SOXP-2

Overview
NameSOXP-2 (AFD29620.1)
Smed IDSMED30035063
Uniprot Best hitPutative transcription factor SOX-14 OS=Drosophila melanogaster GN=Sox14 PE=2 SV=3 (E=1.2246e-07)
Length (bp)2664
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SOXP-2 (SMED30035063) t-SNE clustered cells

Violin plots show distribution of expression levels for SOXP-2 (SMED30035063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SOXP-2 (SMED30035063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SOXP-2 (SMED30035063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 54.299 bits (129), Expect = 9.218e-7
Identity = 32/94 (34.04%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  389 NLTDDKLSKPYSTVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +LT  + ++  +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  569 DLTRPEDAEGGATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 661          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 54.299 bits (129), Expect = 9.218e-7
Identity = 32/94 (34.04%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  389 NLTDDKLSKPYSTVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +LT  + ++  +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  569 DLTRPEDAEGGATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 661          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX12 (SRY-box 12 [Source:HGNC Symbol;Acc:HGNC:11198])

HSP 1 Score: 53.1434 bits (126), Expect = 9.495e-7
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 53.9138 bits (128), Expect = 1.293e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  573 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 654          
BLAST of SOXP-2 vs. Ensembl Human
Match: SOX6 (SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421])

HSP 1 Score: 53.9138 bits (128), Expect = 1.374e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  576 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 657          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: sem-2 (pep:known chromosome:WBcel235:I:5204664:5215218:-1 gene:WBGene00004771 transcript:C32E12.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:sem-2)

HSP 1 Score: 54.299 bits (129), Expect = 2.267e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS  T   KK   HI  RP+N+FM++S+  RR +     D  N+EISK LG  W ++    K+ +  EA++L + H
Sbjct:   79 PYSDATNC-KKSSNHIK-RPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCH 153          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: sem-2 (pep:known chromosome:WBcel235:I:5204664:5208128:-1 gene:WBGene00004771 transcript:C32E12.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:sem-2)

HSP 1 Score: 54.299 bits (129), Expect = 2.267e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS  T   KK   HI  RP+N+FM++S+  RR +     D  N+EISK LG  W ++    K+ +  EA++L + H
Sbjct:   79 PYSDATNC-KKSSNHIK-RPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCH 153          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 52.7582 bits (125), Expect = 6.494e-7
Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  440 RKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + K   HI  RP+N+FM+++R  RR +L  + D  NS ISK+LG  W  +  + K  Y  E  +L+ LH
Sbjct:  274 QAKSPNHIK-RPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLH 341          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 52.7582 bits (125), Expect = 6.494e-7
Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  440 RKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + K   HI  RP+N+FM+++R  RR +L  + D  NS ISK+LG  W  +  + K  Y  E  +L+ LH
Sbjct:  274 QAKSPNHIK-RPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLH 341          
BLAST of SOXP-2 vs. Ensembl Celegans
Match: egl-13 (Transcription factor egl-13 [Source:UniProtKB/Swiss-Prot;Acc:Q23045])

HSP 1 Score: 53.1434 bits (126), Expect = 6.933e-7
Identity = 27/69 (39.13%), Postives = 40/69 (57.97%), Query Frame = 2
Query:  440 RKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + K   HI  RP+N+FM+++R  RR +L  + D  NS ISK+LG  W  +  + K  Y  E  +L+ LH
Sbjct:  322 QAKSPNHIK-RPMNAFMVWARDERRKILKAYPDMHNSNISKILGSRWKGMSNSEKQPYYEEQSRLSKLH 389          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox14 (Sox box protein 14 [Source:FlyBase gene name;Acc:FBgn0005612])

HSP 1 Score: 59.3066 bits (142), Expect = 1.239e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox14 (Sox box protein 14 [Source:FlyBase gene name;Acc:FBgn0005612])

HSP 1 Score: 59.3066 bits (142), Expect = 1.239e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox14 (Sox box protein 14 [Source:FlyBase gene name;Acc:FBgn0005612])

HSP 1 Score: 59.3066 bits (142), Expect = 1.239e-8
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox100B (Sox100B [Source:FlyBase gene name;Acc:FBgn0024288])

HSP 1 Score: 51.9878 bits (123), Expect = 1.882e-6
Identity = 26/67 (38.81%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  446 KRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            ++K+HI  RP+N+FM++++  RR +   +    NSE+SK LGKLW N+  + K  +   A+KL + H
Sbjct:   72 RKKEHIK-RPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTH 137          
BLAST of SOXP-2 vs. Ensembl Fly
Match: Sox102F (Sox102F [Source:FlyBase gene name;Acc:FBgn0039938])

HSP 1 Score: 51.2174 bits (121), Expect = 3.525e-6
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 2
Query:  452 KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            K HI  RP+N+FM++++  RR +L    D  NS ISK+LG  W  +    K  Y  E  +L+ LH
Sbjct:  382 KPHIK-RPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLH 445          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox13 (SRY (sex determining region Y)-box 13 [Source:ZFIN;Acc:ZDB-GENE-100519-1])

HSP 1 Score: 53.5286 bits (127), Expect = 7.452e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  422 STVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             +  ESR     HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  395 GSFGESRTPSSGHIK-RPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQH 468          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox13 (SRY (sex determining region Y)-box 13 [Source:ZFIN;Acc:ZDB-GENE-100519-1])

HSP 1 Score: 53.5286 bits (127), Expect = 7.523e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  422 STVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
             +  ESR     HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  396 GSFGESRTPSSGHIK-RPMNAFMVWAKDERRRILQAFPDMHNSSISKILGSRWKSMSNQEKQPYYEEQARLSRQH 469          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: SOX14 (SRY-box 14 [Source:HGNC Symbol;Acc:HGNC:11193])

HSP 1 Score: 51.2174 bits (121), Expect = 1.038e-6
Identity = 46/118 (38.98%), Postives = 69/118 (58.47%), Query Frame = 2
Query:  443 KKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSXXXXXXXXXXXXXXXXYLTKCPINSTPLSSNS-YESIQDINSVTDTLQN 793
            K+  +HI  RP+N+FM++SR  RR + +      NSEISK LG  W  +  + K  Y +EAK+L   H +E P+YKY+P++K K  L K  + S PL   S  E  +D++S +   Q+
Sbjct:    3 KQPMEHIK-RPMNAFMVWSRGQRRQMALENPKMHNSEISKRLGAEWKRLSDSEKRPYIDEAKRLRAQHMREHPDYKYRPRRKPKGLLRKDMVLSLPLVGQSDSEKPRDVHSSSAAAQH 119          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox12 (SRY (sex determining region Y)-box 12 [Source:ZFIN;Acc:ZDB-GENE-040724-33])

HSP 1 Score: 52.373 bits (124), Expect = 1.253e-6
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 2
Query:  470 RPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            RP+N+FM++S+  RR ++  + D  N+EISK LGK W  +P   K  +  EA++L + H
Sbjct:   55 RPMNAFMVWSQIERRKIMEQWPDMHNAEISKRLGKRWKLLPDYEKIPFIKEAERLRLKH 113          
BLAST of SOXP-2 vs. Ensembl Zebrafish
Match: sox8b (SRY (sex determining region Y)-box 8b [Source:ZFIN;Acc:ZDB-GENE-031114-1])

HSP 1 Score: 51.9878 bits (123), Expect = 1.564e-6
Identity = 25/77 (32.47%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            P         K K H+  RP+N+FM++++  RR +   +    N+E+SK LGKLW  +  + K  +  EA++L + H
Sbjct:   71 PMPVRVSGSGKSKPHVK-RPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLTESEKRPFVEEAERLRVQH 146          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox7 (SRY (sex determining region Y)-box 7 [Source:Xenbase;Acc:XB-GENE-488067])

HSP 1 Score: 56.6102 bits (135), Expect = 2.992e-8
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 2
Query:  368 WMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            W   L  +  D+ LS   S     R+K  +    RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +    K  Y  EA++L + H
Sbjct:   10 WTEGLDCSPIDEDLSDGLSPHRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox6 (SRY (sex determining region Y)-box 6 [Source:Xenbase;Acc:XB-GENE-483934])

HSP 1 Score: 53.1434 bits (126), Expect = 5.911e-7
Identity = 27/72 (37.50%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            T  R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W  +    K  Y  E  +L+ +H
Sbjct:  372 TRGRSSSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIH 442          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox17a (SRY (sex determining region Y)-box 17 alpha [Source:Xenbase;Acc:XB-GENE-484295])

HSP 1 Score: 52.373 bits (124), Expect = 6.536e-7
Identity = 31/94 (32.98%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  365 QWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            QW   + N+L + KL K  +    SR K +  I  RP+N+FM++++  R+ +     D  N+E+SK+LGK W  +    K  +  EA++L + H
Sbjct:   31 QWAEPM-NSLGEGKL-KSDAGSANSRGKAEARIR-RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQH 121          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox6 (SRY (sex determining region Y)-box 6 [Source:Xenbase;Acc:XB-GENE-483934])

HSP 1 Score: 53.1434 bits (126), Expect = 6.661e-7
Identity = 27/72 (37.50%), Postives = 40/72 (55.56%), Query Frame = 2
Query:  431 TESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            T  R   + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W  +    K  Y  E  +L+ +H
Sbjct:  381 TRGRSSSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMSNQEKQPYYEEQARLSKIH 451          
BLAST of SOXP-2 vs. Ensembl Xenopus
Match: sox13 (SRY (sex determining region Y)-box 13 [Source:Xenbase;Acc:XB-GENE-481889])

HSP 1 Score: 52.373 bits (124), Expect = 1.120e-6
Identity = 26/66 (39.39%), Postives = 38/66 (57.58%), Query Frame = 2
Query:  449 RKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            R  HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+  H
Sbjct:  374 RGSHIK-RPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSRWKSMSNAEKQPYYEEQARLSRQH 438          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox12 (SRY (sex determining region Y)-box 12 [Source:MGI Symbol;Acc:MGI:98360])

HSP 1 Score: 53.1434 bits (126), Expect = 7.575e-7
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox12 (SRY (sex determining region Y)-box 12 [Source:MGI Symbol;Acc:MGI:98360])

HSP 1 Score: 53.1434 bits (126), Expect = 7.575e-7
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 53.9138 bits (128), Expect = 8.760e-7
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  557 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 638          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 53.9138 bits (128), Expect = 9.310e-7
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  599 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 680          
BLAST of SOXP-2 vs. Ensembl Mouse
Match: Sox6 (SRY (sex determining region Y)-box 6 [Source:MGI Symbol;Acc:MGI:98368])

HSP 1 Score: 53.9138 bits (128), Expect = 9.310e-7
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  422 STVTESRKKR--------KKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            +TV E+R  R        + HI  RP+N+FM++++  RR +L  F D  NS ISK+LG  W ++    K  Y  E  +L+ +H
Sbjct:  599 ATVAEARVYRDARGRASSEPHIK-RPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKSMSNQEKQPYYEEQARLSKIH 680          
BLAST of SOXP-2 vs. UniProt
Match: sp|P40656|SOX14_DROME (Putative transcription factor SOX-14 OS=Drosophila melanogaster GN=Sox14 PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 1.225e-7
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  410 SKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            S PYS  T ++K    HI  RP+N+FM++S+  RR +     D  N+EISK LG+ W  +    K  Y  EA+KL  LH
Sbjct:  170 STPYSDATRTKKHSPGHIK-RPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLH 247          
BLAST of SOXP-2 vs. UniProt
Match: sp|Q28GD5|SOX7_XENTR (Transcription factor Sox-7 OS=Xenopus tropicalis GN=sox7 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 4.867e-7
Identity = 29/93 (31.18%), Postives = 49/93 (52.69%), Query Frame = 2
Query:  368 WMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            W   L  +  D+ LS   S     R+K  +    RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +    K  Y  EA++L + H
Sbjct:   10 WTEGLDCSPIDEDLSDGLSPHRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102          
BLAST of SOXP-2 vs. UniProt
Match: sp|O42342|SOX7_XENLA (Transcription factor Sox-7 OS=Xenopus laevis GN=sox7 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 8.991e-7
Identity = 29/93 (31.18%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  368 WMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            W   L  +  D  LS   S     R+K  +    RP+N+FM++++  R+ + +   D  N+E+SK+LGK W  +    K  Y  EA++L + H
Sbjct:   10 WTESLDCSPMDGDLSDGLSPHRSPREKGSETRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALSPAQKRPYVEEAERLRVQH 102          
BLAST of SOXP-2 vs. UniProt
Match: sp|Q8T3B9|SEM2_CAEEL (Transcription factor sem-2 OS=Caenorhabditis elegans GN=sem-2 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 3.092e-6
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  416 PYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            PYS  T   KK   HI  RP+N+FM++S+  RR +     D  N+EISK LG  W ++    K+ +  EA++L + H
Sbjct:   79 PYSDATNC-KKSSNHIK-RPMNAFMVWSQMERRKICEHQPDMHNAEISKQLGSRWRSLTDEEKAPFVAEAERLRVCH 153          
BLAST of SOXP-2 vs. UniProt
Match: sp|O15370|SOX12_HUMAN (Transcription factor SOX-12 OS=Homo sapiens GN=SOX12 PE=2 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 4.879e-6
Identity = 25/63 (39.68%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  458 HITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            HI  RP+N+FM++S+H RR ++  + D  N+EISK LG+ W  +  + K  +  EA++L + H
Sbjct:   39 HIK-RPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKH 100          
BLAST of SOXP-2 vs. TrEMBL
Match: tr|H9CXU9|H9CXU9_SCHMD (SOXP-2 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 542/542 (100.00%), Postives = 542/542 (100.00%), Query Frame = 2
Query:  209 MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSXXXXXXXXXXXXXXXXYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNEXXXXXXXXXXXXXXNNVSKHTSDSIITNSPIREEIVLEXXXXXXXXXXXXYRHVFQRXXXXXXXXXXXXXIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLXXXXXXXXXXXXXXXKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI 1834
            MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSSSLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLSNSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI
Sbjct:    1 MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEFPEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNLQKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCKISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSSSLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLSNSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQNFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDPLIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDNPYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI 542          
BLAST of SOXP-2 vs. TrEMBL
Match: tr|A0A183TH27|A0A183TH27_SCHSO (Uncharacterized protein OS=Schistocephalus solidus PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.607e-32
Identity = 61/120 (50.83%), Postives = 85/120 (70.83%), Query Frame = 2
Query:  287 CQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            C+ C A + S+R W  HLVDRH +P +W S+ A+ L  D    PY+ VTESRKKR     PRPLNSFM+F++H+RRN+L+ F   SN+E+S+LLG+LW+ +P  IK+ +D EA +L+ LH
Sbjct:   48 CEDCHASKQSVRQWASHLVDRHTVPSEWPSERASRLPADSTRTPYTYVTESRKKRMPGAIPRPLNSFMLFAQHIRRNILLAFDGVSNAELSRLLGELWSALPRPIKTQFDEEATRLSKLH 167          
BLAST of SOXP-2 vs. TrEMBL
Match: tr|A0A0R3TTK2|A0A0R3TTK2_HYMNN (Uncharacterized protein OS=Hymenolepis nana PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.907e-32
Identity = 61/124 (49.19%), Postives = 89/124 (71.77%), Query Frame = 2
Query:  275 YFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + + C  C + QNSL+ W++HL D H LP +W SD A  LT    +KPY+T+TES+K+R+K   PRPLNSFM+F++H+RRNVL   ++ASNS +S+ LG +W ++P ++K+ YD EA KL  +H
Sbjct:    2 WMEDCVDCVSAQNSLQAWIRHLTDFHALPTEWPSDRALRLTGVAATKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRIHNEASNSVLSQQLGIVWRSVPRSVKNRYDEEAAKLVKIH 125          
BLAST of SOXP-2 vs. TrEMBL
Match: tr|A0A0R3SCN8|A0A0R3SCN8_HYMDI (Uncharacterized protein OS=Hymenolepis diminuta PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.151e-32
Identity = 61/124 (49.19%), Postives = 88/124 (70.97%), Query Frame = 2
Query:  275 YFDLCQKCSAYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            + D C  C + Q+SL+ W++HL D H LP +W SD A  LT    +KPY+T+TES+K+R+K   PRPLNSFM+F++H+RRNVL   ++ASNS +S+ LG +W ++P  +K+ YD EA KL  +H
Sbjct:    2 WMDDCVDCVSAQSSLQTWIRHLTDFHALPTEWPSDRALRLTGVAATKPYTTITESKKRRRKDSVPRPLNSFMLFAQHIRRNVLRIHNEASNSVLSQQLGIVWRSVPRIVKNRYDEEAAKLVKIH 125          
BLAST of SOXP-2 vs. TrEMBL
Match: tr|A0A158QCD2|A0A158QCD2_HYMDI (Uncharacterized protein OS=Hymenolepis diminuta PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 7.975e-32
Identity = 61/127 (48.03%), Postives = 89/127 (70.08%), Query Frame = 2
Query:  269 LTYFDLCQKCS-AYQNSLRDWMKHLVDRHPLPIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHLRRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILH 646
            L Y + C++C  A  + +  ++ HL + H +P +W SD A+ LT D+  KPY+T+  +RKKR+K  TPRPLNSFMIF++H+RRNVL  F  AS+S IS+LLG+ W+ IP  I++ YD EA +L+ +H
Sbjct:   10 LHYMNACKQCVIAIDDGVESFITHLTNEHAIPTEWPSDRASRLTGDEAKKPYTTIAATRKKRRKLTTPRPLNSFMIFAQHIRRNVLAIFETASSSNISRLLGQAWSKIPKEIRAAYDEEAARLSKIH 136          
The following BLAST results are available for this feature:
BLAST of SOXP-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
SOX69.218e-734.04SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421][more]
SOX69.218e-734.04SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421][more]
SOX129.495e-739.68SRY-box 12 [Source:HGNC Symbol;Acc:HGNC:11198][more]
SOX61.293e-636.14SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421][more]
SOX61.374e-636.14SRY-box 6 [Source:HGNC Symbol;Acc:HGNC:16421][more]
back to top
BLAST of SOXP-2 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
sem-22.267e-738.96pep:known chromosome:WBcel235:I:5204664:5215218:-1... [more]
sem-22.267e-738.96pep:known chromosome:WBcel235:I:5204664:5208128:-1... [more]
egl-136.494e-739.13Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-136.494e-739.13Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
egl-136.933e-739.13Transcription factor egl-13 [Source:UniProtKB/Swi... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Sox141.239e-841.77Sox box protein 14 [Source:FlyBase gene name;Acc:F... [more]
Sox141.239e-841.77Sox box protein 14 [Source:FlyBase gene name;Acc:F... [more]
Sox141.239e-841.77Sox box protein 14 [Source:FlyBase gene name;Acc:F... [more]
Sox100B1.882e-638.81Sox100B [Source:FlyBase gene name;Acc:FBgn0024288][more]
Sox102F3.525e-640.00Sox102F [Source:FlyBase gene name;Acc:FBgn0039938][more]
back to top
BLAST of SOXP-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
sox137.452e-737.33SRY (sex determining region Y)-box 13 [Source:ZFIN... [more]
sox137.523e-737.33SRY (sex determining region Y)-box 13 [Source:ZFIN... [more]
SOX141.038e-638.98SRY-box 14 [Source:HGNC Symbol;Acc:HGNC:11193][more]
sox121.253e-640.68SRY (sex determining region Y)-box 12 [Source:ZFIN... [more]
sox8b1.564e-632.47SRY (sex determining region Y)-box 8b [Source:ZFIN... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
sox72.992e-831.18SRY (sex determining region Y)-box 7 [Source:Xenba... [more]
sox65.911e-737.50SRY (sex determining region Y)-box 6 [Source:Xenba... [more]
sox17a6.536e-732.98SRY (sex determining region Y)-box 17 alpha [Sourc... [more]
sox66.661e-737.50SRY (sex determining region Y)-box 6 [Source:Xenba... [more]
sox131.120e-639.39SRY (sex determining region Y)-box 13 [Source:Xenb... [more]
back to top
BLAST of SOXP-2 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Sox127.575e-739.68SRY (sex determining region Y)-box 12 [Source:MGI ... [more]
Sox127.575e-739.68SRY (sex determining region Y)-box 12 [Source:MGI ... [more]
Sox68.760e-736.14SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
Sox69.310e-736.14SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
Sox69.310e-736.14SRY (sex determining region Y)-box 6 [Source:MGI S... [more]
back to top
BLAST of SOXP-2 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40656|SOX14_DROME1.225e-741.77Putative transcription factor SOX-14 OS=Drosophila... [more]
sp|Q28GD5|SOX7_XENTR4.867e-731.18Transcription factor Sox-7 OS=Xenopus tropicalis G... [more]
sp|O42342|SOX7_XENLA8.991e-731.18Transcription factor Sox-7 OS=Xenopus laevis GN=so... [more]
sp|Q8T3B9|SEM2_CAEEL3.092e-638.96Transcription factor sem-2 OS=Caenorhabditis elega... [more]
sp|O15370|SOX12_HUMAN4.879e-639.68Transcription factor SOX-12 OS=Homo sapiens GN=SOX... [more]
back to top
BLAST of SOXP-2 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|H9CXU9|H9CXU9_SCHMD0.000e+0100.00SOXP-2 OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|A0A183TH27|A0A183TH27_SCHSO3.607e-3250.83Uncharacterized protein OS=Schistocephalus solidus... [more]
tr|A0A0R3TTK2|A0A0R3TTK2_HYMNN3.907e-3249.19Uncharacterized protein OS=Hymenolepis nana PE=4 S... [more]
tr|A0A0R3SCN8|A0A0R3SCN8_HYMDI7.151e-3249.19Uncharacterized protein OS=Hymenolepis diminuta PE... [more]
tr|A0A158QCD2|A0A158QCD2_HYMDI7.975e-3248.03Uncharacterized protein OS=Hymenolepis diminuta PE... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009071High mobility group box domainSMARTSM00398hmgende2coord: 88..158
e-value: 1.5E-16
score: 70.9
IPR009071High mobility group box domainGENE3DG3DSA:1.10.30.10coord: 90..166
e-value: 4.1E-21
score: 74.9
IPR009071High mobility group box domainPFAMPF00505HMG_boxcoord: 90..157
e-value: 1.2E-14
score: 54.3
IPR009071High mobility group box domainPROSITEPS50118HMG_BOX_2coord: 89..157
score: 15.249
IPR009071High mobility group box domainSUPERFAMILYSSF47095HMG-boxcoord: 90..167
NoneNo IPR availableTMHMMTMhelixcoord: 49..66
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 15..32
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 2..19
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
NoneNo IPR availableTMHMMTMhelixcoord: 20..42

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009071HMG_box_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000003Stage 3
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000212blastomere compartment
PLANA:0000429neoblast compartment
PLANA:0004517blastomere
PLANA:0000009sigma neoblast
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035063 ID=SMED30035063|Name=SOXP-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2664bp
TGTACATTGAATTCAATATTTAATAGTGATTAACTTATCCAAATTTTCAG
CCACTTTTAGTTTAATTTGCGTGTTTTGTTGAGCAGTTTTTATTGGCGCA
TTTTATAAAAAATACAAAACCAATCCAAATCAGTTTGAATCATTGTCAGA
TTTTAGTCGTGCAAGATACATTATTTCATTTTAATTCTCTAGCATATGAC
ATTTAAACATGGAGCTGAATTACTCGTTGAATGATAATAATTTCAATTTA
CAATTAGAAAGCGAGTCCTTGACTTATTTCGATTTATGCCAAAAATGTTC
AGCGTACCAAAATAGTCTTAGAGACTGGATGAAACATTTAGTTGACAGAC
ATCCTTTACCTATTCAGTGGATGAGTGATTTGGCAAATAATTTAACAGAT
GATAAATTATCTAAGCCATATTCGACCGTTACAGAATCCCGTAAAAAACG
CAAGAAGCATATCACTCCAAGGCCATTGAATAGTTTCATGATATTTTCCA
GACATTTAAGAAGAAATGTTCTTATTTTCTTTAGTGATGCTTCAAATTCA
GAAATAAGCAAACTTCTTGGGAAGTTATGGAATAACATTCCAGCTACCAT
TAAATCGATGTATGATAATGAAGCTAAAAAGCTTGCAATTTTACACTCCA
AAGAATTTCCTGAATATAAATATCAACCTAAAAAGAAAAAAAAACAATAT
CTAACGAAATGCCCCATTAATTCCACACCTTTGTCGAGTAATTCATATGA
AAGTATTCAAGATATTAATTCAGTAACGGATACACTACAGAATTCATCTA
ACAACTTACAAAAGGAAAGTAATCCGACCTCTGTTTCGTCTTATGGAAGC
AATCAGGAATGTAATAATTCATTTAAGAATCATAGTGTACAGTCCAGCAA
TTTTCCCAAAGAAATCAACCATAAACCAAGTAGAAAAATTGAAAAGCAAT
CGTGCAAAATAAGTTCCAATCAAATAATGGATGATTCAGAAGGGGCTGAA
TCCAGTCCATCATCATTTAAAAACACCATTAAAAATGAAATTTATTCCTC
TTATAGTCCATTTCTAAATGAATCCCATAGCATTCTTTCAGATTTAAGTT
ACTCTTCGTCTCTCAATAACGTTTCAAAACACACTAGCGATTCCATTATA
ACGAATTCTCCTATCAGAGAAGAAATTGTCTTAGAAAATAATCAGCCCTC
TCAACAGAATAATATAAACAATTACCGACACGTATTTCAGAGAACTTCGA
CTCTATCCAACAGTTTGTTGACCCCTTTAACCATTGTCACAGAAAAAGTT
GACGAACAGAAAGATCTTCCACCATCAAGAATCAATATCCGATATGTGAA
AATTAACAAACTACCGATTCAAACAAAATCCGATTTCCCATTGACTGGAT
ATTTTCAAAATTTCAATAACGACTCAAATCTTCATTTTCAGAGTTCCATT
CACGCCCTGAATACGACATTGACTCCAGATCTGTCGGTAAAACGCGAAGC
CACTGTCAACAACAGCATGACAGATTATATCAATCGAAAACGTACAAATG
TCGATCCACTTATCATCGATGATATATTTGAAAACGAACAATTTGAAGAT
GAGGAAGTGTTGAATTTTGACAATCCTGATAACAATAACAGTTCTCCTTG
GTCGTTTAAATCGCCTAACTTTAAAATATCTACCGGTTCCTCGACACTGT
CAGACAATCCGTACAAAGAACAGTTTTGTTCTTCCCCGTTCCATCTATCA
GAAACTGATACTCAACCGATTCCAGTTCAACGATTGCCAGCAATCGGCTC
ATGGTTAAAGTCAAACTATTCTGAATTCATGATCTGATCCAATCTATTAT
TCTATTCAATTGTCTGTTTTCATACAATTAGGATTACTTGTTATGAATTC
TAGCTGATTTTGAGTGTGTTTATAAAGCTTTTGTAACGCCTTTTCTATAC
AGATGTTCGATATATATATATAAATAAATAAATATAAATATATAACAATT
TTATTGACATTGTACAGTATTCCATAAGCCCGATCTTGTAACGCATTTAT
TACTATACTCAATAGACCAATCTATATGTTCTCATAATTTCTATGTTGTT
ATTGTACACGGGAATTATTACTATAAATGATGCGAATTTATCACTTTGTA
ATTGAGGGAAATTATCGATCAATTTGCGCTTTCAGACATTTTTCATGTAT
AAACTTGTTTTTCTCTTTTTTATCATCAAAAATTTAATTTTTTTGATATC
GCTATTCATCATATTATTATTCTCCGTTGCATTTGTTAGATTATGTAAAT
TTTTATATGAAAATGTTGTTATTTATTGTATTTTTATACGATTTTTTGCT
TTGGATACACTTTTATCAAATCATATTGCCAGTGTGAGCATTTATTGGAC
TTGTTGTTATTGCTGCTGCTCGAATAATTGCTTCATACGGGGAGTCTCGA
TATTTTCATGAAGCGATTTTCATGGTTGCCGCTCTCCGCCGCCGCCATTC
GGTGTAAATATCAATTGCATTGCCAGCACGTTTTCTCAAACTCAATTTTT
GTACTCAATTTCAATTGATTTATGTTCATTTTATTTTTCATAGAAATGAG
TAAATAAATTTTCATAAATAGTTTTGTTTTCAATATTTTTAGGAAATTTG
AATGTGTCTCTAGA
back to top

protein sequence of SMED30035063-orf-1

>SMED30035063-orf-1 ID=SMED30035063-orf-1|Name=SMED30035063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=543bp
MELNYSLNDNNFNLQLESESLTYFDLCQKCSAYQNSLRDWMKHLVDRHPL
PIQWMSDLANNLTDDKLSKPYSTVTESRKKRKKHITPRPLNSFMIFSRHL
RRNVLIFFSDASNSEISKLLGKLWNNIPATIKSMYDNEAKKLAILHSKEF
PEYKYQPKKKKKQYLTKCPINSTPLSSNSYESIQDINSVTDTLQNSSNNL
QKESNPTSVSSYGSNQECNNSFKNHSVQSSNFPKEINHKPSRKIEKQSCK
ISSNQIMDDSEGAESSPSSFKNTIKNEIYSSYSPFLNESHSILSDLSYSS
SLNNVSKHTSDSIITNSPIREEIVLENNQPSQQNNINNYRHVFQRTSTLS
NSLLTPLTIVTEKVDEQKDLPPSRINIRYVKINKLPIQTKSDFPLTGYFQ
NFNNDSNLHFQSSIHALNTTLTPDLSVKREATVNNSMTDYINRKRTNVDP
LIIDDIFENEQFEDEEVLNFDNPDNNNSSPWSFKSPNFKISTGSSTLSDN
PYKEQFCSSPFHLSETDTQPIPVQRLPAIGSWLKSNYSEFMI*
back to top
Aliases
The feature 'SOXP-2' has the following synonyms
Synonym
SOXP-2
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30035063
GenBankAFD29620.1