVVARKIKPATKTFIRECVCRAQVCRALLDSVLFEQAQVEVQALMEEHTYPLFLKSDVYL 205          
BLAST of axis inhibition protein B vs. Ensembl Cavefish
Match: ENSAMXT00000031013.1 (axin-1-like [Source:NCBI gene;Acc:103030717])

HSP 1 Score: 96.2857 bits (238), Expect = 4.531e-20
Identity = 39/79 (49.37%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            + V YY   +P+PY T +   + +TLGQFK L+ KKG +R++FK+  DEFDCGVV+EE+  DDA+LP++E +++ K+EK
Sbjct:  596 ITVAYYFCGEPIPYMTSV-KGRVVTLGQFKELLTKKGSYRFYFKKVSDEFDCGVVYEEVNEDDAVLPIFEERIIGKVEK 673          

HSP 2 Score: 67.0106 bits (162), Expect = 7.458e-11
Identity = 45/140 (32.14%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNF---DRSDTHKLHQLTKVIYRAYIRSESPYAVP--LKQNTKKSIVDKLSD----RKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYI 594
            +S   P +   ++L  LL + D  + FR +L        LDFWFAC GF+     D  D  +L +L K IYR YI   S   V   +K  TK  I + +      R   D  +F+ AQ+E++ ++       FL+SD Y+
Sbjct:   67 ASPAPPHLRWAESLHFLLDDQDGTSLFRAFLLQEGCSDLLDFWFACSGFRKLPATDGQDGRRL-KLAKAIYRKYIADNSSGVVARKIKPATKTFIRECVCRAQVCRALLDSVLFEQAQVEVQALMEEHTYPLFLKSDVYL 205          
BLAST of axis inhibition protein B vs. Ensembl Cavefish
Match: ENSAMXT00000012689.2 (axin-1-like [Source:NCBI gene;Acc:103030717])

HSP 1 Score: 95.5153 bits (236), Expect = 9.064e-20
Identity = 39/79 (49.37%), Postives = 59/79 (74.68%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            + V YY   +P+PY T +   + +TLGQFK L+ KKG +R++FK+  DEFDCGVV+EE+  DDA+LP++E +++ K+EK
Sbjct:  671 ITVAYYFCGEPIPYMTSV-KGRVVTLGQFKELLTKKGSYRFYFKKVSDEFDCGVVYEEVNEDDAVLPIFEERIIGKVEK 748          

HSP 2 Score: 67.0106 bits (162), Expect = 7.495e-11
Identity = 45/140 (32.14%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNF---DRSDTHKLHQLTKVIYRAYIRSESPYAVP--LKQNTKKSIVDKLSD----RKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYI 594
            +S   P +   ++L  LL + D  + FR +L        LDFWFAC GF+     D  D  +L +L K IYR YI   S   V   +K  TK  I + +      R   D  +F+ AQ+E++ ++       FL+SD Y+
Sbjct:   67 ASPAPPHLRWAESLHFLLDDQDGTSLFRAFLLQEGCSDLLDFWFACSGFRKLPATDGQDGRRL-KLAKAIYRKYIADNSSGVVARKIKPATKTFIRECVCRAQVCRALLDSVLFEQAQVEVQALMEEHTYPLFLKSDVYL 205          
BLAST of axis inhibition protein B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008444.1 (pep scaffold:Pmarinus_7.0:GL479496:14395:17295:-1 gene:ENSPMAG00000007646.1 transcript:ENSPMAT00000008444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 3.458e-22
Identity = 38/77 (49.35%), Postives = 56/77 (72.73%), Query Frame = 1
Query: 2227 YYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            YY   +P+PYR+++     +TL  FK L+ KKG +R++FK+  +EF+CGVV EE+  D A+LPL++GKVV K+EK E
Sbjct:   14 YYFCGEPIPYRSRVRGDS-LTLAHFKELLTKKGNYRFYFKKASEEFECGVVFEEVRDDKALLPLYQGKVVGKVEKVE 89          
BLAST of axis inhibition protein B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007682.1 (pep scaffold:Pmarinus_7.0:GL479837:661:11661:1 gene:ENSPMAG00000006940.1 transcript:ENSPMAT00000007682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.968e-20
Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            +VV YY   + +PYRT +     +TLG FK L+ KKG +RY+FK+  ++FDCGVV+EE+  DDAILP++E K+  K+E+ E
Sbjct:  203 VVVVYYFCGETIPYRTSV-RGHVLTLGHFKELLTKKGTYRYYFKKASEDFDCGVVYEEVQDDDAILPIYEEKINGKVERIE 282          
BLAST of axis inhibition protein B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009992.1 (pep scaffold:Pmarinus_7.0:GL486030:972:8629:-1 gene:ENSPMAG00000009042.1 transcript:ENSPMAT00000009992.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.406e-15
Identity = 44/133 (33.08%), Postives = 68/133 (51.13%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIR-SESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P V   ++L  LL + D    FR +L+       LDFWFAC GF+N      HK+ +  ++IY+ Y+  +    A  LK  T+  + D +  R   D ++FD AQLEI+  +       FL+S+ Y+E
Sbjct:   84 ASPTPPYVRWGESLHSLLDDRDGTHLFRTFLEHEELPDMLDFWFACNGFRNA----RHKMGKAARLIYKRYVSDTAGVVAAHLKAATRAYVRDCVLARGVADPTVFDQAQLEIQQQMEENSYPAFLKSELYLE 212          
BLAST of axis inhibition protein B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005690.1 (pep scaffold:Pmarinus_7.0:GL485422:2197:11231:-1 gene:ENSPMAG00000005159.1 transcript:ENSPMAT00000005690.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.938e-13
Identity = 41/133 (30.83%), Postives = 71/133 (53.38%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQ--NTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYI 594
            +S   P V   ++L  LL++ D  + FR +L+  +    LDFWFAC GF+   ++D  K  +L K IY+ +I+  +   + L+Q  +  ++ V +    K  D ++FD AQ E++  +       FL+SD Y+
Sbjct:   77 ASPTPPYVRWAESLPALLEDQDGTSLFRAFLEQEDCVDLLDFWFACSGFR---KTDGDKRAKLAKAIYKKFIKDNA--GIVLRQIGSITRTGVKECIASKRIDSTMFDRAQEEVQTAMEENAYPAFLRSDVYL 204          
BLAST of axis inhibition protein B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009994.1 (pep scaffold:Pmarinus_7.0:GL486030:972:8338:-1 gene:ENSPMAG00000009042.1 transcript:ENSPMAT00000009994.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 4.123e-13
Identity = 42/133 (31.58%), Postives = 66/133 (49.62%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIR-SESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P V   ++L  LL + D    FR +L+       LDFWFAC GF+N   +      +  ++IY+ Y+  +    A  LK  T+  + D +  R   D ++FD AQLEI+  +       FL+S+ Y+E
Sbjct:   79 ASPTPPYVRWGESLHSLLDDRDGTHLFRTFLEHEELPDMLDFWFACNGFRNLLAT-----RKAARLIYKRYVSDTAGVVAAHLKAATRAYVRDCVLARGVADPTVFDQAQLEIQQQMEENSYPAFLKSELYLE 206          
BLAST of axis inhibition protein B vs. Ensembl Nematostella
Match: EDO44861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI9])

HSP 1 Score: 89.3521 bits (220), Expect = 3.253e-18
Identity = 37/80 (46.25%), Postives = 58/80 (72.50%), Query Frame = 1
Query: 2218 VVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
             + Y++  +P+ YRT +P  ++ITLGQFK+L+ +KG FRYFFK   ++ +C VV+EE+  D  +LP +EGK+V K+EK +
Sbjct:  752 TIIYWLWGEPIAYRTSLP-GKHITLGQFKTLIMRKGEFRYFFKTKTEDRECEVVYEEVKEDKMMLPTFEGKIVGKVEKVD 830          
BLAST of axis inhibition protein B vs. Ensembl Nematostella
Match: EDO37929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEC9])

HSP 1 Score: 56.9954 bits (136), Expect = 1.424e-8
Identity = 28/56 (50.00%), Postives = 37/56 (66.07%), Query Frame = 1
Query: 2284 ITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            ITL  FK +  + GP+R+ FK    EF  G V EE+I DD I+P WEGK+VA +E+
Sbjct:  294 ITLRDFKHMFDRPGPYRFHFKALDPEF--GTVKEEVIEDDDIIPGWEGKIVAWVEE 347          
BLAST of axis inhibition protein B vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 48.9062 bits (115), Expect = 1.367e-6
Identity = 35/137 (25.55%), Postives = 60/137 (43.80%), Query Frame = 1
Query:  193 GSMSSNNKPIVTKIDN----LSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFY 591
            GS S   KP + ++ N       LL     V  F+ +L S      L FW A + ++  +  D      + ++IY  Y+ + SP  + L    + ++   +SD    DQ+ FD AQ  I  ++  +    F++S  Y
Sbjct:   26 GSASEMTKPTIDEMKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLE--DRESRRDMARMIYEDYVSTLSPTEISLDAKIRATVDKSMSDP---DQNTFDPAQDHIYTLMYHDCFPRFIKSKHY 157          
BLAST of axis inhibition protein B vs. Ensembl Nematostella
Match: EDO39599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9L8])

HSP 1 Score: 48.9062 bits (115), Expect = 8.415e-6
Identity = 27/72 (37.50%), Postives = 45/72 (62.50%), Query Frame = 1
Query: 2227 YYIGNDPVPYRTQIPDS-QYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVA 2439
            Y+I ++  PY  ++  +   +TLG FK+++ +   +++FFK   D+F  GVV EEI  D+  LP + G+VVA
Sbjct:    8 YHIDDEDTPYLVKLGKTPDIVTLGDFKNVLNRPN-YKFFFKSMDDDF--GVVKEEISDDETHLPCFNGRVVA 76          
BLAST of axis inhibition protein B vs. Ensembl Medaka
Match: ENSORLT00000029383.1 (axin-1 [Source:NCBI gene;Acc:101155494])

HSP 1 Score: 97.8265 bits (242), Expect = 2.129e-20
Identity = 42/79 (53.16%), Postives = 58/79 (73.42%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            + V YY   +P+PYRT +   + +TLGQFK L+ KKG ++++FK+  DEFDCGVV EEI  DD ILP++E K+V K+EK
Sbjct:  799 MTVAYYFCGEPIPYRTSV-KGRVVTLGQFKELLTKKGHYKFYFKKVSDEFDCGVVFEEIRNDDDILPIFEEKIVGKVEK 876          

HSP 2 Score: 67.0106 bits (162), Expect = 7.813e-11
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D    F+ +L        LDFWFAC GF+   +S   K  +L K IY+ YI   S       +   KS +     ++  D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:  101 ASPTPPYLKWAESLHSLLDDQDGTQLFKNFLCQEGCADLLDFWFACSGFR---QSSQEKRAKLAKAIYKKYIVDGSGIVSRQIKAATKSFIRDCVGKQHPDPAMFDQAQTEIQAMIEENTYPLFLKSDLYLE 229          
BLAST of axis inhibition protein B vs. Ensembl Medaka
Match: ENSORLT00000012346.2 (axin-1 [Source:NCBI gene;Acc:101155494])

HSP 1 Score: 97.4413 bits (241), Expect = 2.669e-20
Identity = 42/79 (53.16%), Postives = 58/79 (73.42%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            + V YY   +P+PYRT +   + +TLGQFK L+ KKG ++++FK+  DEFDCGVV EEI  DD ILP++E K+V K+EK
Sbjct:  761 MTVAYYFCGEPIPYRTSV-KGRVVTLGQFKELLTKKGHYKFYFKKVSDEFDCGVVFEEIRNDDDILPIFEEKIVGKVEK 838          

HSP 2 Score: 67.0106 bits (162), Expect = 7.789e-11
Identity = 41/132 (31.06%), Postives = 63/132 (47.73%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D    F+ +L        LDFWFAC GF+   +S   K  +L K IY+ YI   S       +   KS +     ++  D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   92 ASPTPPYLKWAESLHSLLDDQDGTQLFKNFLCQEGCADLLDFWFACSGFR---QSSQEKRAKLAKAIYKKYIVDGSGIVSRQIKAATKSFIRDCVGKQHPDPAMFDQAQTEIQAMIEENTYPLFLKSDLYLE 220          
BLAST of axis inhibition protein B vs. Ensembl Medaka
Match: axin1 (axin 1 [Source:NCBI gene;Acc:101155852])

HSP 1 Score: 93.5893 bits (231), Expect = 4.096e-19
Identity = 41/81 (50.62%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            L V YY   + +PYRT +  +  +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EEI  D  +LP++E K++ K+EK +
Sbjct:  775 LTVAYYFCEELIPYRTSVKGT-VVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEIREDGDVLPIFEDKIIGKVEKVD 854          

HSP 2 Score: 64.3142 bits (155), Expect = 4.500e-10
Identity = 43/135 (31.85%), Postives = 68/135 (50.37%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFD--RSDTHKLHQLTKVIYRAYIRSESP-YAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   +    LDFWFAC GF+  +    +  K  +L K IY+ +I   +   +  ++  TK  I D L  R   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   82 ASPTPPYLKWAESLHSLLDDQDGIQLFRKFLKQEDCADMLDFWFACSGFRKLEAHEGNEEKKVKLAKAIYKKFILDNNGIVSRQIRPATKCFIKDCLM-RLHIDPAMFDQAQAEIQTMMEENTYPLFLKSDTYLE 215          
BLAST of axis inhibition protein B vs. Ensembl Medaka
Match: axin1 (axin 1 [Source:NCBI gene;Acc:101155852])

HSP 1 Score: 93.5893 bits (231), Expect = 4.343e-19
Identity = 41/81 (50.62%), Postives = 57/81 (70.37%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            L V YY   + +PYRT +  +  +TLGQFK L+ KKG +RY+FK+  DEFDCGVV EEI  D  +LP++E K++ K+EK +
Sbjct:  734 LTVAYYFCEELIPYRTSVKGT-VVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEIREDGDVLPIFEDKIIGKVEKVD 813          

HSP 2 Score: 64.3142 bits (155), Expect = 4.592e-10
Identity = 43/135 (31.85%), Postives = 68/135 (50.37%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFD--RSDTHKLHQLTKVIYRAYIRSESP-YAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S   P +   ++L  LL + D +  FR +L   +    LDFWFAC GF+  +    +  K  +L K IY+ +I   +   +  ++  TK  I D L  R   D ++FD AQ EI+ ++       FL+SD Y+E
Sbjct:   77 ASPTPPYLKWAESLHSLLDDQDGIQLFRKFLKQEDCADMLDFWFACSGFRKLEAHEGNEEKKVKLAKAIYKKFILDNNGIVSRQIRPATKCFIKDCLM-RLHIDPAMFDQAQAEIQTMMEENTYPLFLKSDTYLE 210          
BLAST of axis inhibition protein B vs. Ensembl Medaka
Match: AXIN2 (axin 2 [Source:NCBI gene;Acc:101156143])

HSP 1 Score: 89.3521 bits (220), Expect = 8.486e-18
Identity = 37/79 (46.84%), Postives = 57/79 (72.15%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            LVV Y+   + +PYR+ +  +  +TLG FK  ++KKG +RY+FK+  DEF+CG V EE+  D A+LP++EGKV+ K+E+
Sbjct:  712 LVVTYFFCGEEIPYRSMM-KTHCLTLGHFKEQLSKKGNYRYYFKKASDEFECGAVFEEVWEDAAVLPMYEGKVLGKVER 789          

HSP 2 Score: 80.4925 bits (197), Expect = 5.104e-15
Identity = 47/132 (35.61%), Postives = 70/132 (53.03%), Query Frame = 1
Query:  202 SSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIE 597
            +S + P+V    +L  LL + D    F+ +L+  N    LDFWFAC GF+  D  DT  L ++ KVI++ YI +    A  LK  TK  I D +  ++  D ++FD AQ EI+  +       FL SD Y++
Sbjct:   71 ASPDSPLVRWAKSLHFLLGDQDGAHLFKTFLERENCVDTLDFWFACNGFRQMDLKDTKTL-RVAKVIFKRYIDNNGIVAKQLKPATKTFIRDSIKKQQ-IDSAMFDQAQTEIQSYMEENAYQMFLTSDIYLD 200          
BLAST of axis inhibition protein B vs. Planmine SMEST
Match: SMESG000025925.1 (SMESG000025925.1)

HSP 1 Score: 1481.85 bits (3835), Expect = 0.000e+0
Identity = 773/778 (99.36%), Postives = 774/778 (99.49%), Query Frame = 1
Query:  124 MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIEPKSFERNLLSNNSRIQEQISDIPVXXXXXXXXXXXXXXXXXXXXXXXXXXEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNGSGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQMKFEKILRLVKSVPTEXXXXXXXXXAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKLKTTYRPGDLRDDHAQDILENHCLRIGLDEPATRHLKRELSDGKNRWRREHDLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGIDNSPSSHRYXXXXXXXXXKNHFPLPKNQIVMESTDTSGFSYFKDSPTKKNNISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHEYDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQVNLYSPVPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQKPCFCTNTAGINDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQIXXXXXXXXXXXLVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIEPKSFERNLLSNNSRIQEQISDIPVSSCSSSGHIGRKSSSARINAIASRGSEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNGSGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQ KFEKILRLVKSVPTESDTDDSSSSAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKLKTTYRPGDLRDDHAQDILENHCLRIGLDEP TRHLKRELSDGKNRWRREHDLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGIDNSPSSHRYHHHHHHHHHKNHFPLPKNQIVME+TDTSGFSYFKDSPTKKNNISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHEYDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQ NLYSPVPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQK CFCTNTAGINDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQITKTNTSSKSNSLVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE
Sbjct:    1 MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFYIEPKSFERNLLSNNSRIQEQISDIPVSSCSSSGHIGRKSSSARINAIASRGSEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNGSGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQTKFEKILRLVKSVPTESDTDDSSSSAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKLKTTYRPGDLRDDHAQDILENHCLRIGLDEPGTRHLKRELSDGKNRWRREHDLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGIDNSPSSHRYHHHHHHHHHKNHFPLPKNQIVMENTDTSGFSYFKDSPTKKNNISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHEYDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQANLYSPVPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQKTCFCTNTAGINDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQITKTNTSSKSNSLVVGYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 778          
BLAST of axis inhibition protein B vs. Planmine SMEST
Match: SMESG000039725.1 (SMESG000039725.1)

HSP 1 Score: 144.821 bits (364), Expect = 9.267e-36
Identity = 68/120 (56.67%), Postives = 92/120 (76.67%), Query Frame = 1
Query:  232 IDNLSLLLQESDSVTNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRSESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNFLQSDFY 591
            + +  +LL +S  V  FR +L+S  + H+L+FWFACQGFK+ DR    K++QL KVIYRAYIRSES  AVPL+ NTKK+IVDK+S ++C DQSIFDTAQ+EIRD+L  EF + F++S+ +
Sbjct:   44 VVDFKVLLNDSQGVEIFRGFLESERATHYLEFWFACQGFKSADR---EKVYQLIKVIYRAYIRSESKTAVPLQPNTKKNIVDKISSKQCLDQSIFDTAQMEIRDVLIKEFYIRFIKSESF 160          

HSP 2 Score: 113.62 bits (283), Expect = 9.654e-26
Identity = 51/83 (61.45%), Postives = 64/83 (77.11%), Query Frame = 1
Query: 2215 LVVGYYIGNDPVPYRTQIPDSQY-ITLGQFKSLVAKKGPFRYFFKRYCDEFD-CGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            ++VGYY   DPVPYRTQ+P  +   TLGQFK L+ ++GP+RYFFKR CDEFD  G V EE  +++ +LPLWEGKVVAK+EK E
Sbjct:  528 IIVGYYFCGDPVPYRTQVPIGESGFTLGQFKMLLPRRGPYRYFFKRPCDEFDGGGAVQEEYTKNEDVLPLWEGKVVAKVEKME 610          
BLAST of axis inhibition protein B vs. Planmine SMEST
Match: SMESG000033276.1 (SMESG000033276.1)

HSP 1 Score: 53.1434 bits (126), Expect = 6.113e-7
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 2227 YYIGNDPVPYRTQIPD-SQYITLGQFK----SLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 2451
            Y++G  P+PY + IP     ITL   K    S+++K   FRYFFK  C   D G   +EIIRD   +P+ +GK++  I++
Sbjct:  329 YFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFK-TCSS-DMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 406          
BLAST of axis inhibition protein B vs. Planmine SMEST
Match: SMESG000003898.1 (SMESG000003898.1)

HSP 1 Score: 52.373 bits (124), Expect = 1.206e-6
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query: 2227 YYIGNDPVPYRTQIPD-SQYITLGQFK----SLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKI 2445
            Y++G  P+PY + IP     ITL   K    S+++K   FRYFFK  C   D G   +EIIRD   +P+ +GK++  I
Sbjct:  329 YFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFK-TCSS-DMGSSKQEIIRDHDSVPIVDGKIIVFI 404          
BLAST of axis inhibition protein B vs. Planmine SMEST
Match: SMESG000049876.1 (SMESG000049876.1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.459e-6
Identity = 32/79 (40.51%), Postives = 47/79 (59.49%), Query Frame = 1
Query: 2227 YYIGNDPVPYRTQI--PDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEKAE 2457
            YY+ ++  PY  +   P  Q ITLG FK+ + +   +++FFK   D+F  GVV EEI  DDA LP   G+VV+ +  +E
Sbjct:    8 YYVDDEETPYLIKFHSPPEQ-ITLGDFKNALNRPN-YKFFFKSLDDDF--GVVKEEITDDDAKLPYVNGRVVSWLVVSE 82          
The following BLAST results are available for this feature:
BLAST of axis inhibition protein B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AXIN16.801e-2151.85axin 1 [Source:HGNC Symbol;Acc:HGNC:903][more]
AXIN16.917e-2151.85axin 1 [Source:HGNC Symbol;Acc:HGNC:903][more]
AXIN23.911e-1745.57axin 2 [Source:HGNC Symbol;Acc:HGNC:904][more]
AXIN23.911e-1745.57axin 2 [Source:HGNC Symbol;Acc:HGNC:904][more]
AXIN24.008e-1745.57axin 2 [Source:HGNC Symbol;Acc:HGNC:904][more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of axis inhibition protein B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Axn5.858e-1240.00gene:FBgn0026597 transcript:FBtr0085554[more]
Axn5.858e-1240.00gene:FBgn0026597 transcript:FBtr0334703[more]
Axn6.093e-1240.00gene:FBgn0026597 transcript:FBtr0085553[more]
Axn6.093e-1240.00gene:FBgn0026597 transcript:FBtr0085555[more]
Axn6.894e-1240.00gene:FBgn0026597 transcript:FBtr0334702[more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
axin14.651e-2050.62axin 1 [Source:NCBI gene;Acc:57931][more]
axin14.651e-2050.62axin 1 [Source:NCBI gene;Acc:57931][more]
axin14.651e-2050.62axin 1 [Source:NCBI gene;Acc:57931][more]
axin27.603e-1938.64axin 2 (conductin, axil) [Source:NCBI gene;Acc:580... [more]
axin26.005e-1838.64axin 2 (conductin, axil) [Source:NCBI gene;Acc:580... [more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak32.336e-2154.43p21 protein (Cdc42/Rac)-activated kinase 3 [Source... [more]
pak32.565e-2154.43p21 protein (Cdc42/Rac)-activated kinase 3 [Source... [more]
ENSXETT00000012979.13.767e-1441.46axin 2 (conductin, axil) [Source:NCBI gene;Acc:100... [more]
ampd28.255e-1333.58adenosine monophosphate deaminase 2 [Source:Xenbas... [more]
ENSXETT00000001825.12.544e-938.46pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Axin12.783e-2151.85axin 1 [Source:MGI Symbol;Acc:MGI:1096327][more]
Axin12.783e-2151.85axin 1 [Source:MGI Symbol;Acc:MGI:1096327][more]
Axin12.831e-2151.85axin 1 [Source:MGI Symbol;Acc:MGI:1096327][more]
Axin24.285e-1745.57axin 2 [Source:MGI Symbol;Acc:MGI:1270862][more]
Axin24.442e-1745.57axin 2 [Source:MGI Symbol;Acc:MGI:1270862][more]
back to top
BLAST of axis inhibition protein B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70239|AXIN1_RAT1.359e-2053.09Axin-1 OS=Rattus norvegicus OX=10116 GN=Axin1 PE=1... [more]
sp|O42400|AXIN1_CHICK2.164e-2054.43Axin-1 OS=Gallus gallus OX=9031 GN=AXIN1 PE=2 SV=1[more]
sp|O35625|AXIN1_MOUSE2.165e-2051.85Axin-1 OS=Mus musculus OX=10090 GN=Axin1 PE=1 SV=3[more]
sp|O15169|AXIN1_HUMAN3.266e-2051.85Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2[more]
sp|Q9YGY0|AXIN1_XENLA3.418e-2053.16Axin-1 OS=Xenopus laevis OX=8355 GN=axin1 PE=1 SV=... [more]
back to top
BLAST of axis inhibition protein B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3C7W90.000e+099.74Axis inhibition protein B OS=Schmidtea mediterrane... [more]
G3C7W81.307e-3157.63Axis inhibition protein A OS=Schmidtea mediterrane... [more]
A0A0X3PP831.047e-2869.14DIX domain-containing protein OS=Schistocephalus s... [more]
A0A5K3FJ313.087e-2774.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3P8GCP77.860e-2767.07DIX domain-containing protein OS=Schistosoma matth... [more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
axin16.432e-2254.43axin 1 [Source:NCBI gene;Acc:103045152][more]
axin16.604e-2254.43axin 1 [Source:NCBI gene;Acc:103045152][more]
ENSAMXT00000037125.13.434e-2049.37axin-1-like [Source:NCBI gene;Acc:103030717][more]
ENSAMXT00000031013.14.531e-2049.37axin-1-like [Source:NCBI gene;Acc:103030717][more]
ENSAMXT00000012689.29.064e-2049.37axin-1-like [Source:NCBI gene;Acc:103030717][more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008444.13.458e-2249.35pep scaffold:Pmarinus_7.0:GL479496:14395:17295:-1 ... [more]
ENSPMAT00000007682.11.968e-2049.38pep scaffold:Pmarinus_7.0:GL479837:661:11661:1 gen... [more]
ENSPMAT00000009992.12.406e-1533.08pep scaffold:Pmarinus_7.0:GL486030:972:8629:-1 gen... [more]
ENSPMAT00000005690.11.938e-1330.83pep scaffold:Pmarinus_7.0:GL485422:2197:11231:-1 g... [more]
ENSPMAT00000009994.14.123e-1331.58pep scaffold:Pmarinus_7.0:GL486030:972:8338:-1 gen... [more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of axis inhibition protein B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO448613.253e-1846.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379291.424e-850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328041.367e-625.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395998.415e-637.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of axis inhibition protein B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000029383.12.129e-2053.16axin-1 [Source:NCBI gene;Acc:101155494][more]
ENSORLT00000012346.22.669e-2053.16axin-1 [Source:NCBI gene;Acc:101155494][more]
axin14.096e-1950.62axin 1 [Source:NCBI gene;Acc:101155852][more]
axin14.343e-1950.62axin 1 [Source:NCBI gene;Acc:101155852][more]
AXIN28.486e-1846.84axin 2 [Source:NCBI gene;Acc:101156143][more]
back to top
BLAST of axis inhibition protein B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025925.10.000e+099.36SMESG000025925.1[more]
SMESG000039725.19.267e-3656.67SMESG000039725.1[more]
SMESG000033276.16.113e-738.75SMESG000033276.1[more]
SMESG000003898.11.206e-639.74SMESG000003898.1[more]
SMESG000049876.13.459e-640.51SMESG000049876.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035066
GenBankADW27178.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035066 ID=SMED30035066|Name=axis inhibition protein B|organism=Schmidtea mediterranea sexual|type=transcript|length=2767bp
GATCTATTTAAATTAAGTTATAATACGAGAAATTTTAGAATTTTTGTTTT
AAGTTTTTCAATTCAGTTTGTGTGACTGACATCGAATCACCCCAGTTCCA
GATGAATAAAATAATCGTGTAATATGAAAAAAGTCTGTCATGACAACCAA
ACTCTAGATTCATCAAATGCCGAATATGTTGTTCTTCAAACTGGCTCAAT
GAGTTCCAATAACAAGCCCATCGTCACGAAAATCGACAATCTCTCTCTGC
TACTTCAAGAAAGTGACAGTGTCACAAATTTTCGTCTCTACCTCGACTCA
ATAAACAGTGGTCATTTTCTCGATTTTTGGTTCGCTTGTCAGGGTTTTAA
AAACTTCGATCGTTCAGATACTCACAAACTTCATCAATTGACAAAAGTCA
TATACCGAGCTTACATTCGATCGGAATCTCCCTATGCGGTTCCGTTGAAA
CAGAACACAAAAAAATCAATTGTCGACAAACTGAGCGATCGAAAATGTTT
CGACCAATCGATATTCGATACAGCTCAATTGGAAATACGGGATATTTTGT
CTGGGGAATTTTTAATGAACTTTCTACAGTCTGATTTCTATATTGAACCG
AAATCATTTGAGAGAAACCTTTTATCAAACAACTCGAGAATCCAAGAACA
GATTAGTGATATTCCAGTTTCGAGCTGTTCCAGTTCAGGTCACATCGGCC
GCAAATCTAGCAGTGCCAGAATCAATGCGATAGCTTCACGAGGTTCGGAA
GGTGTCAATGATGGAAACTGCAATAAAGGCTCAACTGACAATTCATTCGG
ACAACTCTATACAGCTCAAAACACTGGAACGATTACAACAGTGTTTAATA
ATAACCTCATGGGAAACAACGGCAGCGGAACAGGTTCTAAAGACAGACGT
AATTTATCAGAAATCGATCCACAAGCTTTCGCAAAATTATTGTACACAAA
ATTAGAAGAAATTGTTGAAGAGCAGATGAAGTTCGAAAAGATTCTCCGTC
TTGTCAAATCGGTACCAACAGAGTCAGACACAGATGACAGCAGCTCATCG
GCAATTAGCTATTTGATGCATTGCCAGTGGGTTCATTCACAGGGTGCTAA
TTTTAAAAACTCCGTCGATTCCGAGCTTGTTGAGGCTGCCAATGCATTGA
CAATGAAAGCAAGCTGTAAATTGAAGACAACTTACAGACCCGGTGACTTA
CGAGATGATCATGCTCAAGACATTCTGGAGAATCATTGTTTAAGAATCGG
TCTCGATGAGCCGGCAACGAGGCATTTAAAACGAGAGTTATCAGATGGGA
AAAATAGATGGAGAAGAGAACACGATTTGGGTTCAATAACATCATACGAC
AGCGGAGTTGCCACGTCTCTTGAACAATATTCGAATTTAGGAATACCCGG
GTCGATTTTAGAAAATGTCCCATGGCAAAAATCTAATTTCAAATCCCTAA
ATCTCAATGAAATCGGAATTGATAACTCCCCAAGTAGTCATAGGTATCAT
CATCACCATCATCATCATCATCATAAAAACCATTTTCCCTTGCCAAAAAA
TCAAATCGTAATGGAGAGCACCGACACTAGTGGTTTTTCGTATTTTAAAG
ACTCACCGACGAAAAAGAATAACATTTCTGAAGTATCGAGTAACTTCGAT
TCAGGAGTCAGTTCAGCCTATGAGAATATGGGAAGGCGTTTTCAGCCAAT
GAACGACAAAGTCAGCAATTGGATGTGTAAAAATTCCAACATTACCTCAA
CTGGTCCATATAATTTTCACGAATACGACTCGAACAATGCATCAGGGATT
CCTCCAAATACACCTCTCATATCTGCCAGGGGCGGCTTTACCTCACCATC
ATTTTGTGACATCTATCCGAATCAGATTTACATGCTTCCGAAACCAATTA
AACAGGTGAATCTCTATTCACCTGTTCCTGAATGTGATTCAATACCTCAT
CAGAGTTTAGAAAGCTGGCTCGAACAGCAGGCTACAGTTAGCGCTTCGGC
GTTAATTGGCAAAACTTTGAAAATGAACAACACAAATTTACAGAAACCTT
GTTTTTGCACAAATACTGCTGGAATCAATGATTTGGGATTTATTGCTCCA
GAAATAAGTGAGCCATGTGATAACCGAGATCAGGCCGCAAATGATCCGAA
ACTTAATCTGACTAATAAGGACTCTCAAATTACGAAAACAAATACATCAT
CGAAATCAAATTCTCTTGTCGTTGGTTACTATATAGGAAATGACCCTGTT
CCTTACCGCACTCAAATACCGGATTCTCAATATATTACGCTTGGGCAATT
CAAATCACTAGTCGCGAAAAAAGGACCTTTCAGATATTTCTTCAAGCGGT
ATTGTGATGAATTCGACTGTGGAGTAGTCCACGAAGAGATTATCAGAGAT
GATGCTATCTTGCCATTATGGGAAGGGAAAGTCGTAGCTAAAATTGAAAA
AGCAGAGTGAATTTTTTGTACAAAAAATTTTCGCTTTAAAATTTGTTTTT
CATTTTATTTCGATTCTCGATTTTTCAATTTTTCAAATTTCATTCTAAAC
ACTATTGTTAATGATAGTAGAAAAACAACAGTAAATTAAAACAAGAAAAC
TTTCTATGAAAGTGAAAATTCGAAATCGGTTTTAGTTGGTTTTTTTATTT
ATTTTTTAAAAATTGAAAATCTCGTAGAAAAACAAATGTTTATGTGTGTA
TAAAAAAATCCACGATTTTAACAAATATTTTATCACTCGATGAAAATGTC
TTTGTAAATATGTTATC
back to top

protein sequence of SMED30035066-orf-1

>SMED30035066-orf-1 ID=SMED30035066-orf-1|Name=SMED30035066-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=779bp
MKKVCHDNQTLDSSNAEYVVLQTGSMSSNNKPIVTKIDNLSLLLQESDSV
TNFRLYLDSINSGHFLDFWFACQGFKNFDRSDTHKLHQLTKVIYRAYIRS
ESPYAVPLKQNTKKSIVDKLSDRKCFDQSIFDTAQLEIRDILSGEFLMNF
LQSDFYIEPKSFERNLLSNNSRIQEQISDIPVSSCSSSGHIGRKSSSARI
NAIASRGSEGVNDGNCNKGSTDNSFGQLYTAQNTGTITTVFNNNLMGNNG
SGTGSKDRRNLSEIDPQAFAKLLYTKLEEIVEEQMKFEKILRLVKSVPTE
SDTDDSSSSAISYLMHCQWVHSQGANFKNSVDSELVEAANALTMKASCKL
KTTYRPGDLRDDHAQDILENHCLRIGLDEPATRHLKRELSDGKNRWRREH
DLGSITSYDSGVATSLEQYSNLGIPGSILENVPWQKSNFKSLNLNEIGID
NSPSSHRYHHHHHHHHHKNHFPLPKNQIVMESTDTSGFSYFKDSPTKKNN
ISEVSSNFDSGVSSAYENMGRRFQPMNDKVSNWMCKNSNITSTGPYNFHE
YDSNNASGIPPNTPLISARGGFTSPSFCDIYPNQIYMLPKPIKQVNLYSP
VPECDSIPHQSLESWLEQQATVSASALIGKTLKMNNTNLQKPCFCTNTAG
INDLGFIAPEISEPCDNRDQAANDPKLNLTNKDSQITKTNTSSKSNSLVV
GYYIGNDPVPYRTQIPDSQYITLGQFKSLVAKKGPFRYFFKRYCDEFDCG
VVHEEIIRDDAILPLWEGKVVAKIEKAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000062esophagus
PLANA:0000081pharynx pouch
PLANA:0000097ventral nerve cord
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038207DIX_dom_sf
IPR036305RGS_sf
IPR001158DIX
IPR016137RGS
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0030159receptor signaling complex scaffold activity
Vocabulary: cellular component
TermDefinition
GO:0030877beta-catenin destruction complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001158DIX domainSMARTSM00021dax_2coord: 695..778
e-value: 4.3E-24
score: 96.0
IPR001158DIX domainPFAMPF00778DIXcoord: 697..775
e-value: 6.0E-31
score: 106.1
IPR001158DIX domainPROSITEPS50841DIXcoord: 695..778
score: 28.096
IPR016137RGS domainSMARTSM00315RGS_3coord: 39..160
e-value: 1.8E-17
score: 74.0
IPR016137RGS domainPFAMPF00615RGScoord: 40..156
e-value: 4.6E-17
score: 62.4
IPR016137RGS domainPROSITEPS50132RGScoord: 39..156
score: 20.247
IPR038207DIX domain superfamilyGENE3DG3DSA:3.10.20.380coord: 694..778
e-value: 4.2E-35
score: 121.4
NoneNo IPR availableGENE3DG3DSA:1.10.167.10coord: 62..144
e-value: 8.7E-24
score: 85.6
NoneNo IPR availablePANTHERPTHR46102FAMILY NOT NAMEDcoord: 30..159
coord: 678..777
coord: 260..524
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 32..159
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 696..777