SOXP-2

Overview
NameSOXP-2 (AFD29620.1)
Smed IDSMED30035063
Uniprot Best hitPutative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3 (E=1.25106e-07)
Length (bp)2664
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SOXP-2 (SMED30035063) t-SNE clustered cells

Violin plots show distribution of expression levels for SOXP-2 (SMED30035063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SOXP-2 (SMED30035063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SOXP-2 (SMED30035063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

SOXP-2 ( SOXP-2 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the blastomere, sigma neoblast and neoblast

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30035063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 34

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30035063SMESG000074761.1 dd_Smed_v4_8483_0_1dd_Smed_v4PMID:28292427whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30035063SMESG000074761.1 SMED_25793_V2_2GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30035063SMESG000074761.1 SMED_25793_V2_2GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30035063SMESG000074761.1 SMED_03191_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30035063SMESG000074761.1 SMED_03191_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30035063SMESG000074761.1 SMED_25793_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30035063SMESG000074761.1 SMED_25793_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30035063SMESG000074761.1 JQ425152.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30035063SMESG000074761.1 JQ425152.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 JQ425152.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30035063SMESG000074761.1 JQ425152.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 JQ425152.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
X1 cellSMED30035063SMESG000074761.1 SmedASXL_013986SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X2 cellSMED30035063SMESG000074761.1 SmedASXL_013986SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:22385657whole organismasexual adultfluorescence in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:22385657whole organismasexual adultcolorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
blastomereSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30035063SMESG000074761.1 SMED30035063smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
parenchymaSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721whole organismasexual adultcolorimetric in situ hybridization evidence
tailSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721whole organismasexual adultcolorimetric in situ hybridization evidence
parapharyngeal regionSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721whole organismasexual adultcolorimetric in situ hybridization evidence
sigma neoblastSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721FACS sorted cell populationasexual adultfluorescence in situ hybridization evidence
sigma neoblastSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
prepharyngeal regionSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721whole organismasexual adultcolorimetric in situ hybridization evidence
gamma neoblastSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
headSMED30035063SMESG000074761.1 JQ425152smed_ncbi_20200123PMID:25017721whole organismasexual adultcolorimetric in situ hybridization evidence
blastomereSMED30035063SMESG000074761.1 AFD29620.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 AFD29620.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 AFD29620.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
neoblastSMED30035063SMESG000074761.1 AFD29620.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
blastomereSMED30035063SMESG000074761.1 AFD29620.1smed_ncbi_20200123PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
Homology
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX12 (SRY-box transcription factor 12 [Source:HGNC Symbol;Acc:HGNC:11198])

HSP 1 Score: 53.1434 bits (126), Expect = 9.902e-7
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box transcription factor 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 54.299 bits (129), Expect = 1.008e-6
Identity = 32/94 (34.04%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  389 NLTDDKLSKPYSTVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +LT  + ++  +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  569 DLTRPEDAEGGATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 661          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box transcription factor 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 54.299 bits (129), Expect = 1.008e-6
Identity = 32/94 (34.04%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  389 NLTDDKLSKPYSTVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +LT  + ++  +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  569 DLTRPEDAEGGATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 661          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box transcription factor 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 53.9138 bits (128), Expect = 1.413e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  573 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 654          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box transcription factor 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 53.9138 bits (128), Expect = 1.413e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  573 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 654          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: sem-2 (Transcription factor sem-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8T3B9])

HSP 1 Score: 54.299 bits (129), Expect = 2.476e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS  T   KK   HI  RP+N+FM++S+  RR +     D  N+EISK LG  W ++    K+ +  EA++L + H
Sbjct:   79 PYSDATNC-KKSSNHIK-RPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCH 153          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: sem-2 (Transcription factor sem-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8T3B9])

HSP 1 Score: 54.299 bits (129), Expect = 2.476e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS  T   KK   HI  RP+N+FM++S+  RR +     D  N+EISK LG  W ++    K+ +  EA++L + H
Sbjct:   79 PYSDATNC-KKSSNHIK-RPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCH 153          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 52.7582 bits (125), Expect = 7.107e-7
Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  440 RKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + K   HI  RP+N+FM+++R  RR +L  + D  NS ISK+LG  W  +  + K  Y  E  +L+ LH
Sbjct:  274 QAKSPNHIK-RPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLH 341          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 52.373 bits (124), Expect = 7.395e-7
Identity = 30/77 (38.96%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  422 STVTESRKKRKK--HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S V   R + K   HI  RP+N+FM+++R  RR +L  + D  NS ISK+LG  W  +  + K  Y  E  +L+ LH
Sbjct:  160 SEVATPRPQAKSPNHIK-RPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLH 235          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 53.1434 bits (126), Expect = 7.593e-7
Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  440 RKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + K   HI  RP+N+FM+++R  RR +L  + D  NS ISK+LG  W  +  + K  Y  E  +L+ LH
Sbjct:  322 QAKSPNHIK-RPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLH 389          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox14 (gene:FBgn0005612 transcript:FBtr0072158)

HSP 1 Score: 59.3066 bits (142), Expect = 1.248e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox14 (gene:FBgn0005612 transcript:FBtr0343282)

HSP 1 Score: 59.3066 bits (142), Expect = 1.248e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox14 (gene:FBgn0005612 transcript:FBtr0072157)

HSP 1 Score: 59.3066 bits (142), Expect = 1.248e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox100B (gene:FBgn0024288 transcript:FBtr0085735)

HSP 1 Score: 51.9878 bits (123), Expect = 1.896e-6
Identity = 26/67 (38.81%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  446 KRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            ++K+HI  RP+N+FM++++  RR +   +    NSE+SK LGKLW N+  + K  +   A+KL + H
Sbjct:   72 RKKEHIK-RPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTH 137          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox102F (gene:FBgn0039938 transcript:FBtr0089252)

HSP 1 Score: 51.2174 bits (121), Expect = 3.551e-6
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 2
Query:  452 KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            K HI  RP+N+FM++++  RR +L    D  NS ISK+LG  W  +    K  Y  E  +L+ LH
Sbjct:  382 KPHIK-RPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLH 445          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox13 (SRY-box transcription factor 13 [Source:ZFIN;Acc:ZDB-GENE-100519-1])

HSP 1 Score: 53.5286 bits (127), Expect = 8.909e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  422 STVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             +  ESR     HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  396 GSFGESRTPSSGHIK-RPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQH 469          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox13 (SRY-box transcription factor 13 [Source:ZFIN;Acc:ZDB-GENE-100519-1])

HSP 1 Score: 53.1434 bits (126), Expect = 1.149e-6
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  422 STVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             +  ESR     HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  366 GSFGESRTPSSGHIK-RPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQH 439          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox13 (SRY-box transcription factor 13 [Source:ZFIN;Acc:ZDB-GENE-100519-1])

HSP 1 Score: 53.1434 bits (126), Expect = 1.149e-6
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  422 STVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             +  ESR     HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  366 GSFGESRTPSSGHIK-RPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQH 439          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox12 (SRY-box transcription factor 12 [Source:ZFIN;Acc:ZDB-GENE-040724-33])

HSP 1 Score: 52.373 bits (124), Expect = 1.465e-6
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            RP+N+FM++S+  RR ++  + D  N+EISK LGK W  +P   K  +  EA++L + H
Sbjct:   55 RPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAERLRLKH 113          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: FQ377628.1 (pep chromosome:GRCz11:2:22564928:22575851:-1 gene:ENSDARG00000111969.1 transcript:ENSDART00000182932.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FQ377628.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.616e-6
Identity = 46/118 (38.98%), Postives = 69/118 (58.47%), Query Frame = 2
Query:  443 KKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSXXXXXXXXXXXXXXXXYLTKCPINSTPLSSNS-YESIQDINSVTDTLQN 793
            K+  +HI  RP+N+FM++SR  RR + +      NSEISK LG  W  +  + K  Y +EAK+L   H +E P+YKY+P++K K  L K  + S PL   S  E  +D++S +   Q+
Sbjct:    8 KQPMEHIK-RPMNAFMVWSRGQRRQMALENPKMHNSEISKRLGAEWKRLSDSEKRPYIDEAKRLRAQHMREHPDYKYRPRRKPKGLLRKDMVLSLPLVGQSDSEKPRDVHSSSAAAQH 124          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox7 (SRY-box 7 [Source:NCBI gene;Acc:549080])

HSP 1 Score: 56.6102 bits (135), Expect = 9.151e-8
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 2
Query:  368 WMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            W   L  +  D+ LS   S     R+K  +    RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +    K  Y  EA++L + H
Sbjct:   10 WTEGLDCSPIDEDLSDGLSPHRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox17b.3 (SRY-box 17 alpha [Source:NCBI gene;Acc:395066])

HSP 1 Score: 53.5286 bits (127), Expect = 1.064e-6
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  365 QWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            QW   + N+L + KL K  +    SR K +  I  RP+N+FM++++  R+ +     D  N+E+SK+LGK W ++    K  +  EA++L + H
Sbjct:   31 QWAEPM-NSLGEGKL-KSDAGSANSRGKAEARIR-RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAERLRVQH 121          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox17b.3 (SRY-box 17 alpha [Source:NCBI gene;Acc:395066])

HSP 1 Score: 53.1434 bits (126), Expect = 1.161e-6
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  365 QWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            QW   + N+L + KL K  +    SR K +  I  RP+N+FM++++  R+ +     D  N+E+SK+LGK W ++    K  +  EA++L + H
Sbjct:   31 QWAEPM-NSLGEGKL-KSDAGSANSRGKAEARIR-RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVKEAERLRVQH 121          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox17b.3 (SRY-box 17 alpha [Source:NCBI gene;Acc:395066])

HSP 1 Score: 53.1434 bits (126), Expect = 1.214e-6
Identity = 31/94 (32.98%), Postives = 53/94 (56.38%), Query Frame = 2
Query:  365 QWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            QW   + N+L + KL K  +    SR K +  I  RP+N+FM++++  R+ +     D  N+E+SK+LGK W ++    K  +  EA++L + H
Sbjct:   31 QWAEPM-NSLGEGKL-KSDAGSANSRGKAEARIR-RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKSLTLASKRPFVEEAERLRVQH 121          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: spidr (scaffold protein involved in DNA repair [Source:Xenbase;Acc:XB-GENE-5813435])

HSP 1 Score: 53.5286 bits (127), Expect = 1.721e-6
Identity = 27/72 (37.50%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            T  R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W  +    K  Y  E  +L+ +H
Sbjct:  559 TRGRSSSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIH 629          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox12 (SRY (sex determining region Y)-box 12 [Source:MGI Symbol;Acc:MGI:98360])

HSP 1 Score: 53.1434 bits (126), Expect = 8.226e-7
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox12 (SRY (sex determining region Y)-box 12 [Source:MGI Symbol;Acc:MGI:98360])

HSP 1 Score: 53.1434 bits (126), Expect = 8.226e-7
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 53.9138 bits (128), Expect = 9.964e-7
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  557 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 638          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 53.9138 bits (128), Expect = 1.059e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  599 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 680          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 53.9138 bits (128), Expect = 1.059e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  599 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 680          
BLAST of SOXP-2 vs. UniProt
Match: sp|P40656|SOX14_DROME (Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 1.251e-7
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. UniProt
Match: sp|Q28GD5|SOX7_XENTR (Transcription factor Sox-7 OS=Xenopus tropicalis OX=8364 GN=sox7 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.848e-7
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 2
Query:  368 WMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            W   L  +  D+ LS   S     R+K  +    RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +    K  Y  EA++L + H
Sbjct:   10 WTEGLDCSPIDEDLSDGLSPHRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102          
BLAST of SOXP-2 vs. UniProt
Match: sp|O42342|SOX7_XENLA (Transcription factor Sox-7 OS=Xenopus laevis OX=8355 GN=sox7 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 8.990e-7
Identity = 29/93 (31.18%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  368 WMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            W   L  +  D  LS   S     R+K  +    RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +    K  Y  EA++L + H
Sbjct:   10 WTESLDCSPMDGDLSDGLSPHRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102          
BLAST of SOXP-2 vs. UniProt
Match: sp|Q8T3B9|SEM2_CAEEL (Transcription factor sem-2 OS=Caenorhabditis elegans OX=6239 GN=sem-2 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 3.149e-6
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS  T   KK   HI  RP+N+FM++S+  RR +     D  N+EISK LG  W ++    K+ +  EA++L + H
Sbjct:   79 PYSDATNC-KKSSNHIK-RPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCH 153          
BLAST of SOXP-2 vs. UniProt
Match: sp|O15370|SOX12_HUMAN (Transcription factor SOX-12 OS=Homo sapiens OX=9606 GN=SOX12 PE=2 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 4.755e-6
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|20300267 (tr|H9CXU9|H9CXU9_SCHMD SOXP-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 542/542 (100.00%), Postives = 542/542 (100.00%), Query Frame = 2
Query:  209 MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSXXXXXXXXXXXXXXXXYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNEXXXXXXXXXXXXXXNNVSKHTSDSIITNSPIREEIVLEXXXXXXXXXXXXYRHVFQRXXXXXXXXXXXXXIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLXXXXXXXXXXXXXXXKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI 1834
            MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSSSLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLSNSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI
Sbjct:    1 MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSSSLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLSNSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI 542          
BLAST of SOXP-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|19318816 (tr|A0A564XWJ0|A0A564XWJ0_HYMDI HMG box domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS656 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.277e-34
Identity = 61/127 (48.03%), Postives = 89/127 (70.08%), Query Frame = 2
Query:  269 LTYFDLCQKCS-AYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            L Y + C++C  A  + +  ++ HL + H +P +W SD A+ LT D+  KPY+T+  +RKKR+K  TPRPLNSFMIF++H+RRNVL  F  AS+S IS+LLG+ W+ IP  I++ YD EA +L+ +H
Sbjct:   10 LHYMNACKQCVIAIDDGVESFITHLTNEHAIPTEWPSDRASRLTGDEAKKPYTTIAATRKKRRKLTTPRPLNSFMIFAQHIRRNVLAIFETASSSNISRLLGQAWSKIPKEIRAAYDEEAARLSKIH 136          
BLAST of SOXP-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|167256209 (tr|A0A0R3TTK2|A0A0R3TTK2_RODNA HMG box domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11040 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.407e-32
Identity = 61/124 (49.19%), Postives = 89/124 (71.77%), Query Frame = 2
Query:  275 YFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + + C  C + QNSL+ W++HL D H LP +W SD A  LT    +KPY+T+TES+K+R+K   PRPLNSFM+F++H+RRNVL   ++ASNS +S+ LG +W ++P ++K+ YD EA KL  +H
Sbjct:    2 WMEDCVDCVSAQNSLQAWIRHLTDFHALPTEWPSDRALRLTGVAATKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRIHNEASNSVLSQQLGIVWRSVPRSVKNRYDEEAAKLVKIH 125          
BLAST of SOXP-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|15781120 (tr|A0A0R3SCN8|A0A0R3SCN8_HYMDI HMG box domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2370 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 6.285e-32
Identity = 61/124 (49.19%), Postives = 88/124 (70.97%), Query Frame = 2
Query:  275 YFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + D C  C + Q+SL+ W++HL D H LP +W SD A  LT    +KPY+T+TES+K+R+K   PRPLNSFM+F++H+RRNVL   ++ASNS +S+ LG +W ++P  +K+ YD EA KL  +H
Sbjct:    2 WMDDCVDCVSAQSSLQTWIRHLTDFHALPTEWPSDRALRLTGVAATKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRIHNEASNSVLSQQLGIVWRSVPRIVKNRYDEEAAKLVKIH 125          
BLAST of SOXP-2 vs. TrEMBL
Match: gnl|BL_ORD_ID|16310572 (tr|A0A183TH27|A0A183TH27_SCHSO HMG box domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS15775 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.680e-32
Identity = 61/120 (50.83%), Postives = 85/120 (70.83%), Query Frame = 2
Query:  287 CQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            C+ C A + S+R W  HLVDRH +P +W S+ A+ L  D    PY+ VTESRKKR     PRPLNSFM+F++H+RRN+L+ F   SN+E+S+LLG+LW+ +P  IK+ +D EA +L+ LH
Sbjct:   48 CEDCHASKQSVRQWASHLVDRHTVPSEWPSERASRLPADSTRTPYTYVTESRKKRMPGAIPRPLNSFMLFAQHIRRNILLAFDGVSNAELSRLLGELWSALPRPIKTQFDEEATRLSKLH 167          
BLAST of SOXP-2 vs. Ensembl Cavefish
Match: sox6 (SRY-box transcription factor 6 [Source:ZFIN;Acc:ZDB-GENE-081120-6])

HSP 1 Score: 52.373 bits (124), Expect = 2.001e-6
Identity = 26/72 (36.11%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +  R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  568 SRGRNPNEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 638          
BLAST of SOXP-2 vs. Ensembl Cavefish
Match: sox12 (transcription factor SOX-4-like [Source:NCBI gene;Acc:103039194])

HSP 1 Score: 51.9878 bits (123), Expect = 2.013e-6
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            RP+N+FM++S+  RR ++  + D  N+EISK LGK W  +P   K  +  EA++L + H
Sbjct:   64 RPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAERLRLKH 122          
BLAST of SOXP-2 vs. Ensembl Cavefish
Match: sox13 (SRY-box transcription factor 13 [Source:NCBI gene;Acc:103022571])

HSP 1 Score: 51.9878 bits (123), Expect = 2.331e-6
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            ++SR     HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  427 SDSRTTSSGHIK-RPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQH 497          
BLAST of SOXP-2 vs. Ensembl Cavefish
Match: sox7 (SRY-box transcription factor 7 [Source:NCBI gene;Acc:103025329])

HSP 1 Score: 51.6026 bits (122), Expect = 2.427e-6
Identity = 21/59 (35.59%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +  + K  Y  EA++L + H
Sbjct:   46 RPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTPSQKRPYVEEAERLRVQH 104          
BLAST of SOXP-2 vs. Ensembl Cavefish
Match: sox7 (SRY-box transcription factor 7 [Source:NCBI gene;Acc:103025329])

HSP 1 Score: 51.6026 bits (122), Expect = 2.427e-6
Identity = 21/59 (35.59%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +  + K  Y  EA++L + H
Sbjct:   46 RPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTPSQKRPYVEEAERLRVQH 104          
BLAST of SOXP-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008165.1 (pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 gene:ENSPMAG00000007384.1 transcript:ENSPMAT00000008165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 3.037e-8
Identity = 26/63 (41.27%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W  + +  K  Y  E  +L+ LH
Sbjct:   60 HIK-RPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKAMSSQEKQPYYEEQARLSKLH 121          
BLAST of SOXP-2 vs. Ensembl Sea Lamprey
Match: sox12 (SRY-box transcription factor 12 [Source:ZFIN;Acc:ZDB-GENE-040724-33])

HSP 1 Score: 50.0618 bits (118), Expect = 1.504e-6
Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+  RR +++   D  N+EISK LG+ W  +    K  +  EA++L + H
Sbjct:   59 HIK-RPMNAFMVWSQIERRKIMMESPDVHNAEISKRLGRRWKQLKDCEKVPFMREAERLRLKH 120          
BLAST of SOXP-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010223.1 (pep scaffold:Pmarinus_7.0:GL478813:2555:9375:-1 gene:ENSPMAG00000009255.1 transcript:ENSPMAT00000010223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 1.757e-6
Identity = 22/60 (36.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query:  467 PRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PRP+N+FM++++  RR +     D  N+E+SK+LGK W  +    +     EA++L +LH
Sbjct:    7 PRPMNAFMVWAKDERRRLAKQNPDLHNAELSKMLGKSWRALTPESRRPCVEEAERLRLLH 66          
BLAST of SOXP-2 vs. Ensembl Sea Lamprey
Match: sox4b (SRY-box transcription factor 4b [Source:ZFIN;Acc:ZDB-GENE-040426-1274])

HSP 1 Score: 48.521 bits (114), Expect = 4.315e-6
Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+  RR ++    D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   61 HIK-RPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGRRWKQLKESEKVPFIREAERLRLKH 122          
BLAST of SOXP-2 vs. Ensembl Sea Lamprey
Match: sox10 (SRY-box transcription factor 10 [Source:ZFIN;Acc:ZDB-GENE-011207-1])

HSP 1 Score: 48.1358 bits (113), Expect = 5.698e-6
Identity = 23/69 (33.33%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  440 RKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +   K H+  RP+N+FM++++  RR +   +    N+E+SK LGKLW  +    K  +  EA++L + H
Sbjct:  105 KPGEKPHVK-RPMNAFMVWAQAARRKLSDQYPQLHNAELSKTLGKLWRLLNEGEKRPFVEEAERLRMQH 172          
BLAST of SOXP-2 vs. Ensembl Nematostella
Match: EDO39449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9V3])

HSP 1 Score: 52.7582 bits (125), Expect = 7.888e-9
Identity = 26/64 (40.62%), Postives = 40/64 (62.50%), Query Frame = 2
Query:  455 KHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +HI  RP+N+FM++SR  RR + + + +  N EISKLLG  W+ +    K  +  EAK+L  +H
Sbjct:    7 QHIK-RPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEEEKRPFVTEAKRLRTIH 69          
BLAST of SOXP-2 vs. Ensembl Nematostella
Match: EDO42788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S2])

HSP 1 Score: 51.6026 bits (122), Expect = 2.837e-8
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS V   +K  K     RP+NSFM++++  RR +   +    N+E+SK+LGKLW  + A  K  Y +EA +L   H
Sbjct:    4 PYSEVQLPKKDPK---VKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRMLSAAEKQPYVDEAARLDKRH 77          
BLAST of SOXP-2 vs. Ensembl Nematostella
Match: EDO32843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STW6])

HSP 1 Score: 50.447 bits (119), Expect = 6.113e-8
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  398 DDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            DD++    +T  ES+KK       RP+N+FM++S+  RR +     D  N+EISK LGK W  +  + K  +  E+++L I H
Sbjct:    2 DDQVDATQAT-HESKKKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSESEKRPFVEESERLRIRH 83          
BLAST of SOXP-2 vs. Ensembl Nematostella
Match: EDO37719 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEY6])

HSP 1 Score: 47.3654 bits (111), Expect = 7.200e-7
Identity = 22/59 (37.29%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            RP+N+FMI++R  R  +   +  A+N+EIS  LG++WN++ +  +  Y +EA +L   H
Sbjct:   11 RPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQKPYFDEATRLKDKH 69          
BLAST of SOXP-2 vs. Ensembl Nematostella
Match: EDO44399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVK6])

HSP 1 Score: 46.595 bits (109), Expect = 1.456e-6
Identity = 24/60 (40.00%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHS 649
            RPLNSFM++++  RR +        N+EISK+LG  W  +P + K  Y  EA +L   H 
Sbjct:   12 RPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPESEKLPYTEEALRLRRQHK 71          
BLAST of SOXP-2 vs. Ensembl Medaka
Match: sox17 (SRY-box transcription factor 17 [Source:NCBI gene;Acc:100304455])

HSP 1 Score: 58.151 bits (139), Expect = 2.157e-8
Identity = 33/98 (33.67%), Postives = 58/98 (59.18%), Query Frame = 2
Query:  362 IQWMSDLANNLTDDKLS-KPYSTVT--ESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             QW +D  + L D K+  +P ++ +  +SR K +  I  RP+N+FM++++  R+ +     D  N+E+SK+LGK W  +P T K  +  EA++L + H
Sbjct:   30 CQW-ADALSPLGDAKVKNEPCASGSGSQSRGKSEPRIR-RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALPVTEKQPFVEEAERLRVQH 125          
BLAST of SOXP-2 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 53.1434 bits (126), Expect = 1.096e-6
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +  R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ LH
Sbjct:  519 SRGRNSNEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLH 589          
BLAST of SOXP-2 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 53.1434 bits (126), Expect = 1.285e-6
Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 2
Query:  437 SRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ LH
Sbjct:  548 GRNSNEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLH 616          
BLAST of SOXP-2 vs. Ensembl Medaka
Match: sox6b (SRY-box containing gene 6b [Source:NCBI gene;Acc:100304449])

HSP 1 Score: 53.1434 bits (126), Expect = 1.377e-6
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +  R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ LH
Sbjct:  586 SRGRNSNEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQDKQPYYEEQARLSKLH 656          
BLAST of SOXP-2 vs. Ensembl Medaka
Match: sox8 (SRY-box transcription factor 8 [Source:NCBI gene;Acc:100304451])

HSP 1 Score: 52.373 bits (124), Expect = 1.447e-6
Identity = 24/67 (35.82%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  446 KRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            K K H+  RP+N+FM++++  RR +   +    N+E+SK LGKLW  +  + K  + +EA++L + H
Sbjct:   95 KSKPHVK-RPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVDEAERLRVQH 160          
BLAST of SOXP-2 vs. Planmine SMEST
Match: SMESG000074761.1 (SMESG000074761.1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 541/542 (99.82%), Postives = 542/542 (100.00%), Query Frame = 2
Query:  209 MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSXXXXXXXXXXXXXXXXYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNEXXXXXXXXXXXXXXNNVSKHTSDSIITNSPIREEIVLEXXXXXXXXXXXXYRHVFQRXXXXXXXXXXXXXIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLXXXXXXXXXXXXXXXKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI 1834
            MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHS+QSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSSSLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLSNSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI
Sbjct:    1 MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSIQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSSSLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLSNSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI 542          
BLAST of SOXP-2 vs. Planmine SMEST
Match: SMESG000010063.1 (SMESG000010063.1)

HSP 1 Score: 127.872 bits (320), Expect = 3.666e-33
Identity = 68/122 (55.74%), Postives = 91/122 (74.59%), Query Frame = 2
Query:  284 LCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHS 649
            LC  CS  Q++L+ WM HL   HPLP +W+S+ A  L DD+  +PY+ VT+SRK+R++  TPRPLN+FMIFSRH+RRN+L  F DASNS++SK LG LW  +   IKS+Y+ EAK+LA LH+
Sbjct:    2 LCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHA 123          
BLAST of SOXP-2 vs. Planmine SMEST
Match: SMESG000010063.1 (SMESG000010063.1)

HSP 1 Score: 129.028 bits (323), Expect = 1.780e-32
Identity = 68/122 (55.74%), Postives = 91/122 (74.59%), Query Frame = 2
Query:  284 LCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHS 649
            LC  CS  Q++L+ WM HL   HPLP +W+S+ A  L DD+  +PY+ VT+SRK+R++  TPRPLN+FMIFSRH+RRN+L  F DASNS++SK LG LW  +   IKS+Y+ EAK+LA LH+
Sbjct:    2 LCSNCSNNQDTLKLWMVHLASCHPLPPEWLSEKAKVLNDDENQRPYTIVTDSRKRRRRPTTPRPLNTFMIFSRHIRRNILSVFPDASNSQLSKELGILWKKVTNEIKSLYEEEAKRLAQLHA 123          
BLAST of SOXP-2 vs. Planmine SMEST
Match: SMESG000011244.1 (SMESG000011244.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.364e-7
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  365 QWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            ++  D   N+T        S +T S +K+   +  RP+N+FM++SR  RR +        NSEISK LG +W N+    K  + +EAK+L   H
Sbjct:  224 EFSKDQTQNVTTANSQTSQSNITSSSQKKDDRVK-RPMNAFMVWSRGQRRRMAQDNPKMHNSEISKRLGGMWKNLSEEDKKPFIDEAKRLRANH 316          
BLAST of SOXP-2 vs. Planmine SMEST
Match: SMESG000011244.1 (SMESG000011244.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.426e-7
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  365 QWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            ++  D   N+T        S +T S +K+   +  RP+N+FM++SR  RR +        NSEISK LG +W N+    K  + +EAK+L   H
Sbjct:  225 EFSKDQTQNVTTANSQTSQSNITSSSQKKDDRVK-RPMNAFMVWSRGQRRRMAQDNPKMHNSEISKRLGGMWKNLSEEDKKPFIDEAKRLRANH 317          
The following BLAST results are available for this feature:
BLAST of SOXP-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOX129.902e-739.68SRY-box transcription factor 12 [Source:HGNC Symbo... [more]
SOX61.008e-634.04SRY-box transcription factor 6 [Source:HGNC Symbol... [more]
SOX61.008e-634.04SRY-box transcription factor 6 [Source:HGNC Symbol... [more]
SOX61.413e-636.14SRY-box transcription factor 6 [Source:HGNC Symbol... [more]
SOX61.413e-636.14SRY-box transcription factor 6 [Source:HGNC Symbol... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sem-22.476e-738.96Transcription factor sem-2 [Source:UniProtKB/Swis... [more]
sem-22.476e-738.96Transcription factor sem-2 [Source:UniProtKB/Swis... [more]
egl-137.107e-739.13Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-137.395e-738.96Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-137.593e-739.13Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sox141.248e-841.77gene:FBgn0005612 transcript:FBtr0072158[more]
Sox141.248e-841.77gene:FBgn0005612 transcript:FBtr0343282[more]
Sox141.248e-841.77gene:FBgn0005612 transcript:FBtr0072157[more]
Sox100B1.896e-638.81gene:FBgn0024288 transcript:FBtr0085735[more]
Sox102F3.551e-640.00gene:FBgn0039938 transcript:FBtr0089252[more]
back to top
BLAST of SOXP-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox138.909e-737.33SRY-box transcription factor 13 [Source:ZFIN;Acc:Z... [more]
sox131.149e-637.33SRY-box transcription factor 13 [Source:ZFIN;Acc:Z... [more]
sox131.149e-637.33SRY-box transcription factor 13 [Source:ZFIN;Acc:Z... [more]
sox121.465e-640.68SRY-box transcription factor 12 [Source:ZFIN;Acc:Z... [more]
FQ377628.11.616e-638.98pep chromosome:GRCz11:2:22564928:22575851:-1 gene:... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox79.151e-831.18SRY-box 7 [Source:NCBI gene;Acc:549080][more]
sox17b.31.064e-632.98SRY-box 17 alpha [Source:NCBI gene;Acc:395066][more]
sox17b.31.161e-632.98SRY-box 17 alpha [Source:NCBI gene;Acc:395066][more]
sox17b.31.214e-632.98SRY-box 17 alpha [Source:NCBI gene;Acc:395066][more]
spidr1.721e-637.50scaffold protein involved in DNA repair [Source:Xe... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sox128.226e-739.68SRY (sex determining region Y)-box 12 [Source:MGI ... [more]
Sox128.226e-739.68SRY (sex determining region Y)-box 12 [Source:MGI ... [more]
Sox69.964e-736.14SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
Sox61.059e-636.14SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
Sox61.059e-636.14SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
back to top
BLAST of SOXP-2 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40656|SOX14_DROME1.251e-741.77Putative transcription factor SOX-14 OS=Drosophila... [more]
sp|Q28GD5|SOX7_XENTR4.848e-731.18Transcription factor Sox-7 OS=Xenopus tropicalis O... [more]
sp|O42342|SOX7_XENLA8.990e-731.18Transcription factor Sox-7 OS=Xenopus laevis OX=83... [more]
sp|Q8T3B9|SEM2_CAEEL3.149e-638.96Transcription factor sem-2 OS=Caenorhabditis elega... [more]
sp|O15370|SOX12_HUMAN4.755e-639.68Transcription factor SOX-12 OS=Homo sapiens OX=960... [more]
back to top
BLAST of SOXP-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203002670.000e+0100.00tr|H9CXU9|H9CXU9_SCHMD SOXP-2 OS=Schmidtea mediter... [more]
gnl|BL_ORD_ID|193188164.277e-3448.03tr|A0A564XWJ0|A0A564XWJ0_HYMDI HMG box domain-cont... [more]
gnl|BL_ORD_ID|1672562093.407e-3249.19tr|A0A0R3TTK2|A0A0R3TTK2_RODNA HMG box domain-cont... [more]
gnl|BL_ORD_ID|157811206.285e-3249.19tr|A0A0R3SCN8|A0A0R3SCN8_HYMDI HMG box domain-cont... [more]
gnl|BL_ORD_ID|163105726.680e-3250.83tr|A0A183TH27|A0A183TH27_SCHSO HMG box domain-cont... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox62.001e-636.11SRY-box transcription factor 6 [Source:ZFIN;Acc:ZD... [more]
sox122.013e-640.68transcription factor SOX-4-like [Source:NCBI gene;... [more]
sox132.331e-637.50SRY-box transcription factor 13 [Source:NCBI gene;... [more]
sox72.427e-635.59SRY-box transcription factor 7 [Source:NCBI gene;A... [more]
sox72.427e-635.59SRY-box transcription factor 7 [Source:NCBI gene;A... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008165.13.037e-841.27pep scaffold:Pmarinus_7.0:GL479973:18969:29522:-1 ... [more]
sox121.504e-638.10SRY-box transcription factor 12 [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000010223.11.757e-636.67pep scaffold:Pmarinus_7.0:GL478813:2555:9375:-1 ge... [more]
sox4b4.315e-638.10SRY-box transcription factor 4b [Source:ZFIN;Acc:Z... [more]
sox105.698e-633.33SRY-box transcription factor 10 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SOXP-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394497.888e-940.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427882.837e-838.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328436.113e-836.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377197.200e-737.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443991.456e-640.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sox172.157e-833.67SRY-box transcription factor 17 [Source:NCBI gene;... [more]
sox6b1.096e-637.50SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox6b1.285e-638.57SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox6b1.377e-637.50SRY-box containing gene 6b [Source:NCBI gene;Acc:1... [more]
sox81.447e-635.82SRY-box transcription factor 8 [Source:NCBI gene;A... [more]
back to top
BLAST of SOXP-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074761.10.000e+099.82SMESG000074761.1[more]
SMESG000010063.13.666e-3355.74SMESG000010063.1[more]
SMESG000010063.11.780e-3255.74SMESG000010063.1[more]
SMESG000011244.13.364e-734.04SMESG000011244.1[more]
SMESG000011244.13.426e-734.04SMESG000011244.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035063
GenBankAFD29620.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035063 ID=SMED30035063|Name=SOXP-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2664bp
TGTACATTGAATTCAATATTTAATAGTGATTAACTTATCCAAATTTTCAG
CCACTTTTAGTTTAATTTGCGTGTTTTGTTGAGCAGTTTTTATTGGCGCA
TTTTATAAAAAATACAAAACCAATCCAAATCAGTTTGAATCATTGTCAGA
TTTTAGTCGTGCAAGATACATTATTTCATTTTAATTCTCTAGCATATGAC
ATTTAAACATGGAGCTGAATTACTCGTTGAATGATAATAATTTCAATTTA
CAATTAGAAAGCGAGTCCTTGACTTATTTCGATTTATGCCAAAAATGTTC
AGCGTACCAAAATAGTCTTAGAGACTGGATGAAACATTTAGTTGACAGAC
ATCCTTTACCTATTCAGTGGATGAGTGATTTGGCAAATAATTTAACAGAT
GATAAATTATCTAAGCCATATTCGACCGTTACAGAATCCCGTAAAAAACG
CAAGAAGCATATCACTCCAAGGCCATTGAATAGTTTCATGATATTTTCCA
GACATTTAAGAAGAAATGTTCTTATTTTCTTTAGTGATGCTTCAAATTCA
GAAATAAGCAAACTTCTTGGGAAGTTATGGAATAACATTCCAGCTACCAT
TAAATCGATGTATGATAATGAAGCTAAAAAGCTTGCAATTTTACACTCCA
AAGAATTTCCTGAATATAAATATCAACCTAAAAAGAAAAAAAAACAATAT
CTAACGAAATGCCCCATTAATTCCACACCTTTGTCGAGTAATTCATATGA
AAGTATTCAAGATATTAATTCAGTAACGGATACACTACAGAATTCATCTA
ACAACTTACAAAAGGAAAGTAATCCGACCTCTGTTTCGTCTTATGGAAGC
AATCAGGAATGTAATAATTCATTTAAGAATCATAGTGTACAGTCCAGCAA
TTTTCCCAAAGAAATCAACCATAAACCAAGTAGAAAAATTGAAAAGCAAT
CGTGCAAAATAAGTTCCAATCAAATAATGGATGATTCAGAAGGGGCTGAA
TCCAGTCCATCATCATTTAAAAACACCATTAAAAATGAAATTTATTCCTC
TTATAGTCCATTTCTAAATGAATCCCATAGCATTCTTTCAGATTTAAGTT
ACTCTTCGTCTCTCAATAACGTTTCAAAACACACTAGCGATTCCATTATA
ACGAATTCTCCTATCAGAGAAGAAATTGTCTTAGAAAATAATCAGCCCTC
TCAACAGAATAATATAAACAATTACCGACACGTATTTCAGAGAACTTCGA
CTCTATCCAACAGTTTGTTGACCCCTTTAACCATTGTCACAGAAAAAGTT
GACGAACAGAAAGATCTTCCACCATCAAGAATCAATATCCGATATGTGAA
AATTAACAAACTACCGATTCAAACAAAATCCGATTTCCCATTGACTGGAT
ATTTTCAAAATTTCAATAACGACTCAAATCTTCATTTTCAGAGTTCCATT
CACGCCCTGAATACGACATTGACTCCAGATCTGTCGGTAAAACGCGAAGC
CACTGTCAACAACAGCATGACAGATTATATCAATCGAAAACGTACAAATG
TCGATCCACTTATCATCGATGATATATTTGAAAACGAACAATTTGAAGAT
GAGGAAGTGTTGAATTTTGACAATCCTGATAACAATAACAGTTCTCCTTG
GTCGTTTAAATCGCCTAACTTTAAAATATCTACCGGTTCCTCGACACTGT
CAGACAATCCGTACAAAGAACAGTTTTGTTCTTCCCCGTTCCATCTATCA
GAAACTGATACTCAACCGATTCCAGTTCAACGATTGCCAGCAATCGGCTC
ATGGTTAAAGTCAAACTATTCTGAATTCATGATCTGATCCAATCTATTAT
TCTATTCAATTGTCTGTTTTCATACAATTAGGATTACTTGTTATGAATTC
TAGCTGATTTTGAGTGTGTTTATAAAGCTTTTGTAACGCCTTTTCTATAC
AGATGTTCGATATATATATATAAATAAATAAATATAAATATATAACAATT
TTATTGACATTGTACAGTATTCCATAAGCCCGATCTTGTAACGCATTTAT
TACTATACTCAATAGACCAATCTATATGTTCTCATAATTTCTATGTTGTT
ATTGTACACGGGAATTATTACTATAAATGATGCGAATTTATCACTTTGTA
ATTGAGGGAAATTATCGATCAATTTGCGCTTTCAGACATTTTTCATGTAT
AAACTTGTTTTTCTCTTTTTTATCATCAAAAATTTAATTTTTTTGATATC
GCTATTCATCATATTATTATTCTCCGTTGCATTTGTTAGATTATGTAAAT
TTTTATATGAAAATGTTGTTATTTATTGTATTTTTATACGATTTTTTGCT
TTGGATACACTTTTATCAAATCATATTGCCAGTGTGAGCATTTATTGGAC
TTGTTGTTATTGCTGCTGCTCGAATAATTGCTTCATACGGGGAGTCTCGA
TATTTTCATGAAGCGATTTTCATGGTTGCCGCTCTCCGCCGCCGCCATTC
GGTGTAAATATCAATTGCATTGCCAGCACGTTTTCTCAAACTCAATTTTT
GTACTCAATTTCAATTGATTTATGTTCATTTTATTTTTCATAGAAATGAG
TAAATAAATTTTCATAAATAGTTTTGTTTTCAATATTTTTAGGAAATTTG
AATGTGTCTCTAGA
back to top

protein sequence of SMED30035063-orf-1

>SMED30035063-orf-1 ID=SMED30035063-orf-1|Name=SMED30035063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=543bp
MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPL
PIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHL
RRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEF
PEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNL
QKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCK
ISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSS
SLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLS
NSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQ
NFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDP
LIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDN
PYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI*
back to top
Aliases
The feature 'SOXP-2' has the following synonyms
Synonym
SOXP-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000039gamma neoblast
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0004517blastomere
PLANA:0000429neoblast
PLANA:0000009sigma neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036910HMG_box_dom_sf
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000007Stage 7
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000003Stage 3
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 85..155
e-value: 1.5E-16
score: 70.9
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 87..154
e-value: 1.3E-14
score: 54.3
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 86..154
score: 15.249
IPR036910High mobility group box domain superfamilyGENE3DG3DSA:1.10.30.10coord: 82..165
e-value: 3.4E-20
score: 74.3
IPR036910High mobility group box domain superfamilySUPERFAMILYSSF47095HMG-boxcoord: 87..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 247..268
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 224..268
NoneNo IPR availablePANTHERPTHR10270:SF161SOX DOMAIN-CONTAINING PROTEIN DICHAETE-RELATEDcoord: 73..334
NoneNo IPR availablePANTHERPTHR10270SOX TRANSCRIPTION FACTORcoord: 73..334
NoneNo IPR availableCDDcd00084HMG-boxcoord: 87..151
e-value: 4.83988E-15
score: 67.6439