Acid-sensing ion channel 1C

Overview
NameAcid-sensing ion channel 1C
Smed IDSMED30035055
Length (bp)1925
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acid-sensing ion channel 1C (SMED30035055) t-SNE clustered cells

Violin plots show distribution of expression levels for Acid-sensing ion channel 1C (SMED30035055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acid-sensing ion channel 1C (SMED30035055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acid-sensing ion channel 1C (SMED30035055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035055SMESG000029022.1 SmedASXL_010546SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30035055SMESG000029022.1 dd_Smed_v4_17245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035055SMESG000029022.1 dd_Smed_v4_17245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035055SMESG000029022.1 dd_Smed_v4_17245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30035055SMESG000029022.1 dd_Smed_v4_17245_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30035055SMESG000029022.1 dd_Smed_v6_17245_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 48.1358 bits (113), Expect = 6.137e-6
Identity = 31/99 (31.31%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLFLRCCDACYFYKFKSENQQK----NVFKVNLNKTDTQL 1833
            +E +I  N + + I   +L  + +E+   Y +  LL DIGG +GL++GASL+TI E++ YL     D    Y +  ++ Q+    N+ +  L    TQ+
Sbjct:   31 SEAYIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQRHSSTNLLQEGLGSHRTQV 129          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 56.6102 bits (135), Expect = 3.776e-8
Identity = 70/333 (21.02%), Postives = 122/333 (36.64%), Query Frame = 1
Query:  187 LATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIV------------HRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDE-GIFVDAFTQIDLKGTTKVHIN----VNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGC 1134
            L  V    S  ++ H + H+  A     +  W+++   ++  F     +L+  YL   V T      +   +P +TIC++NP       S ++  +  LI+ ++ +                 + +S  T  + E  +    +D   I  + D       +++ C Y    C+ + F   +   +GNCL FN   M    SR      L+   R D                +D +      +G++I IH  +  PY D  G F    T   L G + V         G C T+      +   T   ++       C  + +QEKI  +CGC
Sbjct:    8 LKYVFTDFSCWTSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVNTETTLQFAERTFPTVTICHLNPWKLSETKS-VDPDMSALIDAYNSDSSSAQFGLPASLTADRQQQASKWTLMYSERLNEKQYNDAADIAYSYD------DMVVSCTYNAKTCNITDFNDFYNPSYGNCLQFNTDGMYSS-SRAGPLYGLRMVMRTD----------------QDTYLPWTEASGVIIDIHMQDEIPYPDVFGYFAPPGTASSL-GVSYVQTTRLSKPYGSCTTKTKLKTTHYTGTYTVEA-------CFRSCMQEKIIASCGC 308          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 55.8398 bits (133), Expect = 9.282e-8
Identity = 30/80 (37.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1522 VKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYF 1761
            V +I  D     ++  +N   + I    L  + ++ET  Y LV L SD GG IGLW+G S+IT  E   LF   C   YF
Sbjct:  645 VSDIFNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYF 724          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 55.8398 bits (133), Expect = 9.291e-8
Identity = 30/80 (37.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1522 VKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYF 1761
            V +I  D     ++  +N   + I    L  + ++ET  Y LV L SD GG IGLW+G S+IT  E   LF   C   YF
Sbjct:  647 VSDIFNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYF 726          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 55.4546 bits (132), Expect = 9.495e-8
Identity = 30/80 (37.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1522 VKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYF 1761
            V +I  D     ++  +N   + I    L  + ++ET  Y LV L SD GG IGLW+G S+IT  E   LF   C   YF
Sbjct:  606 VSDIFNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYF 685          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 55.4546 bits (132), Expect = 1.171e-7
Identity = 30/80 (37.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1522 VKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYF 1761
            V +I  D     ++  +N   + I    L  + ++ET  Y LV L SD GG IGLW+G S+IT  E   LF   C   YF
Sbjct:  646 VSDIFNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYF 725          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 51.6026 bits (122), Expect = 1.606e-6
Identity = 24/58 (41.38%), Postives = 39/58 (67.24%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI 1725
            +ED+I  NF+ + I   +L  + IE+   Y +  LL DIGG +GL++GAS++TI E++
Sbjct:  207 SEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEIL 264          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 51.6026 bits (122), Expect = 2.551e-6
Identity = 24/58 (41.38%), Postives = 39/58 (67.24%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI 1725
            +ED+I  NF+ + I   +L  + IE+   Y +  LL DIGG +GL++GAS++TI E++
Sbjct:  399 SEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEIL 456          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic4b (acid-sensing (proton-gated) ion channel family member 4b [Source:NCBI gene;Acc:407667])

HSP 1 Score: 50.0618 bits (118), Expect = 6.775e-6
Identity = 24/62 (38.71%), Postives = 42/62 (67.74%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            +E++I  NF+ + I   +L  + IE+   Y +  LL DIGG +GL++GAS++TI E++ Y++
Sbjct:  403 SEEYIRDNFLILDIFFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIY 464          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 50.0618 bits (118), Expect = 7.007e-6
Identity = 27/62 (43.55%), Postives = 39/62 (62.90%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
             E +I+ N M + I   +L  + IE+   Y L  LL DIGG +GL++GAS++TI EL  YL+
Sbjct:  430 TEQYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLY 491          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 50.0618 bits (118), Expect = 7.960e-6
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1513 IRLVKNISADKIL-----NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            +R+    SA  +       E +I+ N M + I   +L  + IE+   Y L  LL DIGG +GL++GAS++TI EL  YL+
Sbjct:  392 VRIPSKASAKYLAKKYNKTEQYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLY 471          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: lhx1 (LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482])

HSP 1 Score: 55.0694 bits (131), Expect = 1.551e-7
Identity = 65/273 (23.81%), Postives = 120/273 (43.96%), Query Frame = 1
Query:  214 RQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSS-FVYPDITICNVNPLYFGSGGSRINASVKLLIENFSIN---DKIVHRN-SSDST--NNFFEGFDNPDISDL--LFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGR--DPFNNINTPTGILIMIHEAETFPY-RDEGIFVDAFTQIDLKGTTKVHINV 996
            + ++ H + ++ ++K+  ++++WL+    AL         ++L Y   P    I    S+   +P +TICN+N +   S G   + S  L      +    ++  H N +SDS   N  +    N   S+   L  ++ I+  H    ++I C +   EC+ S F     + FGNC TFN  K +  R   ++   L N  +  F   +     HL  F +  +   ++    GI +++H+    P+  DEG+ V    + ++ G  KV + V
Sbjct:   36 QHTSAHGIPNIFRSKHWFRRMVWLVFVSFALCCALWQCTQMVLTYYTYPSHEKIMLISSAKLKFPAVTICNLNSVRLSSLGRSFSMSNSLQDSGLEMTHRRNRSHHMNVTSDSVDENVLYASAFNKFASEFNQLPDEQKIEMGHQLEDMLIFCNFHGQECNSSFFSGFINYKFGNCYTFNSQKSVDIRGNQIRVDPL-NITKAGFMYGL-----HLELFIQQIEYVRDMTHAAGIRLLVHDQAQMPFPEDEGVNVPPGAETEI-GMMKVQLIV 301          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 51.6026 bits (122), Expect = 3.001e-6
Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF-LRCCDA 1752
            NE +I  NF+ + I   +L  + IE+   Y L  LL DIGG +GL++GAS +TI E++ Y++ +R C  
Sbjct:  356 NETYIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMYEVRGCGG 424          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 51.6026 bits (122), Expect = 3.357e-6
Identity = 29/76 (38.16%), Postives = 45/76 (59.21%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLFLRCCDACYFYKFKS 1776
            NE +I  NF+ + I   +L  + IE+   Y L  LL DIGG +GL++GAS +TI E++ Y++       Y+Y+ K 
Sbjct:  356 NETYIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMYEVIQVLFYYYREKG 431          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 51.2174 bits (121), Expect = 4.329e-6
Identity = 26/62 (41.94%), Postives = 40/62 (64.52%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            NE +I  NF+ + I   +L  + IE+   Y L  LL DIGG +GL++GAS +TI E++ Y++
Sbjct:  356 NETYIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMY 417          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 63.5438 bits (153), Expect = 4.403e-10
Identity = 110/533 (20.64%), Postives = 207/533 (38.84%), Query Frame = 1
Query:  211 SRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFV-YPDITICNVNPLYFGSGGSRIN--------ASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIW-PFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTP----TGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKC------QSFVGRQA-DCISNLVQEKIGTNCGCVLHTVP---VPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
            +  ++ H +++++Q +N  +K++WL +   ++      +YS ++ Y   P  T+I   +   + +P +T+CN+N  +     SR           S  L ++  S N+       S  T +F     N  I++  F++ N  Y +     ++ C +    C    F  +H++  +GNC TFN     GE  +N  K  +             +G+  L    ++ F +   P     G++ +IH  +  P            Q D  G +   + ++ R   +Q++  + ++   +C      ++F+      C+       I   CGC+   +P   V C L +   C+               L+    + +  M +HN   +C    CE T +   VS+S++PS                  +R  +F  K              K N +                   +++I  N + + I  S L     ++     +  LL+D+GG +GL+ GASLITI E+I  F 
Sbjct:   42 AMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLN-RFQTEAVSRFGIIFFLWDIVSKVLRLQEISANN-----TGSPETLDFVTNHQNFSITE--FVKNNGFYLNN--DTLVHCEFFGKTCSPKDF--KHVFTEYGNCFTFN----YGENIQNKNKVSVSG-----------RGLKLLLDVHQEEFTDNPVPGFADAGVIFVIHSPKKEP------------QFDGLGLSS-PVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITYSTYGCLKECKARHIQRLCGCLPFLLPGNGVECDLLEYYNCVS------------PILDHIERKGLCTMGTHN--SSCPVS-CEETEYPATVSYSTFPS------------------QRATRFLAK--------------KLNQS-------------------QEYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIEYFF 468          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 62.3882 bits (150), Expect = 8.551e-10
Identity = 110/530 (20.75%), Postives = 206/530 (38.87%), Query Frame = 1
Query:  220 STVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFV-YPDITICNVNPLYFGSGGSRIN--------ASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWP-FGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTP----TGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKC------QSFVGRQA-DCISNLVQEKIGTNCGCVLHTVP---VPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
            ++ H +++++Q +N  +K++WL +   ++      +YS ++ Y   P  T+I   +   + +P +T+CN+N  +     SR           S  L ++  S N+       S  T +F     N  I++  F++ N  Y +     ++ C +    C    F  +H++  +GNC TFN     GE  +N  K  +             +G+  L    ++ F +   P     G++ +IH  +  P            Q D  G +   + ++ R   +Q++  + ++   +C      ++F+      C+       I   CGC+   +P   V C L +   C+               L+    + +  M +HN   +C    CE T +   VS+S++PS                  +R  +F  K              K N +                   +++I  N + + I  S L     ++     +  LL+D+GG +GL+ GASLITI E+I  F 
Sbjct:    3 TSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLN-RFQTEAVSRFGIIFFLWDIVSKVLRLQEISANN-----TGSPETLDFVTNHQNFSITE--FVKNNGFYLNN--DTLVHCEFFGKTCSPKDF--KHVFTEYGNCFTFN----YGENIQNKNKVSVSG-----------RGLKLLLDVHQEEFTDNPVPGFADAGVIFVIHSPKKEP------------QFDGLGLSS-PVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITYSTYGCLKECKARHIQRLCGCLPFLLPGNGVECDLLEYYNCVS------------PILDHIERKGLCTMGTHN--SSCPVS-CEETEYPATVSYSTFPS------------------QRATRFLAK--------------KLNQS-------------------QEYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIEYFF 426          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Scnn1g (sodium channel, nonvoltage-gated 1 gamma [Source:MGI Symbol;Acc:MGI:104695])

HSP 1 Score: 51.2174 bits (121), Expect = 3.387e-6
Identity = 77/386 (19.95%), Postives = 149/386 (38.60%), Query Frame = 1
Query:  592 IQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQAD----CISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
            ++K I+ S+ A  L++ C +    C    F + H   +GNC TFN       R      +    G     ++++Y     +N+   +PF  + + TG  +++H+   +P+ +     D  T+I+   +T + +++       +   +  +  +D   + +   A     C+ +  Q K+   CGC  ++ P+P       +C   Q H +      +     +   +         ++  K  C    +T   S + +PS  E    +L LNVL                 T    QQI  K N T +   +   K+++   I                     M+    ++E     LLS+ GG +GLW+  S++ + E+I +F 
Sbjct:  249 LEKKINMSYSAEELLVTCFFDGMSCDARNFTLFHHPMYGNCYTFN------NRENATILSTSMGGSEYGLQVILY-----INEDEYNPF--LVSSTGAKVLVHQQNEYPFIE-----DVGTEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGCAQYSQPLPPAAN---YC-NYQQHPNWMYCYYQLYQAFVREELG-------CQSVCKQSCSFKEWTLTTSLAQWPS--EASEKWL-LNVL-----------------TWDQSQQINKKLNKTDLAKLLIFYKDLNQRSI---------------------MESPANSIE----MLLSNFGGQLGLWMSCSVVCVIEIIEVFF 560          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 50.0618 bits (118), Expect = 7.350e-6
Identity = 29/91 (31.87%), Postives = 52/91 (57.14%), Query Frame = 1
Query: 1489 NVTSIKDAIRLVK--NISADKIL------NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            N+T     I +VK  N  + + L      NE +I  NF+ + +   +L  + +E+   Y L  LL D+GG +GL++GAS++T+ E++ Y++
Sbjct:  357 NLTRYGKEISMVKIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIY 447          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 50.0618 bits (118), Expect = 7.761e-6
Identity = 29/91 (31.87%), Postives = 52/91 (57.14%), Query Frame = 1
Query: 1489 NVTSIKDAIRLVK--NISADKIL------NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            N+T     I +VK  N  + + L      NE +I  NF+ + +   +L  + +E+   Y L  LL D+GG +GL++GAS++T+ E++ Y++
Sbjct:  376 NLTRYGKEISMVKIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQMGLFIGASILTLLEILDYIY 466          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.816e-16
Identity = 136/569 (23.90%), Postives = 226/569 (39.72%), Query Frame = 1
Query:  196 VLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLT-NIFHDHSSFVYPDITICNVNP--------LYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPF-NNINTPTGILIMIHEAETFPYR-DEGIFVDA--FTQIDLKGTTKVHINVN-GRCNTQQV----RYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVP-VPCFLRDLPFC--IKLQHHIDIDVSKR---KTLND----------CMER---NMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYP------SVREK---------QNHYL--WLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLR 1740
            ++  +  +S  H L  +  +++TK+K++W ++  A     T+ L  L+ KYL+  V+  +   D     YP ++ICN+ P        +YF +    +   ++  I+ F    +    +  +S   F+E             Q     SH    +++ C + +  CH S F       + NC TFN  + L      +  T  +NG    F   V K       +G   F NNI    G+ +++H   + P   D GI +     + + LK      +    G C    +    +Y+Y  F              C+    Q  I   CGC    +P VP +  +  FC  IK    I+ + S     ++  D          C ER   N+NN  ++     C +  C  T++   VS S +P      S  E+         QNH++      L +L     K   ++D H       I++K    S K+   + K  S       D I +N +++ I    L +    +   Y L  L +DIGG +GLW+G S++TI ELI L +R
Sbjct:   42 IIAELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNESQNLITWLR-FIQKF----RFEQDSFMNSIRAFYENLG----------QDAKKLSHNLEDMLMHCRFNRELCHVSNFSTFFDGNYFNCFTFNSGQRL-----QMHATGPENGLSLIFS--VEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLNGIKQYKYTFFA-------------CLQLCKQRLIIQRCGCKSSALPEVPSY--NATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQP-CSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSH----MDDILSKSYSLSEKE---MAKEAS-------DLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIR 558          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q9R0Y1|ASIC5_MOUSE (Acid-sensing ion channel 5 OS=Mus musculus OX=10090 GN=Asic5 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.080e-9
Identity = 110/533 (20.64%), Postives = 207/533 (38.84%), Query Frame = 1
Query:  211 SRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFV-YPDITICNVNPLYFGSGGSRIN--------ASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIW-PFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTP----TGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKC------QSFVGRQA-DCISNLVQEKIGTNCGCVLHTVP---VPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
            +  ++ H +++++Q +N  +K++WL +   ++      +YS ++ Y   P  T+I   +   + +P +T+CN+N  +     SR           S  L ++  S N+       S  T +F     N  I++  F++ N  Y +     ++ C +    C    F  +H++  +GNC TFN     GE  +N  K  +             +G+  L    ++ F +   P     G++ +IH  +  P            Q D  G +   + ++ R   +Q++  + ++   +C      ++F+      C+       I   CGC+   +P   V C L +   C+               L+    + +  M +HN   +C    CE T +   VS+S++PS                  +R  +F  K              K N +                   +++I  N + + I  S L     ++     +  LL+D+GG +GL+ GASLITI E+I  F 
Sbjct:   42 AMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLN-RFQTEAVSRFGIIFFLWDIVSKVLRLQEISANN-----TGSPETLDFVTNHQNFSITE--FVKNNGFYLNN--DTLVHCEFFGKTCSPKDF--KHVFTEYGNCFTFN----YGENIQNKNKVSVSG-----------RGLKLLLDVHQEEFTDNPVPGFADAGVIFVIHSPKKEP------------QFDGLGLSS-PVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITYSTYGCLKECKARHIQRLCGCLPFLLPGNGVECDLLEYYNCVS------------PILDHIERKGLCTMGTHN--SSCPVS-CEETEYPATVSYSTFPS------------------QRATRFLAK--------------KLNQS-------------------QEYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIEYFF 468          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q95165|SCNNB_CANLF (Amiloride-sensitive sodium channel subunit beta OS=Canis lupus familiaris OX=9615 GN=SCNN1B PE=3 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 5.600e-8
Identity = 58/232 (25.00%), Postives = 100/232 (43.10%), Query Frame = 1
Query:  604 IDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPY-RDEGIFVDAFTQ---------IDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVP-----CFLRDLPFCIKLQHHIDIDVSKRKT-LNDCME 1251
            ++ S+PA  LI+ C++    C +  F       +GNC  FN    + E++        + G     K+++  G      F       + +  G  +M+HE  ++P+ +DEGI+  + T+         ++ KG       VNG  +   VR  Y D+ T         QA CI +  Q+ +  NC C  +  P+P     C  R+ P       H+ + V++R+T +N C E
Sbjct:  237 VEMSYPAERLILACLFGAEPCSYRNFTSIFHPDYGNCYIFNWG--MTEKALPSANPGAEFG----LKLILDIGQEDYVPF-------LTSTAGARLMLHEQRSYPFIKDEGIYAMSGTETSIGVLVDRLERKGEPYSQCTVNG--SDVPVRNLYSDYNTT-----YSIQA-CIRSCFQDHMIQNCSCAHYLYPLPRGERYCNNREFPDWAYCYSHLRMSVAQRETCINMCKE 447          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|F1MJW3|SCNNG_BOVIN (Amiloride-sensitive sodium channel subunit gamma OS=Bos taurus OX=9913 GN=SCNN1G PE=3 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 1.764e-7
Identity = 80/386 (20.73%), Postives = 150/386 (38.86%), Query Frame = 1
Query:  595 QKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNT----QQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPS-VREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
            +K I+ S+ A  L++ C +    C    F + H   +GNC TFN       R      +    G     ++++Y     +N+   +PF  + + TG  ++IH  + +P+ +     D  T+I+    T + +++           Q   ++ D +     +       C+ +  Q K+  NCGC  ++ P+P   R   +C   Q H +      +     +   +         ++  K+ C    +T   S + +PS V EK     WL                  + T    QQI  K N T +   +   K+++   I                     M++   ++E    +LLS+IGG +GLW+  S++ + E+I +F 
Sbjct:  247 EKKINMSYSADELLVTCFFDGVSCDARNFTLFHHPMYGNCYTFN------NRQNETILSTSMGGSEFGLQVILY-----INEEEYNPF--LVSSTGAKVIIHRQDEYPFVE-----DVGTEIETAMATSIGMHLTESFKLSDPYSQCTEDWSDVQITNIYNATYSLQICLHSCFQAKMVENCGCAQYSQPLP---RGADYC-NYQQHPNWMYCYYQLHQAFVREELGC-------QSVCKEACSFKEWTLTTSLAQWPSEVSEK-----WL----------------LSILTWDQSQQIKKKLNKTDLAKLLIFYKDLNQRSI---------------------MENPANSIE----QLLSNIGGQLGLWMSCSVVCVIEIIEVFF 557          
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Match: sp|Q21974|UNC8_CAEEL (Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 GN=unc-8 PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.489e-6
Identity = 30/80 (37.50%), Postives = 40/80 (50.00%), Query Frame = 1
Query: 1522 VKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYF 1761
            V +I  D     ++  +N   + I    L  + ++ET  Y LV L SD GG IGLW+G S+IT  E   LF   C   YF
Sbjct:  646 VSDIFNDTEACTEYYRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYF 725          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A0R3TJX9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7422 PE=3 SV=1)

HSP 1 Score: 392.119 bits (1006), Expect = 5.291e-124
Identity = 215/534 (40.26%), Postives = 312/534 (58.43%), Query Frame = 1
Query:  163 YVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGS----RINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNEL-QRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCD 1749
            YV   C       +  SR+ST+H LNHLSQA+  +++L WL I  AALFGF  N++ L+ KY++ PVLTN+ HD  +F+YPD+T C +NP+YF   G+    R++++++   E    N   VHR                +++D LF+++N  Y HP W  I++C YMQ  C +  F+ + +WP+G C TFN TKML   +R +      N +RPDFKI+VYK +    KF  DP  ++N P+G+L+MIHE  T+P+      VD  TQI+L+ T   H+   G+C  ++    Y +  T+K Q F+  Q DC+   VQ  +  NCGC +HT+PV      LPFC         D      + +C     +N+ +    K+C +D+CEH T   VV+H+ +P++ E+  +Y WL++L  L +R E ++  KSD+    +        N+T IK+ + +  N S   +LN DF+NRNFM +RIVP+SLFMD +EET EYP  RLLSDIGGC+GLW+GASLIT+FE   L L C D
Sbjct:   72 YVAAAC---GASFLRFSRRSTMHGLNHLSQARTAQRRLFWLCISIAALFGFFFNMFFLVEKYVQVPVLTNVLHDSDNFIYPDVTFCTINPIYFPPEGTTEFERMSSAIEKFKEFKRSNHPHVHR---------------LELADYLFVERNTYYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEKFRMDPHGSVNVPSGVLLMIHEPGTYPHIGHSSIVDECTQIELRMTYVKHLAKLGKCVPEREYISYVNTATNKSQIFLSSQPDCLDAAVQTALAENCGCQMHTMPVMYKYHHLPFCFS-------DALNFTFIENC----FSNVANTVDRKHCFRDVCEHFTIDRVVAHAKFPAIEERHTYYNWLHLLARLEEREEAQYKGKSDIAKLALNADFTVNPNLT-IKEVL-VSGNTS---LLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDCVD 571          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A0R3SIE1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4705 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 6.256e-123
Identity = 209/531 (39.36%), Postives = 305/531 (57.44%), Query Frame = 1
Query:  163 YVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLN-DCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRRE-IKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCD 1749
            Y+   C       +  SR+ST+H LNHL+QA+  +++L WL I  AAL GF  N++ LI KY++ PVLTN+ HD  +F+YPD+T CN+NP+YF    +     +   IE F    K  H +               +++D LF+++N  Y HP W  I++C YMQ  C +  F+ + +WP+G C TFN TKML   +R +      N +RPDFKI+VYK +    ++  DP  ++N P+GIL+MIHE  T+P+      VD   QI+L+ T   H+   G+C  ++    Y +  T++ Q+F+  Q+DC+   VQ  +  NCGC +HT+PV     +LPFC               +LN   +E   +N+++    ++C +D+CEH T   VV H+ +P++ E+  +  WL +L  L+ RE  ++  KSD+    +        N+T IKD I    N S   +LN DF+NRNFM +RIVP+SLFMD +EET EYP  RLLSDIGGC+GLW+GASLIT+FE   L L   D
Sbjct:   70 YMAAAC---GASFLRFSRRSTMHGLNHLAQARTAQRRLFWLCISIAALVGFFFNMFFLIEKYIQVPVLTNVLHDSDNFIYPDVTFCNINPIYFPPKETAEFKRMIAAIEKFKKFKKSTHPH-----------VHRLELADYLFVERNTFYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEEYRMDPHGSVNVPSGILLMIHEPGTYPHIGHSSIVDECAQIELRMTYVKHLAKLGKCVPEREHISYVNTATNESQNFLSSQSDCLDAAVQTALAENCGCQMHTMPVMYRYNNLPFCFS------------DSLNFSFIESCFSNVSNAVDRQHCFRDVCEHFTIDRVVVHAKFPAIAERHTYQNWLRLLARLEEREKAQYRGKSDIAKLALNADFTANPNLT-IKD-IFASGNTS---LLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDFMD 569          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A564Z6I1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12764 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 7.345e-123
Identity = 209/531 (39.36%), Postives = 305/531 (57.44%), Query Frame = 1
Query:  163 YVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLN-DCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRRE-IKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCD 1749
            Y+   C       +  SR+ST+H LNHL+QA+  +++L WL I  AAL GF  N++ LI KY++ PVLTN+ HD  +F+YPD+T CN+NP+YF    +     +   IE F    K  H +               +++D LF+++N  Y HP W  I++C YMQ  C +  F+ + +WP+G C TFN TKML   +R +      N +RPDFKI+VYK +    ++  DP  ++N P+GIL+MIHE  T+P+      VD   QI+L+ T   H+   G+C  ++    Y +  T++ Q+F+  Q+DC+   VQ  +  NCGC +HT+PV     +LPFC               +LN   +E   +N+++    ++C +D+CEH T   VV H+ +P++ E+  +  WL +L  L+ RE  ++  KSD+    +        N+T IKD I    N S   +LN DF+NRNFM +RIVP+SLFMD +EET EYP  RLLSDIGGC+GLW+GASLIT+FE   L L   D
Sbjct:   70 YMAAAC---GASFLRFSRRSTMHGLNHLAQARTAQRRLFWLCISIAALVGFFFNMFFLIEKYIQVPVLTNVLHDSDNFIYPDVTFCNINPIYFPPKETAEFKRMIAAIEKFKKFKKSTHPH-----------VHRLELADYLFVERNTFYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEEYRMDPHGSVNVPSGILLMIHEPGTYPHIGHSSIVDECAQIELRMTYVKHLAKLGKCVPEREHISYVNTATNESQNFLSSQSDCLDAAVQTALAENCGCQMHTMPVMYRYNNLPFCFS------------DSLNFSFIESCFSNVSNAVDRQHCFRDVCEHFTIDRVVVHAKFPAIAERHTYQNWLRLLARLEEREKAQYRGKSDIAKLALNADFTANPNLT-IKD-IFASGNTS---LLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDFMD 569          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A448WRB3 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS11667 PE=3 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 1.370e-121
Identity = 204/525 (38.86%), Postives = 313/525 (59.62%), Query Frame = 1
Query:  175 ICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNP-DISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIK-FTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKI--LNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
            +  R+ T L+  S++ST H LNHL+QA++  +++ WL I   A  GF  NLY LI KY++ P+LTN+ HD   F+YPD+T C VN +YF     R +++ + L+ +FS  D++V +           G +N   +SD L++Q + +Y+HPAWS +++C Y    C+W  F++R +WP+G+C T N TKM     R+++   +K  +RPDFK+++YK +     F RD  N ++ P GI +MIHE  TFP RDE   V+  TQ+D+K T   H+    +C++++   + +D  +    S + RQADCI  +VQ+ +   C C++H++P+   +  L FC   + +I         LNDC+ R+     +H   ++C  DLCEH + T VVS SSYP +R++  H  WL VL  ++  E++ F   SDL     ++ ++   N T     +RL + +   ++  LN DF+ RNF+ +RI PS  FMD + ETVEYPL  LLSDIGGC+GLW+GASLIT+FE + L L
Sbjct:   96 VMNRVGTTLIRFSQRSTFHGLNHLAQARSAHRRIFWLAISLFASIGFFTNLYFLIYKYMQTPILTNVLHDAQPFIYPDVTFCFVNSIYFPP---RNSSAYQELVRHFSAYDQLVAK-----------GLNNKIKLSDYLYMQPHANYTHPAWSAVVQCHYQHQPCNWQHFDVRRLWPWGSCFTLNATKM--NMKRDIRHREIKKKFRPDFKLIIYKALDRPADFTRDLHNGVDLPPGIALMIHEPGTFPPRDECAIVNGCTQVDIKMTWVSHLAHLSKCSSKRDILDLFDIGSGTSYSVLARQADCIDTIVQQSVALECHCLIHSLPISNNISHLDFCFNGRFNISY-------LNDCLLRSQ----AHFSVEHCFLDLCEHFSMTRVVSQSSYPGIRDRFTHRDWLRVLAGIEVSELEHFGNTSDL----AEKALLPHANATG--PPMRLTEVVRQGRVDLLNTDFVERNFLMLRIQPSGFFMDKVLETVEYPLSHLLSDIGGCVGLWIGASLITLFECVDLVL 587          
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Match: A0A183SCX1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS2069 PE=3 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 8.563e-113
Identity = 200/514 (38.91%), Postives = 297/514 (57.78%), Query Frame = 1
Query:  202 MSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIK-FTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFEL-IYLFL 1737
            +  SR+ST+H LNHL+QA+  +++L WL I  A+ FGF  NL+ L+ KY++ PVLTN+ HD  +F++PD+T CNVNP+YF   G+     +K  I  F         +   S+N F +      ++D LFI++N  Y HP W  I++C YMQ  C    F+ + IWP+G C TFN T+M    SR +      N +RPD +I+VYK +     +  DP ++   P G+L+MIHE  T+P+      VD  TQ++LK T+  H+   G+C   + R  Y +  +++ Q+F+  Q+DC+   VQ  +   CGC +HT+P+       PFC            +   L  C     N  T+    K+C  D+CEH T   V++H+ +P+V ++     WL +L +L+ RE+K ++ +SDL    ++   +   N+T  + A    K    D +LN DF+NRNFM +R+VP SLFMD +EET EYP  RLLSDIGGC+GLW+GASLIT+FEL I+L +
Sbjct:   78 LRFSRRSTMHGLNHLAQARTAQRRLFWLCISLASSFGFFFNLFFLMEKYIQVPVLTNVLHDSDNFIFPDVTFCNVNPIYFPPNGTPEFERIKENIHAF--------EDFKRSSNPFAKRLA---LADYLFIKRNTYYVHPKWLTIVECSYMQTPCSSEHFDEKIIWPYGACYTFNATRMPHNMSREISTRTRYNRFRPDLRIIVYKALEFPEGYRFDPHDSFQVPPGVLLMIHEPGTYPHIGHSGIVDECTQVELKMTSVTHLAKLGKCIPMRSRIAYVNVASNESQTFLSSQSDCLDAEVQSALAKYCGCQMHTMPIMYEYHHQPFCFS-------GALEPSFLETC----FNKATASVDRKHCFLDVCEHYTIDRVIAHTKFPAVEDRHTEQHWLQLLADLEDRELKQYSGRSDLAKMALKD--VPGGNITLAEAA----KKRQID-LLNIDFVNRNFMMLRVVPDSLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFELEIFLMI 562          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 50.8322 bits (120), Expect = 3.153e-6
Identity = 24/62 (38.71%), Postives = 42/62 (67.74%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            +ED+I  NF+ + I   +L  + IE+   Y +  LL DIGG +GL++GAS++T+ E++ Y++
Sbjct:  402 SEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYIY 463          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Match: asic4b (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103044180])

HSP 1 Score: 50.8322 bits (120), Expect = 3.362e-6
Identity = 25/62 (40.32%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
             ED+I  NF+ + I   +L  + IE+   Y +  LL DIGG +GL++GAS++TI E++ Y++
Sbjct:  406 TEDYIRDNFLILDIYFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIY 467          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Sea Lamprey
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 48.1358 bits (113), Expect = 4.572e-6
Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIV-PSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLFLRCCD-ACYFYKFKSENQQKNVFKVNLNKTDTQLFDDPNSML 1857
             ED+I  N + + I   ++L  + IE+   Y +  LL DIGG +GL++GAS++TI E+  YL+    D  C   K  ++ + +N+  ++       L+D P   L
Sbjct:  411 TEDYIRENVLVLDIFFEAALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILEIFDYLYEVLKDKVCKCRKKHNKKRSENMVSLSCTINKIHLYDTPCETL 515          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 82.4185 bits (202), Expect = 1.679e-16
Identity = 120/542 (22.14%), Postives = 208/542 (38.38%), Query Frame = 1
Query:  214 RQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFV-YPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFE----GFDNPDISDLL-FIQKNIDY------SHPAWSLIIKCVYMQAEC----------HWSQFEIRHIW--PFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVS-----HLNKFGRDPFNNINTPTGILIMIHEAETFPY-RDEGIFV----DAFTQIDLKGTTKVHINVNGRC-NTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFIN-RNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYL 1731
            +++T H    L     +K +L W+M   AA   F   L  L+ +Y  +P+ T     H+  + +P +TICN+N L       ++      +I N    +K   RNSS+S N F +     F+     ++L  +  + DY      +H    +++ C +    C          +W+Q      W   FGNC  FN  K               NG + D       G S      LN    +    I    G+ + I +    P+   +GI +        Q+    T ++    N  C ++ ++  +   F  +   S +  +  C++    E+    CGC  +  P     R++P C +L            T+ DC+ +  +     +  + C    C   +F   VS + +P+                   R  + TK    + + ++ +++NK   +S K                  F+N  N  QV +    L    ++ET+ Y  + LLSDIGG +G+W+G S +T  ELI L
Sbjct:   20 QETTAHGFGRLGATAGSKWRLYWVMFCLAAYCVFVWQLVGLVNQYNSKPIKTRTQLKHAQKLDFPVVTICNMNVLRASRLPPKLRTKFDQIINN---TNKTSPRNSSNSRNAFVDPQDLSFEETKKFEILHAVTAHDDYRELVSAAHQLEDILLSCNFNGVNCRNSKDPTIPTYWTQ-----TWNDNFGNCYMFNSVKT-------------HNGEKVDLYSSSVPGESNGLTLQLNLEQNEYLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIER----CGCTNYNTP-EMQKRNIPLCNRLN----------STIIDCLNKAYDTFEDGSCDRECPPS-CSEVSFDLTVSSARWPA-------------------RSFEVTK----YAYFLRVRVLNKIASSSSK-----------------YFVNSENIAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIEL 484          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO37453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR1])

HSP 1 Score: 57.3806 bits (137), Expect = 1.564e-8
Identity = 29/94 (30.85%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  217 QSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHS-SFVYPDITICNVNPLYFGSGGSRINASVKLLIENF 495
            Q+T H    ++ AK+  +++ W+ +  AA   F++ +Y L++ YL RP  T I+  H+ S  +P +T+CN N +      S+I + +    ENF
Sbjct:   22 QTTAHGFGKIANAKSRLRRMFWVCLVMAAFGMFSLQIYDLLMIYLSRPTGTQIWMKHAPSIAFPAVTLCNFNIVR----RSQITSELAGSFENF 111          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO34532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP23])

HSP 1 Score: 54.6842 bits (130), Expect = 5.650e-8
Identity = 67/320 (20.94%), Postives = 126/320 (39.38%), Query Frame = 1
Query:  148 ETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYS-LILKYLERPVLTNIFHDHS-SFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSIND----------------------------------KIVHRNSSDSTNNFFEG--FDNPDISDLLFIQ--KNIDYSHPAWSLIIKCVYMQAECHWSQFEI---------RHI--WPFGNCLTFNVTKMLGERSRNVKKTML---KNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYR-DEGIFV 942
            + T+N   G      +++   +  +T H +  +  A +  ++ LWL+ GC  ++   I + + L+++YLE+PV++ +   +  S V+P +TICN+N L         N S++ L+ N    D                                  K++    S      F+G   D   I  ++ +   +N+     A  +      +   C WS F+          +H   W +GNC TFN     G  +   K  +L   ++G         Y G+S +    +D +N      GI +++ + +  P+  +EG  V
Sbjct:   50 DATKNATGGFL----SLIRDFAASTTAHGIGKVFAADSMVRRALWLL-GCLTVYAVMIFMCAQLLVRYLEKPVVSRVEVSYEESLVFPAVTICNLNMLKHSKVAK--NPSIQSLMTNMKEKDEKMRYQPLTPLNTTAAPKDDLDKKIDEQKHRQIKKLMQEAVSSKEKQIFQGAEVDTTSIMGVMLMGSLRNVPSDRLA-QMGYSLDDLLVSCRWSAFKCNSGTLKDLWKHFWHWKYGNCYTFNS----GVSANGEKMPILTVDRSG--------PYDGLSMVIDVKQDQYNPFVDEAGIRVVLTDQQKMPFPFEEGFSV 349          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO36191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB5])

HSP 1 Score: 54.299 bits (129), Expect = 1.009e-7
Identity = 26/85 (30.59%), Postives = 48/85 (56.47%), Query Frame = 1
Query: 1537 ADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFKSENQQK 1791
            A+K+ +   + +NF++V++    L  + I  ++ YP+  LL D+GG +GLW+G S+IT  E + L +   D  ++   K   + K
Sbjct:  386 ANKMNDASILRKNFLRVKLYYEELNRETITYSLSYPVENLLGDVGGQLGLWIGVSVITCAEFLKLLV---DLAWYLASKMSGKTK 467          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Match: EDO37654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF66])

HSP 1 Score: 50.8322 bits (120), Expect = 5.792e-7
Identity = 25/86 (29.07%), Postives = 44/86 (51.16%), Query Frame = 1
Query:  181 KRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHS-SFVYPDITICNVNPL 435
            K++ T +      +T H    L ++KN  Q+  W++    A   F + ++ L  K+  +PV T I   H  +  +P +TICN+NP+
Sbjct:    6 KKIVTKIKDFLGYTTAHGFARLVESKNPVQRAFWVLACLGAFVAFGLQVHKLFSKFNRKPVDTYITVKHEMNLEFPAVTICNLNPI 91          
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Match: asic4a (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:101159336])

HSP 1 Score: 52.7582 bits (125), Expect = 9.453e-7
Identity = 55/257 (21.40%), Postives = 103/257 (40.08%), Query Frame = 1
Query:  157 QNYVRGICKRLATVLMSVSRQSTVHSLNHL-SQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHS-SFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPY 921
            ++ +   C   A  L   +   ++H +NH+    +   ++ LW +    +L  F  +     + YLE P +T +  + +   V+P +TICN+N   F    +  +A +  L     +  K  +R+    T+  +     PD+ D+          H    +++ C +    C    F + +   +G C TFN  K     SR  K+  + NG     +I++           R+  N  +   GI + IH  +  PY
Sbjct:   27 ESLIEESCAPPAKDLAGFANSCSLHGINHIFVSGRLGIRQTLWALAFLTSLALFLYHAAKCAISYLEHPHVTALNEEATPEMVFPAVTICNINRFRF---SALTDADIYHLANLTGLPPK--NRDGHKPTDLMYPA---PDMQDIFN-----RTGHQLEEMLMSCNFSGQNCSAEDFSVVYTR-YGKCYTFNGNKTA---SRKTKQGGMGNG----LEIMLDIQQDEYLPIWRET-NETSLEAGIRVQIHSQDEPPY 261          

HSP 2 Score: 51.9878 bits (123), Expect = 1.687e-6
Identity = 25/62 (40.32%), Postives = 42/62 (67.74%), Query Frame = 1
Query: 1552 NEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELI-YLF 1734
            +ED+I  NF+ + I   +L  + IE+   Y +  LL DIGG +GL++GAS++T+ E++ Y+F
Sbjct:  399 SEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYVF 460          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000029022.1 (SMESG000029022.1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 633/633 (100.00%), Postives = 633/633 (100.00%), Query Frame = 1
Query:   19 MWKTDMNDEMKTDDEDIFDEVDVNKSFLKSGKLPPIQAPNMKQETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFKSENQQKNVFKVNLNKTDTQLFDDPNSMLFINNYGNLERNIFSQLSNEE 1917
            MWKTDMNDEMKTDDEDIFDEVDVNKSFLKSGKLPPIQAPNMKQETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEHTTFTTVVSHSSYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFKSENQQKNVFKVNLNKTDTQLFDDPNSMLFINNYGNLERNIFSQLSNEE
Sbjct:    1 MWKTDMNDEMKTDDEDIFDEVDVNKSFLKSGKLPPIQAPNMKQETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEHTTFTTVVSHSSYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFKSENQQKNVFKVNLNKTDTQLFDDPNSMLFINNYGNLERNIFSQLSNEE 633          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000056126.1 (SMESG000056126.1)

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 261/549 (47.54%), Postives = 377/549 (68.67%), Query Frame = 1
Query:  145 QETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKI---VHRNSSDSTNNF--FEGFD-NPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFK 1773
            + +  +Y+  +CKR+ TVL+  SRQST+HSL+HL+QA+N KQ++ W +I  +A  GF INL ++I KY ERPVLTN++HD+ +FV+PDI+ C VNP++F   G+R     K L   F++  K     H  +     +F  ++ +  + D+SD LFIQ  + Y HPAWS I  CVYMQ+ C+W+ FE+RH+WP+GNC TF V       SR   K M+KN WRPDFKI+VYKG++   +F  DPFNN+NTP+G+L+M+HEA+T+PY DEG  VD++TQIDLK TTKVH+NVN +C+ Q++ YEYYDF+T K   F GRQ DC+ +++Q +I   C C+L  +PV    + LPFC+ ++ +  I+ ++   LN+C++ + + +     +K CH+DLC H +FTTVVSHS YP+V+E+Q  YLWL  L EL++ +++    SDL+   ++  ++ ++N++S+  AI++         L E F++RNFMQ+R+VPSSLFMDHIEET+EY L RLL DIGGCIGLW+GASLIT+FE + L  R  D    Y+ +
Sbjct:   13 KPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTR---QYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNN-----SRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETIN-NRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQMRHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHR 552          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000056126.1 (SMESG000056126.1)

HSP 1 Score: 541.191 bits (1393), Expect = 0.000e+0
Identity = 261/549 (47.54%), Postives = 377/549 (68.67%), Query Frame = 1
Query:  145 QETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKI---VHRNSSDSTNNF--FEGFD-NPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFK 1773
            + +  +Y+  +CKR+ TVL+  SRQST+HSL+HL+QA+N KQ++ W +I  +A  GF INL ++I KY ERPVLTN++HD+ +FV+PDI+ C VNP++F   G+R     K L   F++  K     H  +     +F  ++ +  + D+SD LFIQ  + Y HPAWS I  CVYMQ+ C+W+ FE+RH+WP+GNC TF V       SR   K M+KN WRPDFKI+VYKG++   +F  DPFNN+NTP+G+L+M+HEA+T+PY DEG  VD++TQIDLK TTKVH+NVN +C+ Q++ YEYYDF+T K   F GRQ DC+ +++Q +I   C C+L  +PV    + LPFC+ ++ +  I+ ++   LN+C++ + + +     +K CH+DLC H +FTTVVSHS YP+V+E+Q  YLWL  L EL++ +++    SDL+   ++  ++ ++N++S+  AI++         L E F++RNFMQ+R+VPSSLFMDHIEET+EY L RLL DIGGCIGLW+GASLIT+FE + L  R  D    Y+ +
Sbjct:   21 KPSVSDYLTIMCKRMMTVLIGFSRQSTIHSLSHLAQARNIKQRMFWTIIALSASIGFLINLVNIIEKYYERPVLTNVYHDYRTFVFPDISFCLVNPIHFPPVGTR---QYKQLEHQFAMYFKFRNSTHLKARQEALSFMMYKNYSLDIDLSDYLFIQPEVHYGHPAWSAIFLCVYMQSPCNWTHFEVRHVWPYGNCFTFVVNN-----SRRDVKNMIKNAWRPDFKIIVYKGLTPTTQFSMDPFNNLNTPSGVLVMVHEADTYPYPDEGFIVDSYTQIDLKITTKVHLNVNNKCDMQRLNYEYYDFRTKKSAKFAGRQPDCVFDMIQTQIANRCKCLLQNMPVSKKFKHLPFCLAVEVNETIN-NRDVDLNECIKSSFSFVDQGAINKKCHRDLCSHPSFTTVVSHSKYPAVKERQTQYLWLEKLGELEKLQMRHYNISDLYLKALKPNLVKQYNISSLSQAIKIQNASKNVNFLEESFVDRNFMQIRVVPSSLFMDHIEETLEYTLSRLLGDIGGCIGLWIGASLITVFEFVDLIFRFGDLLSSYRHR 560          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000047581.1 (SMESG000047581.1)

HSP 1 Score: 486.108 bits (1250), Expect = 2.707e-164
Identity = 245/525 (46.67%), Postives = 348/525 (66.29%), Query Frame = 1
Query:  172 GICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTSIK---DAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFL 1737
             I +RL TVL+  SR+ST+H LNHL+QA++ K +L WL I C+A  GF +NL+ LI K+L+ PVLTN+FHD ++F YPD++IC VNP+YF    +R    +   IE +    ++ + +  DS +++       ++SD LF+   ++YSHP+WS II C Y++ +C+++ FE RHIWP+GNC TFN TKM  E +R+VKK  + NGWRPDFK+V+YK + +      DPFN+IN P+G+L+MIHE  T+P+  E   VD+FTQ+DLK TTK H++   +C + +  Y YYDFKT+    FVGRQ DC+ +++Q  I   CGC LH +P+    + LPFC   +        + + L  C+  +++++      + C+KDLCEH +F+TVVSHS YP+VRE+Q H LWL  L +L+  EI+   +S+L    I +      + +S+K    +IR + +     +LNE FIN+NFM +R VPSSLFMDH+EET EYPL RLLSDIGGC+GLWVGASLIT+FE I L L
Sbjct:   48 AIFRRLGTVLLHFSRRSTIHGLNHLAQARSAKHRLFWLTISCSASLGFCVNLFYLIEKFLQTPVLTNVFHDFNNFTYPDLSICIVNPIYFPPENTRYRNELISTIEEYY---RLTNSSFHDSKSSYNANLQKIELSDYLFMHSKLEYSHPSWSAIILCRYLKKKCNYTHFETRHIWPYGNCFTFNGTKMGLEGTRDVKKNTVLNGWRPDFKLVIYKALEYPVNLQIDPFNDINKPSGVLVMIHEPNTYPHIGESFVVDSFTQVDLKITTKSHLSSLKKCESIRNNYTYYDFKTNTSNIFVGRQGDCLFSIIQTNIANYCGCQLHKMPILEKHKQLPFCYDKRF-------RNENLTYCLHASLDDVDREQLRQLCYKDLCEHPSFSTVVSHSKYPAVRERQTHMLWLEHLKDLELLEIEHYGQSELINMAILK------SNSSLKHNYKSIREIYDKGRIDLLNEKFINKNFMHLRFVPSSLFMDHVEETEEYPLSRLLSDIGGCVGLWVGASLITVFEFIDLLL 556          
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Match: SMESG000009914.1 (SMESG000009914.1)

HSP 1 Score: 461.07 bits (1185), Expect = 1.041e-154
Identity = 235/570 (41.23%), Postives = 352/570 (61.75%), Query Frame = 1
Query:  118 PPIQAPNMKQETTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCAALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSGGSRINASVKLLIENFSINDK-IVHRNSSDSTNNFFEGFDNPDISDLLFIQKNIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGERSRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIHEAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKTDKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQHHIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEXXXXXXXXXXXXYPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQ----------IINKFNVTSIKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLVRLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFKSENQQKN 1794
            PP + P       ++    I KRL T+ +  +R+ST+H LNHL+QA++ K++L WL I   A  GF +NL+ L+ K+++ P+LTN FHD++SF+YPDIT C VNP+ F    S     +  +I N+  N++ + H+  + S N  F      ++ D LFI++NI YSH  WS I+ C Y+   C W  F++  +WP+GNC TFN TKM    +R+V++ M  NG+RPDF+I++YK ++ L+    DPFN+I  P+G+L+MIHE ET+P+  +   VD++TQ+DLK TTK H+    +CN  +  Y Y D+++ KCQ+F GR  DC+  ++Q KI  NC C +HT+PV    R  PFC  L     ++VS   ++  C+ + +  +   + H  C++DLC H +++TV+SHS YP+++++Q H LWL  L  +++REI+    S+L    I++           + N+  +    D+I  V     D +++E FI++NFMQ+R VPSSLFMDHIEET EYP+ RLLSDIGGC+GLWVGASLITIFE   L +   D      F +  +  N
Sbjct:    9 PPKRKPKKTFFQQKSPTIIIFKRLGTIFLHFTRRSTIHGLNHLAQARSAKRRLFWLFISTCATVGFFVNLFYLVEKFIQTPILTNTFHDYTSFIYPDITFCLVNPINFPPKTSAQYKYLIGIINNYIRNEESLFHKYINSSKNEDF--LPKLELMDYLFIKENISYSHSPWSAIVDCRYLHYPCSWEHFDVHFVWPYGNCFTFNATKMQKNLTRDVQRNMQLNGFRPDFRIIIYKSINRLSSVVHDPFNDITKPSGVLVMIHEIETYPHVSDSFIVDSYTQVDLKITTKSHLESLKKCNPNRQNYTYCDYRSKKCQTFQGRNIDCVFEIIQNKIAKNCKCQMHTMPVLMKNRFYPFCYSLMLSNPLNVS---SIRKCLNQTIVGVDKQSIHSICYQDLCSHPSYSTVISHSKYPAIQDRQTHSLWLKKLIVIEKREIENYGISNLFQKAIKRNHSTLLRNPNFMENQIPIGKRFDSIDAVYRDMRDDLIDELFIDQNFMQLRFVPSSLFMDHIEETEEYPISRLLSDIGGCVGLWVGASLITIFEFFDLLMDLSDILRIRPFPNSRKDVN 573          
The following BLAST results are available for this feature:
BLAST of Acid-sensing ion channel 1C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ASIC36.137e-631.31acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
del-43.776e-821.02DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
unc-89.282e-837.50Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-89.291e-837.50Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-89.495e-837.50Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-81.171e-737.50Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a1.606e-641.38acid-sensing (proton-gated) ion channel family mem... [more]
asic4a2.551e-641.38acid-sensing (proton-gated) ion channel family mem... [more]
asic4b6.775e-638.71acid-sensing (proton-gated) ion channel family mem... [more]
asic1b7.007e-643.55acid-sensing (proton-gated) ion channel 1b [Source... [more]
asic1b7.960e-637.50acid-sensing (proton-gated) ion channel 1b [Source... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lhx11.551e-723.81LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482][more]
ASIC43.001e-640.58acid sensing ion channel subunit family member 4 [... [more]
ASIC43.357e-638.16acid sensing ion channel subunit family member 4 [... [more]
ASIC44.329e-641.94acid sensing ion channel subunit family member 4 [... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asic54.403e-1020.64acid-sensing (proton-gated) ion channel family mem... [more]
Asic58.551e-1020.75acid-sensing (proton-gated) ion channel family mem... [more]
Scnn1g3.387e-619.95sodium channel, nonvoltage-gated 1 gamma [Source:M... [more]
Asic47.350e-631.87acid-sensing (proton-gated) ion channel family mem... [more]
Asic47.761e-631.87acid-sensing (proton-gated) ion channel family mem... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP3.816e-1623.90FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|Q9R0Y1|ASIC5_MOUSE3.080e-920.64Acid-sensing ion channel 5 OS=Mus musculus OX=1009... [more]
sp|Q95165|SCNNB_CANLF5.600e-825.00Amiloride-sensitive sodium channel subunit beta OS... [more]
sp|F1MJW3|SCNNG_BOVIN1.764e-720.73Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|Q21974|UNC8_CAEEL1.489e-637.50Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 ... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3TJX95.291e-12440.26Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3SIE16.256e-12339.36Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Z6I17.345e-12339.36Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A448WRB31.370e-12138.86Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A183SCX18.563e-11338.91Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asic4a3.153e-638.71acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4b3.362e-640.32acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic1a4.572e-631.43acid-sensing (proton-gated) ion channel 1a [Source... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421371.679e-1622.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374531.564e-830.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345325.650e-820.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361911.009e-730.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376545.792e-729.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic4a9.453e-721.40acid sensing ion channel subunit family member 4 [... [more]
back to top
BLAST of Acid-sensing ion channel 1C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029022.10.000e+0100.00SMESG000029022.1[more]
SMESG000056126.10.000e+047.54SMESG000056126.1[more]
SMESG000056126.10.000e+047.54SMESG000056126.1[more]
SMESG000047581.12.707e-16446.67SMESG000047581.1[more]
SMESG000009914.11.041e-15441.23SMESG000009914.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035055 ID=SMED30035055|Name=Acid-sensing ion channel 1C|organism=Schmidtea mediterranea sexual|type=transcript|length=1925bp
TTACTCATTAAAAGTCAAATGTGGAAAACCGACATGAATGATGAAATGAA
AACGGATGATGAAGATATTTTTGATGAAGTTGACGTTAACAAATCGTTTC
TCAAGAGCGGAAAACTTCCTCCAATTCAAGCTCCAAACATGAAACAAGAA
ACTACCCAAAATTATGTACGAGGCATCTGCAAACGGTTAGCTACGGTGTT
AATGTCAGTTTCAAGGCAAAGCACAGTCCACAGTCTCAATCATTTATCTC
AAGCTAAAAATACAAAACAAAAATTATTATGGTTAATGATAGGATGTGCC
GCATTGTTTGGATTTACGATTAATTTGTACAGTTTAATTTTGAAATATTT
AGAACGTCCAGTTCTTACAAATATCTTCCATGATCATAGCAGTTTCGTCT
ATCCAGATATAACAATTTGCAATGTCAATCCATTATATTTCGGTTCTGGC
GGCTCGAGAATCAACGCCAGTGTTAAATTGTTAATTGAAAACTTTTCTAT
TAATGACAAAATCGTTCACAGGAATTCCAGTGATTCCACTAATAATTTTT
TCGAAGGGTTCGACAATCCTGACATTTCGGATCTTTTGTTTATTCAGAAA
AACATTGATTATAGTCATCCAGCATGGTCTTTGATTATAAAATGTGTTTA
TATGCAAGCCGAATGTCATTGGTCGCAGTTTGAAATCAGACATATTTGGC
CCTTTGGAAACTGCTTGACCTTCAATGTGACAAAAATGCTTGGAGAACGA
AGTCGTAATGTCAAAAAGACCATGTTAAAAAATGGTTGGCGACCAGACTT
TAAAATAGTCGTCTACAAAGGAGTGAGTCATTTAAATAAGTTTGGAAGGG
ATCCATTTAATAATATAAATACCCCAACTGGAATACTAATAATGATACAC
GAAGCTGAAACCTTTCCATATCGAGATGAAGGGATATTTGTTGATGCTTT
TACTCAAATTGATCTAAAAGGAACTACAAAAGTGCATATAAATGTTAATG
GGAGATGCAACACTCAACAAGTGCGATATGAATATTATGATTTTAAAACC
GACAAATGCCAGTCGTTTGTTGGCCGACAAGCTGACTGTATTTCCAATTT
AGTTCAAGAGAAAATTGGAACGAATTGCGGATGTGTACTTCACACCGTTC
CAGTTCCATGTTTTTTGAGAGATCTTCCATTTTGCATTAAATTACAGCAT
CATATAGACATTGATGTCTCCAAAAGAAAGACATTAAATGATTGCATGGA
AAGAAATATGAATAACATGACAAGTCATAACAAACATAAAAATTGTCACA
AGGATCTCTGTGAGCACACGACCTTCACAACCGTGGTATCCCACAGTTCA
TATCCGTCTGTCCGAGAAAAGCAAAATCATTATCTTTGGTTAAATGTCTT
GAATGAACTTCAAAGAAGGGAAATCAAATTTACAAAGAAATCAGATTTAC
ATACGCATGGCATACAACAACAAATTATTAATAAATTCAATGTCACCTCC
ATTAAAGACGCCATTAGACTAGTGAAAAACATTTCTGCCGACAAAATTTT
AAATGAAGACTTCATAAACAGAAATTTCATGCAAGTTAGAATAGTTCCTT
CATCATTGTTTATGGATCATATTGAAGAAACTGTTGAATATCCTTTGGTG
CGACTTCTCAGTGATATCGGCGGATGCATTGGACTATGGGTGGGGGCAAG
TTTGATCACTATATTTGAATTAATTTACCTTTTTCTACGATGTTGTGATG
CATGTTATTTTTACAAATTCAAATCAGAAAATCAACAAAAAAATGTTTTC
AAAGTTAATTTAAACAAAACTGACACTCAATTATTTGATGATCCAAATTC
CATGTTATTTATTAATAATTATGGAAATCTTGAAAGAAATATCTTTAGTC
AATTATCTAATGAAGAATAAATGTG
back to top

protein sequence of SMED30035055-orf-1

>SMED30035055-orf-1 ID=SMED30035055-orf-1|Name=SMED30035055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=640bp
LLIKSQMWKTDMNDEMKTDDEDIFDEVDVNKSFLKSGKLPPIQAPNMKQE
TTQNYVRGICKRLATVLMSVSRQSTVHSLNHLSQAKNTKQKLLWLMIGCA
ALFGFTINLYSLILKYLERPVLTNIFHDHSSFVYPDITICNVNPLYFGSG
GSRINASVKLLIENFSINDKIVHRNSSDSTNNFFEGFDNPDISDLLFIQK
NIDYSHPAWSLIIKCVYMQAECHWSQFEIRHIWPFGNCLTFNVTKMLGER
SRNVKKTMLKNGWRPDFKIVVYKGVSHLNKFGRDPFNNINTPTGILIMIH
EAETFPYRDEGIFVDAFTQIDLKGTTKVHINVNGRCNTQQVRYEYYDFKT
DKCQSFVGRQADCISNLVQEKIGTNCGCVLHTVPVPCFLRDLPFCIKLQH
HIDIDVSKRKTLNDCMERNMNNMTSHNKHKNCHKDLCEHTTFTTVVSHSS
YPSVREKQNHYLWLNVLNELQRREIKFTKKSDLHTHGIQQQIINKFNVTS
IKDAIRLVKNISADKILNEDFINRNFMQVRIVPSSLFMDHIEETVEYPLV
RLLSDIGGCIGLWVGASLITIFELIYLFLRCCDACYFYKFKSENQQKNVF
KVNLNKTDTQLFDDPNSMLFINNYGNLERNIFSQLSNEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 369..386
score: 33.78
coord: 433..453
score: 26.1
coord: 212..223
score: 27.33
coord: 226..242
score: 40.47
coord: 130..146
score: 38.12
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 72..577
e-value: 7.6E-58
score: 196.5
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 65..597
NoneNo IPR availableTMHMMTMhelixcoord: 557..579
NoneNo IPR availableTMHMMTMhelixcoord: 92..114