otopetrin-2

Overview
Nameotopetrin-2
Smed IDSMED30035065
Length (bp)2819
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of otopetrin-2 (SMED30035065) t-SNE clustered cells

Violin plots show distribution of expression levels for otopetrin-2 (SMED30035065) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of otopetrin-2 (SMED30035065) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for otopetrin-2 (SMED30035065) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035065SMESG000028508.1 SmedASXL_007802SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30035065SMESG000028508.1 SmedASXL_064710SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30035065SMESG000028508.1 dd_Smed_v6_22541_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of otopetrin-2 vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 55.0694 bits (131), Expect = 1.940e-7
Identity = 57/233 (24.46%), Postives = 117/233 (50.21%), Query Frame = 3
Query: 2067 INCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFG----GVYLYNISCILAWKTALNAPSAPFVMV-SSLCTIIHGTLQTIFVLLTIAR-MSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKIV 2747
            ++C  +  G F+GL  L V+  S+++ Y F+  +  +      ++ T+M   +++T+  +T++Y +R    L Y N   +++++++ ++   L      G  +Y+++ ++         +  F+++   +  +I    QT   LL +AR + +       +P K+ ++F+L  N+AI+ + +F   +   SE I E  YG   WV + R   PLT+ Y+  S +  A IWK V
Sbjct:  385 VDCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQSAAFVYAF-TDMFQYVLSTIGVLTAIYQMRA---LKYFNKKTKLQNSDQELLDQILLSIGLVGELIYSVAGLVGLTGEKQWTNFSFILLFVHIFRLIQVGTQTF--LLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEY-YGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNV 610          
BLAST of otopetrin-2 vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 55.0694 bits (131), Expect = 1.947e-7
Identity = 57/233 (24.46%), Postives = 117/233 (50.21%), Query Frame = 3
Query: 2067 INCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFG----GVYLYNISCILAWKTALNAPSAPFVMV-SSLCTIIHGTLQTIFVLLTIAR-MSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKIV 2747
            ++C  +  G F+GL  L V+  S+++ Y F+  +  +      ++ T+M   +++T+  +T++Y +R    L Y N   +++++++ ++   L      G  +Y+++ ++         +  F+++   +  +I    QT   LL +AR + +       +P K+ ++F+L  N+AI+ + +F   +   SE I E  YG   WV + R   PLT+ Y+  S +  A IWK V
Sbjct:  369 VDCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQSAAFVYAF-TDMFQYVLSTIGVLTAIYQMRA---LKYFNKKTKLQNSDQELLDQILLSIGLVGELIYSVAGLVGLTGEKQWTNFSFILLFVHIFRLIQVGTQTF--LLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEY-YGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNV 594          
BLAST of otopetrin-2 vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 54.6842 bits (130), Expect = 2.484e-7
Identity = 78/406 (19.21%), Postives = 174/406 (42.86%), Query Frame = 3
Query: 1560 LSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQ-------ISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLL--SYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDP---IPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            ++ +F   Q +FV  + K I T   +   FG++H+T TN+             +++I  +         E+V   R++   N+ K    S    ++ E+       I +    ++Y   ++YS +   +  +  ++++ ++       +                      R +  I+C  + +G F G       ++++I + +F+  SS K V   I   T M   +++T + V + + +R +  L        +  E  +RI++   L G + +++I  IL++   +       +  +++  +I  T Q+  +L+  +R+ + +    +   KP K+ ++ +LM N A + + +F   +   ++ +  + YG  +W ++ R   PLT+ Y+  S    A IWK
Sbjct:  188 MAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNL----------WMWLRYILYEE-------VETVKEIRHVQHANLSK---ASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMKK--------------------RSILKIDCSRTAEGLFAGF---ACIIVTIIAIALFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGEL-IFSIGGILSFINNMTIGLPLIIFTTNVLRLIQVTFQSC-LLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHM-YGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWK 547          
BLAST of otopetrin-2 vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 54.6842 bits (130), Expect = 2.484e-7
Identity = 78/406 (19.21%), Postives = 174/406 (42.86%), Query Frame = 3
Query: 1560 LSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQ-------ISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLL--SYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDP---IPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            ++ +F   Q +FV  + K I T   +   FG++H+T TN+             +++I  +         E+V   R++   N+ K    S    ++ E+       I +    ++Y   ++YS +   +  +  ++++ ++       +                      R +  I+C  + +G F G       ++++I + +F+  SS K V   I   T M   +++T + V + + +R +  L        +  E  +RI++   L G + +++I  IL++   +       +  +++  +I  T Q+  +L+  +R+ + +    +   KP K+ ++ +LM N A + + +F   +   ++ +  + YG  +W ++ R   PLT+ Y+  S    A IWK
Sbjct:  188 MAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNL----------WMWLRYILYEE-------VETVKEIRHVQHANLSK---ASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMKK--------------------RSILKIDCSRTAEGLFAGF---ACIIVTIIAIALFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIGEL-IFSIGGILSFINNMTIGLPLIIFTTNVLRLIQVTFQSC-LLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHM-YGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWK 547          
BLAST of otopetrin-2 vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 54.299 bits (129), Expect = 3.757e-7
Identity = 57/233 (24.46%), Postives = 117/233 (50.21%), Query Frame = 3
Query: 2067 INCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFG----GVYLYNISCILAWKTALNAPSAPFVMV-SSLCTIIHGTLQTIFVLLTIAR-MSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKIV 2747
            ++C  +  G F+GL  L V+  S+++ Y F+  +  +      ++ T+M   +++T+  +T++Y +R    L Y N   +++++++ ++   L      G  +Y+++ ++         +  F+++   +  +I    QT   LL +AR + +       +P K+ ++F+L  N+AI+ + +F   +   SE I E  YG   WV + R   PLT+ Y+  S +  A IWK V
Sbjct:  506 VDCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQSAAFVYAF-TDMFQYVLSTIGVLTAIYQMR---ALKYFNKKTKLQNSDQELLDQILLSIGLVGELIYSVAGLVGLTGEKQWTNFSFILLFVHIFRLIQVGTQTF--LLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEY-YGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNV 731          
BLAST of otopetrin-2 vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0346834)

HSP 1 Score: 85.8853 bits (211), Expect = 1.209e-16
Identity = 99/425 (23.29%), Postives = 198/425 (46.59%), Query Frame = 3
Query: 1527 CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPII--FGVVHMTATN--------INSITHNIVS-YKTLMKFIKTKSNLLEAPVTESVL---TTRNIFSPNILKMNGT--SCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLT--EMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEII--YGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            CH++ + +     + F   Q YF+ L+ + I   + + II  FG++HM  TN        I    H I++ Y    + ++    +       +++    T ++  P  LK       C   +I+  +   +  +L+P +I+YS +   I  ++  S+   Q      P             +             +++C  ++KG F+G+  L++++ISLI+ ++   +   + V M ++ +T  E+++    T+ T+  +  +R +   +Y     R  S + I++  +  G  +LYNI  ++A    L +     V +++L +I+    QT+F+L    R ++S     KKP +E V+F+L+ N+A+W +   + L+ S +E+ P  +  YG   W +I  +S+PL + Y+  S + L  IWK
Sbjct: 1047 CHNVLLALTPATRMAFIFIQMYFIFLNNEQIKV-YRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRP-------------DMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRP--EFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAY-----RSFSLDDILLVGAQTGS-FLYNIFTVIAGHFTLRSDDM-LVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAI---STLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWK 1445          
BLAST of otopetrin-2 vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331167)

HSP 1 Score: 85.5001 bits (210), Expect = 1.780e-16
Identity = 99/425 (23.29%), Postives = 198/425 (46.59%), Query Frame = 3
Query: 1527 CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPII--FGVVHMTATN--------INSITHNIVS-YKTLMKFIKTKSNLLEAPVTESVL---TTRNIFSPNILKMNGT--SCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLT--EMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEII--YGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            CH++ + +     + F   Q YF+ L+ + I   + + II  FG++HM  TN        I    H I++ Y    + ++    +       +++    T ++  P  LK       C   +I+  +   +  +L+P +I+YS +   I  ++  S+   Q      P             +             +++C  ++KG F+G+  L++++ISLI+ ++   +   + V M ++ +T  E+++    T+ T+  +  +R +   +Y     R  S + I++  +  G  +LYNI  ++A    L +     V +++L +I+    QT+F+L    R ++S     KKP +E V+F+L+ N+A+W +   + L+ S +E+ P  +  YG   W +I  +S+PL + Y+  S + L  IWK
Sbjct: 1047 CHNVLLALTPATRMAFIFIQMYFIFLNNEQIKV-YRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRP-------------DMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRP--EFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAY-----RSFSLDDILLVGAQTGS-FLYNIFTVIAGHFTLRSDDM-LVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAI---STLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWK 1445          
BLAST of otopetrin-2 vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331168)

HSP 1 Score: 85.1149 bits (209), Expect = 2.440e-16
Identity = 99/425 (23.29%), Postives = 198/425 (46.59%), Query Frame = 3
Query: 1527 CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPII--FGVVHMTATN--------INSITHNIVS-YKTLMKFIKTKSNLLEAPVTESVL---TTRNIFSPNILKMNGT--SCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLT--EMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEII--YGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            CH++ + +     + F   Q YF+ L+ + I   + + II  FG++HM  TN        I    H I++ Y    + ++    +       +++    T ++  P  LK       C   +I+  +   +  +L+P +I+YS +   I  ++  S+   Q      P             +             +++C  ++KG F+G+  L++++ISLI+ ++   +   + V M ++ +T  E+++    T+ T+  +  +R +   +Y     R  S + I++  +  G  +LYNI  ++A    L +     V +++L +I+    QT+F+L    R ++S     KKP +E V+F+L+ N+A+W +   + L+ S +E+ P  +  YG   W +I  +S+PL + Y+  S + L  IWK
Sbjct: 1047 CHNVLLALTPATRMAFIFIQMYFIFLNNEQIKV-YRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRP-------------DMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRP--EFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAY-----RSFSLDDILLVGAQTGS-FLYNIFTVIAGHFTLRSDDM-LVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAI---STLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWK 1445          
BLAST of otopetrin-2 vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0344796)

HSP 1 Score: 82.0333 bits (201), Expect = 1.115e-15
Identity = 93/451 (20.62%), Postives = 192/451 (42.57%), Query Frame = 3
Query: 1524 DCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPII--FGVVHMTATNINSI----------------------THNIVSYKTLMKFIKTKS---------------NLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILA-----WKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKI 2744
             C  +F+ +     ++  I Q  F+ L+  + +    H +   FG++HM ATN+                          H++V + + M      +               N L A V+  ++      SP     +G  C    IM  +      +L+P +I+YS +  VI   +  ++ S+ D++ +   +    + + +                +++C  S+KG F G+  +++++IS+IM ++   +   +LV  +   L E  +  +     +T +  +RD+  +   ++ +     + +++  +   GVYLY +  IL      W T    P     +++ +  ++  +LQT+F+L +  R         +KP +E ++F+L+ N+AIW +    + +    E+  E  +G   W +I  +S+PL + Y+  S I L  +WKI
Sbjct:  211 GCRDVFVAITPICRMVLCIAQVQFIFLN-TTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSG--CSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHF-------------SVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQ-TGVYLYGMFSILGSYFAKWDTV---PDRVEGIIAEVFGVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHLEF-FGVWGWTIITHISMPLAIFYRFHSTICLFEVWKI 640          
BLAST of otopetrin-2 vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0340589)

HSP 1 Score: 82.4185 bits (202), Expect = 1.198e-15
Identity = 93/451 (20.62%), Postives = 192/451 (42.57%), Query Frame = 3
Query: 1524 DCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPII--FGVVHMTATNINSI----------------------THNIVSYKTLMKFIKTKS---------------NLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILA-----WKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKI 2744
             C  +F+ +     ++  I Q  F+ L+  + +    H +   FG++HM ATN+                          H++V + + M      +               N L A V+  ++      SP     +G  C    IM  +      +L+P +I+YS +  VI   +  ++ S+ D++ +   +    + + +                +++C  S+KG F G+  +++++IS+IM ++   +   +LV  +   L E  +  +     +T +  +RD+  +   ++ +     + +++  +   GVYLY +  IL      W T    P     +++ +  ++  +LQT+F+L +  R         +KP +E ++F+L+ N+AIW +    + +    E+  E  +G   W +I  +S+PL + Y+  S I L  +WKI
Sbjct:  360 GCRDVFVAITPICRMVLCIAQVQFIFLN-TTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSG--CSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHF-------------SVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQEVTLWETFMYFMCAAAVITGMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQ-TGVYLYGMFSILGSYFAKWDTV---PDRVEGIIAEVFGVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHLEF-FGVWGWTIITHISMPLAIFYRFHSTICLFEVWKI 789          
BLAST of otopetrin-2 vs. UniProt/SwissProt
Match: sp|B7Z0W9|OTOP_DROME (Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 1.784e-15
Identity = 99/425 (23.29%), Postives = 198/425 (46.59%), Query Frame = 3
Query: 1527 CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPII--FGVVHMTATN--------INSITHNIVS-YKTLMKFIKTKSNLLEAPVTESVL---TTRNIFSPNILKMNGT--SCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLT--EMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEII--YGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            CH++ + +     + F   Q YF+ L+ + I   + + II  FG++HM  TN        I    H I++ Y    + ++    +       +++    T ++  P  LK       C   +I+  +   +  +L+P +I+YS +   I  ++  S+   Q      P             +             +++C  ++KG F+G+  L++++ISLI+ ++   +   + V M ++ +T  E+++    T+ T+  +  +R +   +Y     R  S + I++  +  G  +LYNI  ++A    L +     V +++L +I+    QT+F+L    R ++S     KKP +E V+F+L+ N+A+W +   + L+ S +E+ P  +  YG   W +I  +S+PL + Y+  S + L  IWK
Sbjct: 1047 CHNVLLALTPATRMAFIFIQMYFIFLNNEQIKV-YRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRP-------------DMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRP--EFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAY-----RSFSLDDILLVGAQTGS-FLYNIFTVIAGHFTLRSDDM-LVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAI---STLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWK 1445          
BLAST of otopetrin-2 vs. TrEMBL
Match: A0A1S3HXZ4 (otopetrin-2 OS=Lingula unguis OX=7574 GN=LOC106159232 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 5.935e-26
Identity = 152/635 (23.94%), Postives = 276/635 (43.46%), Query Frame = 3
Query:  960 QSLDYSVSNFRTLICQILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLT---VFHLSDCKGQPKRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFESLFKXXXXXXXXXXMIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNI-----------------NSITHNIVSYKTLMKF----IKTKSNLLEAPVTESV-------LTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLL----------LSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            Q+L      FR+ +  ILS +Y   +  +  VL I++    P + +  E+F I+ + VSI+FL     F L +          S +   R Q     H  I+      E   K + DSS                  GS  +               ++  +   I +M+ + +      E+  ++      C +I + VR  + L+FT  Q YF+ L+ K  + K+     FG++HM ATNI                  ++  ++  Y +L  F    ++  + +L+    E+        +TTRN   P IL +    C   DIM  +   +  YLYP ++QYS + + I   +          LS+  S    N+S P N                   N R++  ++C+ S KG F+G+  L+V++IS+I  ++  +K S + + + + +  E+ L +IT +  + + + ++D+       NI +    +  ++  SL G VY+++I  I+A            ++V+    ++  +L TIFVL  + R S        KP +E V+F+L+ N+A+WG+ IF + + +    +    YG + WV+I  +S PL + ++  + + LA IW+
Sbjct:  226 QALRNMQEAFRSSLFNILSGLYSIFVIILGAVLPIAEIFAQPVAINFFEAFYIYLYGVSIIFLIYVYAFLLQNAT--------SEYTRKRAQQANNAHTAIL------EKSRKVSIDSS------------------GSHHTGSF----------YLRLGAVGFGIGNMLLDGLRFGEFFEMDLSSP-----CSNILLAVRPMVHLVFTFVQLYFIFLNSKMCIHKYKVLARFGLMHMFATNICVWLRNLMKETLRELQHKAVNTSLTEYLSLQHFTPVHLRDAAGVLKQGAAEAPNYNISTNMTTRN---PPILTL--LDCQRRDIMGNVVDQAAPYLYPCAVQYSLIGSAILYTIWRNIGKRTSPLSTFYSTIQNNWS-PKNKVQTQRPVCD---------NQRQI--VDCQGSTKGLFVGILLLVVTIISMIAFFVLVEKPSYQSIAVIVVHAAEITLHLITAVTVLAAFFRVQDLYF-----NIKKDIGLDETLLLISLTG-VYIFSIFSIVAGYYNTTTYGGTLIVVTGTLQLLESSLLTIFVLNGLRRRSYKPSHEESKPGRELVTFLLVCNIAMWGVNIF-QTRRAEVNPVQTDFYGNLLWVIISHISTPLNIFFRFHAAVCLANIWR 789          
BLAST of otopetrin-2 vs. TrEMBL
Match: A0A1S3KEJ4 (otopetrin-1-like OS=Lingula unguis OX=7574 GN=LOC106181265 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 9.006e-26
Identity = 115/443 (25.96%), Postives = 210/443 (47.40%), Query Frame = 3
Query: 1527 CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNI-----------------NSITHNIVSYKTLMKF----IKTKSNLLEAPVTE-------SVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLL----------LSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            C +I + VR  + L+FT  Q YF+ L+ K  + K+     FG++HM ATNI                  ++  ++  Y +L  F    ++  + +L+    E       + +TTRN   P IL +    C   DIM  +   +  YLYP ++QYS + + I   +          LS+  S    N+S P N                   N R++  ++C+ S KG F+G+  L+V++IS+I  ++  +K S + + + + +  E+ L +IT +  + + + ++D+       NI +    +  ++  SL  GVY+++I  I+A            ++V+    ++  +L TIFVL  + R S        KP +E V+F+L+ N+A+WG+ IF + + +    +    YG + WV+I  +S PL + ++  + + LA IW+
Sbjct:  149 CSNILLAVRPMVHLVFTFVQLYFIFLNSKMCIHKYKVLARFGLMHMFATNICVWLRNLMKETLRELQHKAVNTSLTEYLSLQHFTPAHLRDATGVLKQGAAEVPNYNISTNMTTRN---PPILTL--LDCQRRDIMGNVVDQAAPYLYPCAVQYSLIGSAILYTIWRNIGKRTSPLSTFYSTIQNNWS-PKNKVQTQRPVCD---------NQRQI--VDCQGSTKGLFVGILLLVVTIISMIAFFVLVEKPSYQSIAVIVVHAAEITLHLITAVTVLAAFFRVQDLYF-----NIKKDIGLDETLLLISL-TGVYIFSIFSIVAGYYNTTTYGGTLIVVTGTLQLLESSLLTIFVLNGLRRRSYKPSHEESKPGRELVTFLLVCNIAMWGVNIF-QTRRAEVNPVQTDFYGNLLWVIISHISTPLNIFFRFHAAVCLANIWR 567          
BLAST of otopetrin-2 vs. TrEMBL
Match: A0A210Q965 (Otopetrin-2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12734 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 9.557e-25
Identity = 112/424 (26.42%), Postives = 209/424 (49.29%), Query Frame = 3
Query: 1509 AERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMK-----FIKTKSNLLEAP---VTESVLTTRN--IFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQ---DVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            +E   +C +    VR  L L FT  Q YFV L+ K  + ++     FG++HM ATN+     NIV  +TL +     F + ++     P     +SV   +N  + S  IL+ NG S     +M+ +   S  YLYP S++YS +   I  ++  ++   Q   D N  L + S  ++                 +   ++C  S++G FIG+F L+ +VI++I+ ++     S     +K+ +L+E+++ ++T++  + + + ++ +   S    I+  ES   I +      G + + +  I+A        +   V++SS+  +   TLQT+F+L  + + +       +KP +EFV+F+L+ N+A+W +  F E+  S +  +    YG V W ++  +S+PLT+ Y+  S + L+ IWK
Sbjct:  408 SESFSNCSNPLHGVRPLLQLSFTFIQLYFVFLNSKMCIHRYKSLARFGLMHMVATNLCVWVENIVR-ETLREIETYNFRQREAGTWLGPNVSNNQSVHQVQNGSMTSAGILRCNGNS-----LMKSVVESSGPYLYPCSVEYSIICAGILYVMWKNIGRFQMGYDGNEVLDIESKAKA-----------------QRINVDCSGSSRGLFIGIFVLVATVITMIIFFVLIGSMSYLDTALKLEHLSEVVIYVLTSIAVILAFHRMQSLR-YSIEKQIDLEESLLLIGLV-----GEFTFGLFSIIAAAMDSQESNGFLVILSSVLGMFQATLQTVFLLHALRKSAGKREHERQKPGREFVTFLLVCNIALWSITTF-EVLRSQANPMQLNYYGVVAWNIVNHVSIPLTIFYRFHSTVCLSNIWK 801          
BLAST of otopetrin-2 vs. TrEMBL
Match: R7T6T3 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_165173 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.560e-24
Identity = 101/414 (24.40%), Postives = 202/414 (48.79%), Query Frame = 3
Query: 1524 DCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNIFSPNILKMNG---TSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLT-----AINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            +C  +  +VR  + L FT FQ YF+ L+ +  + K+     FG++HM ATNI  +   +V  +T+    +++ +       +  +        N L + G    +C   +IM ++   +  YLYP +I+YS +   I  ++        +++ S P                    S+C  L      +++C  +N+G F G+F+L+ ++ISLI+ ++      L+   + + +++E+ L  +  +  + +   +R    L +  N ++ E    +++ S +  GVY+Y++  I+A +   +  +  F M ++   ++  T+QT+F+L  + R   S     KKP +EFV+F+L+ N+ +WG+  F E+  + S  +    YG + W +I  ++ PL + Y+  S + L+ IWK
Sbjct:  124 ECIHVLTLVRPVIQLTFTFFQLYFIFLNSRMCIHKYRTLARFGLMHMVATNI-CVWLRVVIQETVHDIHRSQGH-------KGKVNKFYCLDFNFLFLAGNESVACIEQEIMGKVVENASPYLYPCTIEYSLIAAGILYIMW------LNISKSAPT---------------PSTPSDCGHLKKHLRMSVDCAGANRGLFFGIFTLVATIISLIIFFVLVDIPHLQGSAVMVVHVSELTLYCLALIAVIVASVKIRQ---LRFDTN-HKDELDGILILISQM--GVYVYSVFSIVAGRYGDDLITGIFTMATNALIMLQATVQTVFILNGLRRSPRSCFHERKKPGREFVTFLLVCNIGMWGINTF-EVLRADSNPLALNYYGFLPWSIISHVATPLAIFYRFHSTVCLSAIWK 501          
BLAST of otopetrin-2 vs. TrEMBL
Match: A0A4Y2W5E3 (Proton channel OtopLc (Fragment) OS=Araneus ventricosus OX=182803 GN=CG42265_7 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.818e-24
Identity = 111/433 (25.64%), Postives = 210/433 (48.50%), Query Frame = 3
Query: 1455 MIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIK---TKSNLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAP--FVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIW 2738
            M+ N +E  +  EI  ++      C+SI + +   L ++FT  Q YF+  + +  + KF     FG++H+ ATNI  +    V  +TL + +K   ++     + + E +L  R     N +K N   C   DIM  I S S  +L+PF ++YS +   +  ++  ++   +D  F+             SSE    R+S+ + L  +NC  S+KG F GL  L+++ I LI+ ++  +     L+ + +S ++   + ++T        + ++ +         +R +    I++  + +G +Y+Y +  I+A  T       P   VMV+S  TI+  TLQ++FV     R +        KP ++ V+F++M N+ +W +  F E+Q + +  +    YG + W +I R ++PL++ Y+  S I+ A +W
Sbjct:    1 MVYNGLEFGSFFEIPSSS-----PCYSILLGINPVLQMMFTFAQMYFIFANARLNIHKFKVLARFGLMHVVATNI-CVWIRTVGKETLQEIVKHHLSQERGHPSSLEELILPFRE----NYIKNNSNPCQKQDIMGSIVSDSSPFLFPFIVEYSLIGAAVLYVMWKNIG--KDPVFA------------ESSEDGLSRASSVQTLPKMNCAGSSKGLFFGLLVLVIATICLIVFFVLIENEHYSLLAIFLSDVSHSAIMVLTLFTIGIGFFRIQRLKF-----QADRTDHLRDILLTVAAYG-LYVYAMFGIIA-GTLSPKDYVPNLLVMVTSCLTIVQVTLQSLFVAEITCRTTYLPEHDQTKPGRQVVAFLMMGNLTLWIIYTF-EMQKAEASPVQLGFYGFMAWTVIVRATLPLSIFYRFHSSITFAEVW 401          
BLAST of otopetrin-2 vs. Planmine SMEST
Match: SMESG000028508.1 (SMESG000028508.1)

HSP 1 Score: 1613.2 bits (4176), Expect = 0.000e+0
Identity = 884/886 (99.77%), Postives = 885/886 (99.89%), Query Frame = 3
Query:   90 FSSQINMHQSSSESSIDKNKFPSVINLYASDNEQSRSDHYSDEYDKNFGTLSGLSDDTRFEMKTLYTIEERNLSNFKISGSESSSDHNQKKSDNQAVLLXXXXXXXXXXXGQDRMXXXXXXXXXEEGLLTKTKSKPKPQSYIFKGKNNSEHQSLCKKQIPDDVHSLKTQPNCPXXXXXXXXXXXGKFANIFSKRVMIRGSYSQDVSQFRHSGLSNRSALGSIPHVFRLNSQAADSGISNTSPDTLSSTEFYQRNLEDSRFVSKCNRLTSNFPWHGGNIPPSILKHRRRNNQSLDYSVSNFRTLICQILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLTVFHLSDCKGQPKRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFESLFKXXXXXXXXXXMIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKIV 2747
            FSSQINMHQSSSESSIDKNKFPSVINLYASDNEQSRSDHYSDEYDKNFGTLSGLSDDTRFEMKTLYTIEERNLSNFKISGSESSSDHNQ+KSDNQAVLLEYESESSAEESGQDRMSTTSTSTSSEEGLLTKTKSKPKPQSYIFKGKNNSEHQSLCKKQIPDDVHSLKTQPNCPSSPSMWSSSTSGKFANIFSKRVMIRGSYSQDVSQFRHSGLSNRSALGSIPHVFRLNSQAADSGISNTSPDTLSSTEFYQRNLEDSRFVSKCNRLTSNFPWHGGNIPPSILKHRRRNNQSLDYSVSNFRTLICQILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLTVFHLSDCKGQPKRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFESLFKVSILVVSIISMIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNI SPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNSTFRSVRESSSETERLRSSNCRKLTAINCKNSNKGFFIGLFSLLVSVISLIMLYIFSKKSSLKLVGMKISYLTEMILTIITTLVTVTSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKIV
Sbjct: 1007 FSSQINMHQSSSESSIDKNKFPSVINLYASDNEQSRSDHYSDEYDKNFGTLSGLSDDTRFEMKTLYTIEERNLSNFKISGSESSSDHNQRKSDNQAVLLEYESESSAEESGQDRMSTTSTSTSSEEGLLTKTKSKPKPQSYIFKGKNNSEHQSLCKKQIPDDVHSLKTQPNCPSSPSMWSSSTSGKFANIFSKRVMIRGSYSQDVSQFRHSGLSNRSALGSIPHVFRLNSQAADSGISNTSPDTLSSTEFYQRNLEDSRFVSKCNRLTSNFPWHGGNIPPSILKHRRRNNQSLDYSVSNFRTLICQILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLTVFHLSDCKGQPKRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFESLFKVSILVVSIISMIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNILSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNSTFRSVRESSSETERLRSSNCRKLTAINCKNSNKGFFIGLFSLLVSVISLIMLYIFSKKSSLKLVGMKISYLTEMILTIITTLVTVTSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWKIV 1892          
BLAST of otopetrin-2 vs. Planmine SMEST
Match: SMESG000031517.1 (SMESG000031517.1)

HSP 1 Score: 194.512 bits (493), Expect = 8.213e-51
Identity = 186/731 (25.44%), Postives = 340/731 (46.51%), Query Frame = 3
Query:  771 LNSQAADSGISNTSPDTLSSTEFYQRNLEDSRFVSKCNRLTSN---FPWHG------------------GNIPPSILKHRRRNNQSLDYSVSNFRTLICQILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLTVFHLSDCKGQP-KRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFES----------------------LFKXXXXXXXXXXMIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIV----------------------SYKTLMKFIKTKSNL-LEAPVTESVLTTRNIFSPNILKMNGTS--CFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRK---LTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRI--ESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            L+SQAADSGISNTSP+T SSTEFYQR L D+    K +  +S     P  G                  G  P SILK  + ++ SL    ++F+  +  I+S +Y  LL TI +VL + +        +  E F IF + V I+FL   +    + Q   RF +    + + +                 L      D++++++      +  + N D   R C++N +   + E                       L ++++L + ++SMIR+ +     ++ + +       C S  + VR   SL++T  Q YF+ ++ K    KF      G++HM A N++ +   ++                      +     +F+K +    L+ P  E +L  +   SP   + N T   C   D+M+ +   S+ Y+YP ++QY  +T     LL  S  +++  +     N T      S +  +R      RK   L+   C  S KG F+GL +++ +++ L++ +I  +K +L+L  ++ISY  E+ L +  T+ TV + + ++D  LL  P   +R   +     ++  S+  GVYL++++ I+  +     P +PF+++ S+ +++  ++Q+IFV   + R+S        KP +E V+F+L+ N A+W L +F + +      +   ++G   W +I  +++PL L++++ S+I+LAVIWK
Sbjct:  250 LHSQAADSGISNTSPETQSSTEFYQRKLHDTIISGKVSHSSSGRFSVPSIGITGTGMGPKLHHTPRLPSGQYPQSILKFSK-DHFSLIQITADFKNYLFTIISAMYAMLLLTISVVLPVIEITTPHAFFNAYEGFYIFLYVVGIMFLVYIYGYLLRDQTISRFHLGPLCSRQVK----------------ALNTSIQVDNADLSA------TLALRNDDQGDRFCEMNKMETGVHEIDMKRFSLDYDSSEHHYDEWGGLLLRLTVLGMGVVSMIRDGLLFGRVLDTSNSPNSSPAHCRSSQVAVRCLFSLIYTFIQLYFIFINSKICTHKFQVIARLGLMHMIAVNLSGLFKTVIKDSIFEQNIGQTEIINLHRPMSTLSPTQRFLKQEGLYKLKIPSPEIILKIQTTISP---EKNWTKLLCHGGDLMDGVIQASDPYIYPCTVQYCLITAA---LLWLSWRNIETTSTRFDPNVTGSIQESSRASFQR------RKRLILSTTECSGSKKGIFVGLVTMIAAIVDLVVFHILVQKPNLRLTALRISYSFEIALIMSATVATVLACFKMQD--LLFQPRFHSRCITQRLEETLLLISMVAGVYLHSVANIVVGRLYSEKPPSPFLLIGSILSLLQASIQSIFVCTGLRRVSYKTIHERDKPGRELVAFLLLANTALWCLHLFEQRKLDNVFFLHHKVFGQWTWAVISHITIPLILMFRMVSIIALAVIWK 943          
BLAST of otopetrin-2 vs. Planmine SMEST
Match: SMESG000031517.1 (SMESG000031517.1)

HSP 1 Score: 186.422 bits (472), Expect = 2.707e-48
Identity = 186/741 (25.10%), Postives = 340/741 (45.88%), Query Frame = 3
Query:  771 LNSQAADSG----------ISNTSPDTLSSTEFYQRNLEDSRFVSKCNRLTSN---FPWHG------------------GNIPPSILKHRRRNNQSLDYSVSNFRTLICQILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLTVFHLSDCKGQP-KRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFES----------------------LFKXXXXXXXXXXMIRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIV----------------------SYKTLMKFIKTKSNL-LEAPVTESVLTTRNIFSPNILKMNGTS--CFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRK---LTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRI--ESANRIVMFSSLFGGVYLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            L+SQAADSG          ISNTSP+T SSTEFYQR L D+    K +  +S     P  G                  G  P SILK  + ++ SL    ++F+  +  I+S +Y  LL TI +VL + +        +  E F IF + V I+FL   +    + Q   RF +    + + +                 L      D++++++      +  + N D   R C++N +   + E                       L ++++L + ++SMIR+ +     ++ + +       C S  + VR   SL++T  Q YF+ ++ K    KF      G++HM A N++ +   ++                      +     +F+K +    L+ P  E +L  +   SP   + N T   C   D+M+ +   S+ Y+YP ++QY  +T     LL  S  +++  +     N T      S +  +R      RK   L+   C  S KG F+GL +++ +++ L++ +I  +K +L+L  ++ISY  E+ L +  T+ TV + + ++D  LL  P   +R   +     ++  S+  GVYL++++ I+  +     P +PF+++ S+ +++  ++Q+IFV   + R+S        KP +E V+F+L+ N A+W L +F + +      +   ++G   W +I  +++PL L++++ S+I+LAVIWK
Sbjct:  250 LHSQAADSGSVVCIKEDRGISNTSPETQSSTEFYQRKLHDTIISGKVSHSSSGRFSVPSIGITGTGMGPKLHHTPRLPSGQYPQSILKFSK-DHFSLIQITADFKNYLFTIISAMYAMLLLTISVVLPVIEITTPHAFFNAYEGFYIFLYVVGIMFLVYIYGYLLRDQTISRFHLGPLCSRQVK----------------ALNTSIQVDNADLSA------TLALRNDDQGDRFCEMNKMETGVHEIDMKRFSLDYDSSEHHYDEWGGLLLRLTVLGMGVVSMIRDGLLFGRVLDTSNSPNSSPAHCRSSQVAVRCLFSLIYTFIQLYFIFINSKICTHKFQVIARLGLMHMIAVNLSGLFKTVIKDSIFEQNIGQTEIINLHRPMSTLSPTQRFLKQEGLYKLKIPSPEIILKIQTTISP---EKNWTKLLCHGGDLMDGVIQASDPYIYPCTVQYCLITAA---LLWLSWRNIETTSTRFDPNVTGSIQESSRASFQR------RKRLILSTTECSGSKKGIFVGLVTMIAAIVDLVVFHILVQKPNLRLTALRISYSFEIALIMSATVATVLACFKMQD--LLFQPRFHSRCITQRLEETLLLISMVAGVYLHSVANIVVGRLYSEKPPSPFLLIGSILSLLQASIQSIFVCTGLRRVSYKTIHERDKPGRELVAFLLLANTALWCLHLFEQRKLDNVFFLHHKVFGQWTWAVISHITIPLILMFRMVSIIALAVIWK 953          
BLAST of otopetrin-2 vs. Planmine SMEST
Match: SMESG000018672.1 (SMESG000018672.1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.962e-15
Identity = 137/628 (21.82%), Postives = 267/628 (42.52%), Query Frame = 3
Query:  945 RRRNNQSLDYSVSNFRTLICQILSIIYIFLLSTII--LVLAISDQNDVPGSKD-----LLESFQIFQFS---VSILFLTVF-HLSDC---KGQPKRFPISTFITHRFQDTEPEHC---LIVSNPVSFELQEKTNRDSSEINSFPENIVSNEILNIDGSTRSCQINDLSRNLFESLFKXXXXXXXXXXMIRNAVELATEIEIAQ----ANAERLQD--CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAINCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYNISCILAWKTALN-------APSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIW 2738
            RR +    D++++N R+ I   +S   +F +S +   +V+ +SD       K+      LE+F I Q+     S+ FL  + ++ DC   K   K  P    IT    D + +     L   N    EL+  +N D++ +++   N +SN   N D  +   +    +   F + + +       + +   AV     + +      A+  RLQ+  CH+     +  L L +   QT+F+    ++I  K    I F + H+T +NI         +KT++  I  +  LL+   T  +    NI   + ++    +C      +Q+S     YL+P +I+YS ++  I   +L  +   +                E  S  +       + +    C  S+KG F+GL   +V+++ L +  +F K    + + + +  ++E+IL + +++  V +   +R +        ++  E+ +  ++   L  GV+ YN+   ++   + N       + S    +  S+  II   LQ +FVL +  + + S      KP +  V+F+++ N+A+W + IF E + +    I    Y    W +I    +PL + ++  S I L  IW
Sbjct:   21 RRHSVAFADFAINNPRSSIA--VSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKNNKKDDPCQDEITRELVDLDSQKVTFKLSHQNTEDVELENISNDDTTHLST---NNLSNA-FNTDDKSSHLENKLFTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQW------FKTVVYEINHE--LLDHKNTSQI----NIHGNSTIRHENKTC-----TDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEH--------------DEKHSSDKLQTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQVSEIILLVSSSIALVCAFIKMRGLRFC----QLSEEEALDDNLLLVGL-AGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIF-EAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIW 605          
BLAST of otopetrin-2 vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 69.3218 bits (168), Expect = 8.800e-12
Identity = 93/432 (21.53%), Postives = 176/432 (40.74%), Query Frame = 3
Query: 1503 ANAERLQD--CHSIFIIVRSFLSLLFTIFQTYFVLLDFKSIVTKFTHPIIFGVVHMTATNI--------NSITHNIVSYKTLMKFIKTKSNLLEAPVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYSALTTVINLLLLSSMDSVQDVNFSLPVNXXXXXXXXXXXXXXXXXXXNCRKLTAI--NCKNSNKGFFIGLFXXXXXXXXXXMLYIFSKKSSLKLVGMKISYLTEMXXXXXXXXXXXXSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGVYLYN-------ISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSLSDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVHWVLIKRLSVPLTLLYQIDSVISLAVIWK 2741
            A+  R Q+  CH+     +  L L +   QT+F+    + I  K    I F + H+T +NI          I H ++ +   +KFI  KS+                        N T C      +++S     YL+P +I+YS ++  +          V   N+   + S                  N  K T     C  S+KG FIGL   + +++ L    +F + +  + + + +  ++E++L   + +  + +   +R +        +   E+ +  ++  SL  GV+ YN       I   +  K   N+ +    +  SL  II   +Q  FVL +  + +++    ++K  +  V+F+++NN+A+W + IF E + +    I    Y    W +I    +PL + ++  S I L  IW+
Sbjct:  224 ADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEHN--IKFID-KSDF----------------------HNKTVC-----ADELSHSVAPYLFPCAIEYSLISAAV---FYKMFQKVGLANYQKNLKSFCSL--------------NSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGF----RQLTEEETFDDNLILVSL-AGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIF-EAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWR 602          
The following BLAST results are available for this feature:
BLAST of otopetrin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otpl-11.940e-724.46OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
otpl-11.947e-724.46OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
otpl-32.484e-719.21OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-32.484e-719.21OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-13.757e-724.46OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
back to top
BLAST of otopetrin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OtopLc1.209e-1623.29gene:FBgn0259150 transcript:FBtr0346834[more]
OtopLc1.780e-1623.29gene:FBgn0259150 transcript:FBtr0331167[more]
OtopLc2.440e-1623.29gene:FBgn0259150 transcript:FBtr0331168[more]
OtopLb1.115e-1520.62gene:FBgn0031514 transcript:FBtr0344796[more]
OtopLb1.198e-1520.62gene:FBgn0031514 transcript:FBtr0340589[more]
back to top
BLAST of otopetrin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|B7Z0W9|OTOP_DROME1.784e-1523.29Proton channel OtopLc OS=Drosophila melanogaster O... [more]
back to top
BLAST of otopetrin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HXZ45.935e-2623.94otopetrin-2 OS=Lingula unguis OX=7574 GN=LOC106159... [more]
A0A1S3KEJ49.006e-2625.96otopetrin-1-like OS=Lingula unguis OX=7574 GN=LOC1... [more]
A0A210Q9659.557e-2526.42Otopetrin-2 OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
R7T6T31.560e-2424.40Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A4Y2W5E32.818e-2425.64Proton channel OtopLc (Fragment) OS=Araneus ventri... [more]
back to top
BLAST of otopetrin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of otopetrin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028508.10.000e+099.77SMESG000028508.1[more]
SMESG000031517.18.213e-5125.44SMESG000031517.1[more]
SMESG000031517.12.707e-4825.10SMESG000031517.1[more]
SMESG000018672.12.962e-1521.82SMESG000018672.1[more]
SMESG000018670.18.800e-1221.53SMESG000018670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035065 ID=SMED30035065|Name=otopetrin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2819bp
AATTATGTTTGTTTAAATTATTCAATTAAAAATAATTTGTCCTTCAAATG
ACTGAGAAGAAATTGAATGCTTTTATAATTTACGATTAGTTTTCAAGTCA
AATTAATATGCATCAGAGCAGTTCAGAATCATCAATAGACAAAAATAAAT
TTCCATCTGTTATAAATCTTTACGCCAGTGACAATGAACAATCTCGAAGT
GACCATTACAGTGACGAATACGATAAAAACTTTGGTACACTTTCTGGTTT
ATCTGATGATACTCGTTTTGAAATGAAAACTCTCTATACGATAGAAGAAC
GAAATCTGTCTAATTTTAAAATAAGCGGTTCAGAATCGAGTTCTGATCAC
AATCAAAAAAAGAGTGACAATCAAGCAGTCCTTTTAGAATATGAATCTGA
GAGTTCAGCAGAGGAATCTGGACAGGATAGAATGAGTACAACTAGCACCA
GTACAAGCAGCGAAGAAGGTCTTTTGACAAAAACGAAGTCAAAACCGAAA
CCTCAATCATATATTTTTAAAGGAAAAAATAATTCTGAACATCAAAGTCT
GTGTAAAAAGCAGATTCCAGATGATGTTCATTCTTTGAAAACTCAACCGA
ATTGTCCATCATCACCAAGTATGTGGAGTTCCAGTACCAGTGGAAAATTT
GCAAACATTTTCTCAAAACGAGTCATGATTAGAGGAAGTTATAGTCAAGA
TGTAAGTCAATTTAGACATTCAGGTCTCAGTAATAGATCTGCACTCGGAT
CTATTCCGCACGTGTTTAGGTTAAATAGTCAAGCTGCAGATTCAGGAATC
AGCAATACAAGTCCGGATACGCTGAGTTCGACAGAATTTTATCAAAGAAA
TCTCGAGGATTCCCGATTCGTATCGAAATGCAATCGGTTGACCAGCAATT
TCCCATGGCATGGTGGAAACATTCCTCCGTCGATTCTAAAACACAGGAGA
AGAAACAATCAAAGCCTCGATTATTCCGTATCGAATTTCAGAACATTAAT
TTGCCAAATTTTATCAATAATTTATATTTTTCTCTTATCAACAATTATTC
TCGTGCTAGCAATATCCGATCAAAATGACGTGCCAGGATCGAAAGATTTA
CTAGAGAGTTTCCAAATATTTCAATTTTCCGTTTCCATTCTATTTCTTAC
GGTGTTTCACTTATCAGACTGTAAAGGTCAACCAAAGAGATTTCCTATTT
CTACTTTTATTACCCACCGTTTTCAAGATACTGAACCGGAACATTGCCTA
ATTGTCAGCAATCCCGTATCTTTTGAGTTACAGGAAAAGACCAATAGAGA
TTCATCAGAAATTAATAGTTTTCCAGAGAATATTGTGTCAAATGAAATCT
TAAATATTGACGGATCAACCCGATCATGCCAAATAAACGACTTGTCACGA
AACCTATTTGAAAGTTTATTCAAAGTCTCAATTTTAGTTGTCAGTATAAT
CAGTATGATAAGAAATGCAGTAGAATTAGCAACAGAAATTGAAATAGCCC
AAGCCAATGCAGAAAGATTGCAAGATTGTCATTCCATCTTTATAATAGTT
CGAAGTTTTTTGTCTTTACTTTTCACAATTTTTCAAACATATTTCGTCCT
CCTCGATTTCAAAAGTATCGTTACAAAATTTACTCACCCAATTATCTTTG
GTGTAGTGCATATGACCGCTACAAATATCAATTCAATTACCCATAATATT
GTGTCATACAAAACCCTAATGAAATTTATTAAAACAAAATCTAATTTATT
AGAAGCTCCAGTAACGGAATCAGTTTTGACAACAAGAAATATTTTCTCTC
CAAATATTTTGAAAATGAATGGAACTAGCTGCTTTACTGCCGACATAATG
GAGCAGATTTCCAGTATATCTGAAACTTACTTATATCCTTTTTCAATACA
ATATAGTGCTTTAACGACAGTGATCAACTTATTGTTATTATCATCAATGG
ACAGTGTTCAAGATGTCAATTTTTCGCTCCCAGTAAACAGTACGTTCAGA
TCAGTCAGAGAATCTTCCAGTGAAACTGAAAGATTAAGAAGTTCCAATTG
TCGAAAACTGACAGCAATTAATTGTAAAAATTCCAACAAAGGATTTTTTA
TCGGTTTATTTTCCTTGCTCGTTTCAGTTATCAGTTTGATAATGCTTTAT
ATCTTTTCTAAGAAATCCTCACTTAAACTTGTGGGGATGAAAATCTCGTA
TTTAACGGAAATGATTTTAACAATAATAACGACTTTAGTTACTGTCACGT
CTCTTTATCATCTTCGAGATATTTCGCTACTTTCCTATCCAAATAATATT
AACAGAATCGAATCAGCAAACCGTATCGTTATGTTTTCCAGTTTATTTGG
AGGGGTTTACTTGTATAACATCAGTTGTATTCTTGCTTGGAAGACTGCAT
TAAATGCACCCTCTGCTCCATTTGTCATGGTTTCTTCACTCTGTACAATT
ATTCATGGAACTTTGCAAACTATTTTTGTGCTCCTGACAATCGCTAGAAT
GTCACTATCTGATCCGATTCCAATTAAAAAACCGAAAAAAGAATTCGTTT
CATTTATATTAATGAACAATGTTGCCATATGGGGTTTGAAAATCTTTACT
GAATTACAACATAGTACTTCTGAAACCATTCCAGAGATCATCTATGGTCC
AGTACATTGGGTTTTAATCAAACGGTTATCCGTTCCGTTGACGTTACTTT
ATCAAATTGACTCTGTAATCTCTTTGGCTGTGATATGGAAAATTGTGTAA
TTATATTTTCAGGGAAAATTAATGTATATGTTGTTTCTATTTATTAGGTT
AAATAAAAAAATATTTCAA
back to top

protein sequence of SMED30035065-orf-1

>SMED30035065-orf-1 ID=SMED30035065-orf-1|Name=SMED30035065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=881bp
MHQSSSESSIDKNKFPSVINLYASDNEQSRSDHYSDEYDKNFGTLSGLSD
DTRFEMKTLYTIEERNLSNFKISGSESSSDHNQKKSDNQAVLLEYESESS
AEESGQDRMSTTSTSTSSEEGLLTKTKSKPKPQSYIFKGKNNSEHQSLCK
KQIPDDVHSLKTQPNCPSSPSMWSSSTSGKFANIFSKRVMIRGSYSQDVS
QFRHSGLSNRSALGSIPHVFRLNSQAADSGISNTSPDTLSSTEFYQRNLE
DSRFVSKCNRLTSNFPWHGGNIPPSILKHRRRNNQSLDYSVSNFRTLICQ
ILSIIYIFLLSTIILVLAISDQNDVPGSKDLLESFQIFQFSVSILFLTVF
HLSDCKGQPKRFPISTFITHRFQDTEPEHCLIVSNPVSFELQEKTNRDSS
EINSFPENIVSNEILNIDGSTRSCQINDLSRNLFESLFKVSILVVSIISM
IRNAVELATEIEIAQANAERLQDCHSIFIIVRSFLSLLFTIFQTYFVLLD
FKSIVTKFTHPIIFGVVHMTATNINSITHNIVSYKTLMKFIKTKSNLLEA
PVTESVLTTRNIFSPNILKMNGTSCFTADIMEQISSISETYLYPFSIQYS
ALTTVINLLLLSSMDSVQDVNFSLPVNSTFRSVRESSSETERLRSSNCRK
LTAINCKNSNKGFFIGLFSLLVSVISLIMLYIFSKKSSLKLVGMKISYLT
EMILTIITTLVTVTSLYHLRDISLLSYPNNINRIESANRIVMFSSLFGGV
YLYNISCILAWKTALNAPSAPFVMVSSLCTIIHGTLQTIFVLLTIARMSL
SDPIPIKKPKKEFVSFILMNNVAIWGLKIFTELQHSTSETIPEIIYGPVH
WVLIKRLSVPLTLLYQIDSVISLAVIWKIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 454..474
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 21..47
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 65..141
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 104..141
NoneNo IPR availableTMHMMTMhelixcoord: 334..353
NoneNo IPR availableTMHMMTMhelixcoord: 697..719
NoneNo IPR availableTMHMMTMhelixcoord: 512..534
NoneNo IPR availableTMHMMTMhelixcoord: 772..794
NoneNo IPR availableTMHMMTMhelixcoord: 740..762
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 478..497
NoneNo IPR availableTMHMMTMhelixcoord: 662..684
IPR004878OtopetrinPFAMPF03189Otopetrincoord: 444..865
e-value: 3.8E-50
score: 171.0
IPR004878OtopetrinPANTHERPTHR21522OTOPETRINcoord: 292..879