Presequence protease mitochondrial

Overview
NamePresequence protease mitochondrial
Smed IDSMED30035053
Length (bp)3116
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Presequence protease mitochondrial (SMED30035053) t-SNE clustered cells

Violin plots show distribution of expression levels for Presequence protease mitochondrial (SMED30035053) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Presequence protease mitochondrial (SMED30035053) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Presequence protease mitochondrial (SMED30035053) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035053

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035053h1SMcG0001412 SmedASXL_016860SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30035053h1SMcG0001412 SmedASXL_016860SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035053h1SMcG0001412 dd_Smed_v4_5873_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Presequence protease mitochondrial vs. Ensembl Human
Match: PITRM1 (pitrilysin metallopeptidase 1 [Source:HGNC Symbol;Acc:HGNC:17663])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 390/993 (39.27%), Postives = 592/993 (59.62%), Query Frame = 3
Query:  117 KVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISD----IPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINC-------EESAVTDTL-SLLNTFEQDLIARPY---EQVPMS--------------LDCTMEKNCR-------FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPE 2975
            K+ + + G+ + +   V E  +TA++L H+ T A++ HL R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N SD  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + K++  T +  +  W  P+   I C  D  A +P +Q+++ VSF++ D   ++  FT+ ++S+LL SG NSP Y+ LIESG+G D++ ++ G++   R   F +G+QG+ + D++ V  +I+  +  V+  GF  +RI +L+H+IE+ ++H   +FGL L   ++S  NHD    ++LK    + K +  L ENPK+LQ  VK+Y  +NQH+LT+ M P + + +++  +E   ++   + LS  +R  I EK   L   Q   +D +CLP L++SD    IP+  E      + D         TNG++Y +    L  +   L PY+PLF SV+T +      YRE  Q  E  +GG+ A+ H+  + + +++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    A+GI +S H YA  RA   L+P G L E ++G++Q +LMK +A M++    + I+ KL ++K+ + N + ++ ++N         E AV D L S+  + ++    RP+   + VP S                  ME   +       F++PF VNYV   +R+VPYT  D+A  +IL++L+++K+LH +IRE GGAYGGG  +S  G    YSYRDP++ ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V+   L  V++    +   +    I+GPE
Sbjct:   41 KLGDKIHGFTVNQVTSVPELFLTAVKLTHDDTGARYLHLAREDTNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQNRLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFPLEQHLKQIHEEALSKFQKIEPSTVVPAQTPWDKPREFQITCGPDSFATDPSKQTTISVSFLLPDITDTFEAFTLSLLSSLLTSGPNSPFYKALIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDIETVRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQSTSFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPV-TELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYE-QVGVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKM--TAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDI---KPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPE 1025          
BLAST of Presequence protease mitochondrial vs. Ensembl Human
Match: PITRM1 (pitrilysin metallopeptidase 1 [Source:HGNC Symbol;Acc:HGNC:17663])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 390/993 (39.27%), Postives = 592/993 (59.62%), Query Frame = 3
Query:  117 KVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISD----IPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINC-------EESAVTDTL-SLLNTFEQDLIARPY---EQVPMS--------------LDCTMEKNCR-------FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPE 2975
            K+ + + G+ + +   V E  +TA++L H+ T A++ HL R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N SD  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + K++  T +  +  W  P+   I C  D  A +P +Q+++ VSF++ D   ++  FT+ ++S+LL SG NSP Y+ LIESG+G D++ ++ G++   R   F +G+QG+ + D++ V  +I+  +  V+  GF  +RI +L+H+IE+ ++H   +FGL L   ++S  NHD    ++LK    + K +  L ENPK+LQ  VK+Y  +NQH+LT+ M P + + +++  +E   ++   + LS  +R  I EK   L   Q   +D +CLP L++SD    IP+  E      + D         TNG++Y +    L  +   L PY+PLF SV+T +      YRE  Q  E  +GG+ A+ H+  + + +++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    A+GI +S H YA  RA   L+P G L E ++G++Q +LMK +A M++    + I+ KL ++K+ + N + ++ ++N         E AV D L S+  + ++    RP+   + VP S                  ME   +       F++PF VNYV   +R+VPYT  D+A  +IL++L+++K+LH +IRE GGAYGGG  +S  G    YSYRDP++ ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V+   L  V++    +   +    I+GPE
Sbjct:   41 KLGDKIHGFTVNQVTSVPELFLTAVKLTHDDTGARYLHLAREDTNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQNRLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFPLEQHLKQIHEEALSKFQKIEPSTVVPAQTPWDKPREFQITCGPDSFATDPSKQTTISVSFLLPDITDTFEAFTLSLLSSLLTSGPNSPFYKALIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDIETVRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQSTSFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPV-TELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQ--GVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKM--TAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDI---KPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPE 1024          
BLAST of Presequence protease mitochondrial vs. Ensembl Human
Match: PITRM1 (pitrilysin metallopeptidase 1 [Source:HGNC Symbol;Acc:HGNC:17663])

HSP 1 Score: 463.381 bits (1191), Expect = 1.065e-146
Identity = 260/635 (40.94%), Postives = 382/635 (60.16%), Query Frame = 3
Query:  165 VTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISD----IPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMS-TSNYHYRE-IDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWR 2048
            V E  +TA++L H+ T A++ HL R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N SD  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + K++  T +  +  W  P+   I C  D  A +P +Q+++ VSF++ D   ++  FT+ ++S+LL SG NSP Y+ LIESG+G D++ ++ G++   R   F +G+QG+ + D++ V  +I+  +  V+  GF  +RI +L+H+IE+ ++H   +FGL L   ++S  NHD    ++LK    + K +  L ENPK+LQ  VK+Y  +NQH+LT+ M P + + +++  +E   ++   + LS  +R  I EK   L   Q   +D +CLP L++SD    IP+  E      + D         TNG++Y +    L  +   L PY+PLF SV+T+       H++  +   A+  + G+  + HL         A I  G  L+     + +F  MD  R
Sbjct:   25 VPELFLTAVKLTHDDTGARYLHLAREDTNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQNRLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFPLEQHLKQIHEEALSKFQKIEPSTVVPAQTPWDKPREFQITCGPDSFATDPSKQTTISVSFLLPDITDTFEAFTLSLLSSLLTSGPNSPFYKALIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDIETVRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQSTSFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPV-TELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTNPCFEEEEHFKVLVKMTAQELANGIPDSGHL--------YASIRAGRTLTPAGDLQETFSGMDQVR 649          

HSP 2 Score: 181.415 bits (459), Expect = 4.054e-46
Identity = 121/347 (34.87%), Postives = 196/347 (56.48%), Query Frame = 3
Query: 2040 LWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCE-------ESAVTDTL-SLLNTFEQDLIARPY---EQVPMS--------------LDCTMEKNCR-------FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPE 2975
            L+  ++    F++ +    L+KM  T    A+GI +S H YA  RA   L+P G L E ++G++Q +LMK +A M++    + I+ KL ++K+ + N + ++ ++N         E AV D L S+  + ++    RP+   + VP S                  ME   +       F++PF VNYV   +R+VPYT  D+A  +IL++L+++K+LH +IRE GGAYGGG  +S  G    YSYRDP++ ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V+   L  V++    +   +    I+GPE
Sbjct:  585 LFCSVLTNPCFEEEEHFKVLVKM--TAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDI---KPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPE 926          
BLAST of Presequence protease mitochondrial vs. Ensembl Human
Match: PITRM1 (pitrilysin metallopeptidase 1 [Source:HGNC Symbol;Acc:HGNC:17663])

HSP 1 Score: 298.516 bits (763), Expect = 7.751e-89
Identity = 199/582 (34.19%), Postives = 317/582 (54.47%), Query Frame = 3
Query: 1347 LSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISD----IPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINC-------EESAVTDTL-SLLNTFEQDLIARPY---EQVPMS--------------LDCTMEKNCR-------FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPE 2975
            ++S  NHD    ++LK    + K +  L ENPK+LQ  VK+Y  +NQH+LT+ M P + + +++  +E   ++   + LS  +R  I EK   L   Q   +D +CLP L++SD    IP+  E      + D         TNG++Y +    L  +   L PY+PLF SV+T +      YRE  Q  E  +GG+ A+ H+  + + +++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    A+GI +S H YA  RA   L+P G L E ++G++Q +LMK +A M++    + I+ KL ++K+ + N + ++ ++N         E AV D L S+  + ++    RP+   + VP S                  ME   +       F++PF VNYV   +R+VPYT  D+A  +IL++L+++K+LH +IRE GGAYGGG  +S  G    YSYRDP++ ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V+   L  V++    +   +    I+GPE
Sbjct:    9 IASCWNHDGDPVELLKLGNQLAKFRQCLQENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPV-TELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQ--GVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKM--TAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDI---KPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPE 582          
BLAST of Presequence protease mitochondrial vs. Ensembl Human
Match: PITRM1 (pitrilysin metallopeptidase 1 [Source:HGNC Symbol;Acc:HGNC:17663])

HSP 1 Score: 141.739 bits (356), Expect = 2.563e-37
Identity = 77/227 (33.92%), Postives = 129/227 (56.83%), Query Frame = 3
Query: 1086 LIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISD----IPI---------ECEKYPFKMS 1727
            LIESG+G D++ ++ G++   R   F +G+QG+ + D++ V  +I+  +  V+  GF  +RI +L+H+IE+ ++H   +FGL L   ++S  NHD    ++LK    + K +  L ENPK+LQ  VK+Y  +NQH+LT+ M P + + +++  +E   ++   + LS  +R  I EK   L   Q   +D +CLP L++SD    IP+          CE+Y F  S
Sbjct:    2 LIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDIETVRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQSTSFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPVTELDVVLTGHCERYAFPGS 227          
BLAST of Presequence protease mitochondrial vs. Ensembl Celegans
Match: C05D11.1 (pep chromosome:WBcel235:III:6436608:6439959:1 gene:WBGene00015481.1 transcript:C05D11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C05D11.1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.690e-16
Identity = 58/196 (29.59%), Postives = 93/196 (47.45%), Query Frame = 3
Query:  261 GVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPH--NSGGD-PNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRIND 839
             V F T   +  G+PH LEH V  GS+KYP +     +  R  A   NA T  D T Y  S++ +  +  +L VY++ +  P L+   F  E        +  I+   N  GVVY+EM+   S   + +    ++ + P   P+  ++GG   N     + E+++ +H+K YH SN      G VD + VL  +N+
Sbjct:   45 AVSFVTEADSDDGLPHTLEHLVFMGSKKYPFKGVLDVIANRCLADGTNAWTDTDHTAYTLSTVGSDGFLKVLPVYINHLLTPMLTASQFATE--------VHHITGEGNDAGVVYSEMQDHESEMESIMDRKTKEVIYPPFNPYAVDTGGRLKNLRESCTLEKVRDYHKKFYHLSNMVVTVCGMVDHDQVLEIMNN 232          
BLAST of Presequence protease mitochondrial vs. Ensembl Fly
Match: CG3107 (gene:FBgn0033005 transcript:FBtr0086077)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 359/972 (36.93%), Postives = 567/972 (58.33%), Query Frame = 3
Query:  138 GYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTS-IRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNC-RFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEW-AINEN-ITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL--RNSSDKSSVIIGPEQ---EIESDWQKIVFN 3014
            G++  +  +++EF++T+    +E+T  + +H+ R+D N  F + FRT P +S+G+PHILEH  LCGS+KYPVRDPFFKML RS ATFMNAMT  D+TIYPFS+MN  D+ NL  +YLDAVF+P L+  DF+QEGWRLE +++ D  +   +KGVVYNEMKG FS +       +  N+ P+ TY H SGG+P  IP L+Y  L  FH+K YHPSN++ ++YG  D    L+ ++++YL + S +D   S IR + RWT P+ ++I+ + D M    DRQ+ + ++ ++ D+     +F + V+S +L+ G NSP Y+ LIE      +     G+ S  + TTF +G+Q +   D  K  +I +  ++  + DGF S+ + S++H +EL L+H   NFG  L+   ++  NHD  +   L+  + +  ++  +S+N KY Q  ++KY  +N HRLT+ MSP E ++ +    E  L+E   K L + +   I E+   L   Q+   + + LPCL ++D+  P +  K   +   + R  I +  TN I Y K +F++ G+       +PLF +VI++M T+NY+YRE D+     +GG D  LHL  ++ D  S   S  +++++H L  N  +M  L +++I  ++F D +RL  LI  E   S+ + G+++S H YAM  A+S++   G+L     G++    MK   N  +S+   +I  KL  +   +FNK+ ++ AIN  +S     +S    F + L      Q   ++   ++ +C ++V+   VNY + AL +VPY H D+   R+L+KLLS+KYL   IRE  GAYG G  +S  G   FYSYRDP+ST+TL  F+ + +W   N+N I +Q L E+KL V Q++D PI+ G+ G+ +F+  +S E  +  R R+ +VTI DL+   E+   + S      I+GP     E+E+  + I+ N
Sbjct:   72 GFQCERVEHISEFELTSYTFRYERTGTELWHIDRNDSNNVFSINFRTTPFDSTGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFMNAMTGPDYTIYPFSTMNEIDFRNLQHIYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKGVVYNEMKGAFSENAQVFSQNLLNNIFPDHTYRHVSGGNPLEIPKLAYNDLVEFHKKYYHPSNARIYSYGLFDASKTLALLDEEYLSDQSWVDNSYSLIRQQERWTQPRLVHISSRLDNMGTTIDRQNQIAIALLMCDATNIQESFELHVLSEVLIRGPNSPFYKNLIEPNFSGGY-NQTTGYSSDTKDTTFVVGLQDLRVEDFKKCIEIFDKTIINSMNDGFDSQHVESVLHNLELSLKHQNPNFGNTLLFNSTALWNHDGDVVSNLRVSDMISGLRESISQNKKYFQEKIEKYFANNNHRLTLTMSPDEAYEDKFKQAELELVEQKVKLLDEVKIEKIYERGLILDSYQKAESNTDLLPCLTMNDVRDPPKWPKLFIQNVQNVRTQICKVPTNEITYFKCMFNITGLSHEETQLMPLFCNVISAMGTTNYNYREFDKHILLKTGGFDFKLHLIEDVRD--SKSYSLSVMINTHALNNNVPEMFALCQELIKNVRFDDSERLKMLI--ENYISYISVGVASSGHLYAMLGATSQVCDAGKLKSLLYGVDHIDFMK---NFVHSTSTVDICDKLSTIASKVFNKDNMRGAINTTQSYEPSAISNYEKFLESLPTFGKTQTSRNIH-YLDPSCQQYVMNIPVNYCAKALFTVPYLHQDHPTLRVLAKLLSAKYLLPVIREKNGAYGAGAKISSDGIFSFYSYRDPNSTKTLNAFDETYKWLRANQNVIDQQSLFESKLGVLQQLDTPIAPGNIGIDYFLYEVSQEDFESYRSRMLSVTIDDLQCAIENYFGKESMHYGKCILGPVNANLELETSHKWIINN 1034          
BLAST of Presequence protease mitochondrial vs. Ensembl Fly
Match: CG3107 (gene:FBgn0033005 transcript:FBtr0086078)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 359/972 (36.93%), Postives = 567/972 (58.33%), Query Frame = 3
Query:  138 GYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTS-IRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNC-RFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEW-AINEN-ITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL--RNSSDKSSVIIGPEQ---EIESDWQKIVFN 3014
            G++  +  +++EF++T+    +E+T  + +H+ R+D N  F + FRT P +S+G+PHILEH  LCGS+KYPVRDPFFKML RS ATFMNAMT  D+TIYPFS+MN  D+ NL  +YLDAVF+P L+  DF+QEGWRLE +++ D  +   +KGVVYNEMKG FS +       +  N+ P+ TY H SGG+P  IP L+Y  L  FH+K YHPSN++ ++YG  D    L+ ++++YL + S +D   S IR + RWT P+ ++I+ + D M    DRQ+ + ++ ++ D+     +F + V+S +L+ G NSP Y+ LIE      +     G+ S  + TTF +G+Q +   D  K  +I +  ++  + DGF S+ + S++H +EL L+H   NFG  L+   ++  NHD  +   L+  + +  ++  +S+N KY Q  ++KY  +N HRLT+ MSP E ++ +    E  L+E   K L + +   I E+   L   Q+   + + LPCL ++D+  P +  K   +   + R  I +  TN I Y K +F++ G+       +PLF +VI++M T+NY+YRE D+     +GG D  LHL  ++ D  S   S  +++++H L  N  +M  L +++I  ++F D +RL  LI  E   S+ + G+++S H YAM  A+S++   G+L     G++    MK   N  +S+   +I  KL  +   +FNK+ ++ AIN  +S     +S    F + L      Q   ++   ++ +C ++V+   VNY + AL +VPY H D+   R+L+KLLS+KYL   IRE  GAYG G  +S  G   FYSYRDP+ST+TL  F+ + +W   N+N I +Q L E+KL V Q++D PI+ G+ G+ +F+  +S E  +  R R+ +VTI DL+   E+   + S      I+GP     E+E+  + I+ N
Sbjct:   72 GFQCERVEHISEFELTSYTFRYERTGTELWHIDRNDSNNVFSINFRTTPFDSTGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFMNAMTGPDYTIYPFSTMNEIDFRNLQHIYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKGVVYNEMKGAFSENAQVFSQNLLNNIFPDHTYRHVSGGNPLEIPKLAYNDLVEFHKKYYHPSNARIYSYGLFDASKTLALLDEEYLSDQSWVDNSYSLIRQQERWTQPRLVHISSRLDNMGTTIDRQNQIAIALLMCDATNIQESFELHVLSEVLIRGPNSPFYKNLIEPNFSGGY-NQTTGYSSDTKDTTFVVGLQDLRVEDFKKCIEIFDKTIINSMNDGFDSQHVESVLHNLELSLKHQNPNFGNTLLFNSTALWNHDGDVVSNLRVSDMISGLRESISQNKKYFQEKIEKYFANNNHRLTLTMSPDEAYEDKFKQAELELVEQKVKLLDEVKIEKIYERGLILDSYQKAESNTDLLPCLTMNDVRDPPKWPKLFIQNVQNVRTQICKVPTNEITYFKCMFNITGLSHEETQLMPLFCNVISAMGTTNYNYREFDKHILLKTGGFDFKLHLIEDVRD--SKSYSLSVMINTHALNNNVPEMFALCQELIKNVRFDDSERLKMLI--ENYISYISVGVASSGHLYAMLGATSQVCDAGKLKSLLYGVDHIDFMK---NFVHSTSTVDICDKLSTIASKVFNKDNMRGAINTTQSYEPSAISNYEKFLESLPTFGKTQTSRNIH-YLDPSCQQYVMNIPVNYCAKALFTVPYLHQDHPTLRVLAKLLSAKYLLPVIREKNGAYGAGAKISSDGIFSFYSYRDPNSTKTLNAFDETYKWLRANQNVIDQQSLFESKLGVLQQLDTPIAPGNIGIDYFLYEVSQEDFESYRSRMLSVTIDDLQCAIENYFGKESMHYGKCILGPVNANLELETSHKWIINN 1034          
BLAST of Presequence protease mitochondrial vs. Ensembl Fly
Match: CG3107 (gene:FBgn0033005 transcript:FBtr0345009)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 359/972 (36.93%), Postives = 567/972 (58.33%), Query Frame = 3
Query:  138 GYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTS-IRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNC-RFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEW-AINEN-ITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL--RNSSDKSSVIIGPEQ---EIESDWQKIVFN 3014
            G++  +  +++EF++T+    +E+T  + +H+ R+D N  F + FRT P +S+G+PHILEH  LCGS+KYPVRDPFFKML RS ATFMNAMT  D+TIYPFS+MN  D+ NL  +YLDAVF+P L+  DF+QEGWRLE +++ D  +   +KGVVYNEMKG FS +       +  N+ P+ TY H SGG+P  IP L+Y  L  FH+K YHPSN++ ++YG  D    L+ ++++YL + S +D   S IR + RWT P+ ++I+ + D M    DRQ+ + ++ ++ D+     +F + V+S +L+ G NSP Y+ LIE      +     G+ S  + TTF +G+Q +   D  K  +I +  ++  + DGF S+ + S++H +EL L+H   NFG  L+   ++  NHD  +   L+  + +  ++  +S+N KY Q  ++KY  +N HRLT+ MSP E ++ +    E  L+E   K L + +   I E+   L   Q+   + + LPCL ++D+  P +  K   +   + R  I +  TN I Y K +F++ G+       +PLF +VI++M T+NY+YRE D+     +GG D  LHL  ++ D  S   S  +++++H L  N  +M  L +++I  ++F D +RL  LI  E   S+ + G+++S H YAM  A+S++   G+L     G++    MK   N  +S+   +I  KL  +   +FNK+ ++ AIN  +S     +S    F + L      Q   ++   ++ +C ++V+   VNY + AL +VPY H D+   R+L+KLLS+KYL   IRE  GAYG G  +S  G   FYSYRDP+ST+TL  F+ + +W   N+N I +Q L E+KL V Q++D PI+ G+ G+ +F+  +S E  +  R R+ +VTI DL+   E+   + S      I+GP     E+E+  + I+ N
Sbjct:   72 GFQCERVEHISEFELTSYTFRYERTGTELWHIDRNDSNNVFSINFRTTPFDSTGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFMNAMTGPDYTIYPFSTMNEIDFRNLQHIYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKGVVYNEMKGAFSENAQVFSQNLLNNIFPDHTYRHVSGGNPLEIPKLAYNDLVEFHKKYYHPSNARIYSYGLFDASKTLALLDEEYLSDQSWVDNSYSLIRQQERWTQPRLVHISSRLDNMGTTIDRQNQIAIALLMCDATNIQESFELHVLSEVLIRGPNSPFYKNLIEPNFSGGY-NQTTGYSSDTKDTTFVVGLQDLRVEDFKKCIEIFDKTIINSMNDGFDSQHVESVLHNLELSLKHQNPNFGNTLLFNSTALWNHDGDVVSNLRVSDMISGLRESISQNKKYFQEKIEKYFANNNHRLTLTMSPDEAYEDKFKQAELELVEQKVKLLDEVKIEKIYERGLILDSYQKAESNTDLLPCLTMNDVRDPPKWPKLFIQNVQNVRTQICKVPTNEITYFKCMFNITGLSHEETQLMPLFCNVISAMGTTNYNYREFDKHILLKTGGFDFKLHLIEDVRD--SKSYSLSVMINTHALNNNVPEMFALCQELIKNVRFDDSERLKMLI--ENYISYISVGVASSGHLYAMLGATSQVCDAGKLKSLLYGVDHIDFMK---NFVHSTSTVDICDKLSTIASKVFNKDNMRGAINTTQSYEPSAISNYEKFLESLPTFGKTQTSRNIH-YLDPSCQQYVMNIPVNYCAKALFTVPYLHQDHPTLRVLAKLLSAKYLLPVIREKNGAYGAGAKISSDGIFSFYSYRDPNSTKTLNAFDETYKWLRANQNVIDQQSLFESKLGVLQQLDTPIAPGNIGIDYFLYEVSQEDFESYRSRMLSVTIDDLQCAIENYFGKESMHYGKCILGPVNANLELETSHKWIINN 1034          
BLAST of Presequence protease mitochondrial vs. Ensembl Fly
Match: CG3107 (gene:FBgn0033005 transcript:FBtr0111280)

HSP 1 Score: 621.313 bits (1601), Expect = 0.000e+0
Identity = 359/972 (36.93%), Postives = 567/972 (58.33%), Query Frame = 3
Query:  138 GYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTS-IRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNC-RFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEW-AINEN-ITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL--RNSSDKSSVIIGPEQ---EIESDWQKIVFN 3014
            G++  +  +++EF++T+    +E+T  + +H+ R+D N  F + FRT P +S+G+PHILEH  LCGS+KYPVRDPFFKML RS ATFMNAMT  D+TIYPFS+MN  D+ NL  +YLDAVF+P L+  DF+QEGWRLE +++ D  +   +KGVVYNEMKG FS +       +  N+ P+ TY H SGG+P  IP L+Y  L  FH+K YHPSN++ ++YG  D    L+ ++++YL + S +D   S IR + RWT P+ ++I+ + D M    DRQ+ + ++ ++ D+     +F + V+S +L+ G NSP Y+ LIE      +     G+ S  + TTF +G+Q +   D  K  +I +  ++  + DGF S+ + S++H +EL L+H   NFG  L+   ++  NHD  +   L+  + +  ++  +S+N KY Q  ++KY  +N HRLT+ MSP E ++ +    E  L+E   K L + +   I E+   L   Q+   + + LPCL ++D+  P +  K   +   + R  I +  TN I Y K +F++ G+       +PLF +VI++M T+NY+YRE D+     +GG D  LHL  ++ D  S   S  +++++H L  N  +M  L +++I  ++F D +RL  LI  E   S+ + G+++S H YAM  A+S++   G+L     G++    MK   N  +S+   +I  KL  +   +FNK+ ++ AIN  +S     +S    F + L      Q   ++   ++ +C ++V+   VNY + AL +VPY H D+   R+L+KLLS+KYL   IRE  GAYG G  +S  G   FYSYRDP+ST+TL  F+ + +W   N+N I +Q L E+KL V Q++D PI+ G+ G+ +F+  +S E  +  R R+ +VTI DL+   E+   + S      I+GP     E+E+  + I+ N
Sbjct:   72 GFQCERVEHISEFELTSYTFRYERTGTELWHIDRNDSNNVFSINFRTTPFDSTGLPHILEHLSLCGSQKYPVRDPFFKMLNRSVATFMNAMTGPDYTIYPFSTMNEIDFRNLQHIYLDAVFRPNLAYFDFLQEGWRLENKDIFDKQSKLVIKGVVYNEMKGAFSENAQVFSQNLLNNIFPDHTYRHVSGGNPLEIPKLAYNDLVEFHKKYYHPSNARIYSYGLFDASKTLALLDEEYLSDQSWVDNSYSLIRQQERWTQPRLVHISSRLDNMGTTIDRQNQIAIALLMCDATNIQESFELHVLSEVLIRGPNSPFYKNLIEPNFSGGY-NQTTGYSSDTKDTTFVVGLQDLRVEDFKKCIEIFDKTIINSMNDGFDSQHVESVLHNLELSLKHQNPNFGNTLLFNSTALWNHDGDVVSNLRVSDMISGLRESISQNKKYFQEKIEKYFANNNHRLTLTMSPDEAYEDKFKQAELELVEQKVKLLDEVKIEKIYERGLILDSYQKAESNTDLLPCLTMNDVRDPPKWPKLFIQNVQNVRTQICKVPTNEITYFKCMFNITGLSHEETQLMPLFCNVISAMGTTNYNYREFDKHILLKTGGFDFKLHLIEDVRD--SKSYSLSVMINTHALNNNVPEMFALCQELIKNVRFDDSERLKMLI--ENYISYISVGVASSGHLYAMLGATSQVCDAGKLKSLLYGVDHIDFMK---NFVHSTSTVDICDKLSTIASKVFNKDNMRGAINTTQSYEPSAISNYEKFLESLPTFGKTQTSRNIH-YLDPSCQQYVMNIPVNYCAKALFTVPYLHQDHPTLRVLAKLLSAKYLLPVIREKNGAYGAGAKISSDGIFSFYSYRDPNSTKTLNAFDETYKWLRANQNVIDQQSLFESKLGVLQQLDTPIAPGNIGIDYFLYEVSQEDFESYRSRMLSVTIDDLQCAIENYFGKESMHYGKCILGPVNANLELETSHKWIINN 1034          
BLAST of Presequence protease mitochondrial vs. Ensembl Zebrafish
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:406808])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 392/969 (40.45%), Postives = 590/969 (60.89%), Query Frame = 3
Query:  165 VTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTME--------------------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            V +  +TA++L H+ T A++ H  RDD N  F VQFRT P +S+GVPHILEHTVLCGS+++P RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N +D S+    KGVV+NEMKGVFS++       ++  LLP+ TY   SGG+P AIP L++EQLK FH   YHPSN++FFTYGD+ LE  L +I ++ L  + + + +T++  +  W  P+  +++C+ D +A +P +Q+++ +SF++ D   ++  FT+ ++S+L++SG NSP Y+ LIE  IG D++ +  GFD S R  +F +G+QG+ + D + V+ II   +  +I  GF  E+I +L+H+IE+ ++H   +FGL L   ++S  NHD     +LK  E V + +  L ENP+YLQ  V+ Y  +N H+LT+ MSP E F +++   E+  ++   + LS+ +R  I EK   LL  Q TT+D +CLP L++SDI       P ++ +     +   E  TNG++Y + + ++  +   L  Y+PLF SVIT M +    YR+  Q  E  +GGL  +  +  +  DL+  +   G++LSS CL  N   M  LW D+    +F D +RL  L+ M  +    ++GIS S H YAM RA+  L+P   L E ++G++Q K +K +A M++ +   +++ KL ++K  +FN   ++ A+N     + D  + +  F  ++     E+ P+                           K C+    F LPF VN+VS  +R+VP+TH+DYA   IL +++++K+LH +IRE GGAYGGG  +  G L  FYSYRDP+ST+TL  F   +EWA     T+Q ++EAKLSVF  +D P++   KGL  F+ GI+DE++Q  RERLF VT ++L +VA        ++    I+GPE E
Sbjct:   52 VPDLFLTAVKLSHDATGAQYLHAARDDSNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQRFPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFKNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPTDPSSPLVFKGVVFNEMKGVFSDNERLYAQHLQNKLLPDHTYSVVSGGEPLAIPELTWEQLKHFHATHYHPSNARFFTYGDLPLEQHLQQIEEEALSKFERTEPNTAVPPQTPWDKPRMDHVSCRPDALAPDPVKQNTLCMSFLLGDITDTFEMFTLSLLSSLMMSGPNSPFYKALIEPKIGSDFSSS-AGFDGSTRQASFTIGLQGMAEDDTETVKHIIAQTIDDIIASGFEEEQIEALLHKIEIQMKHQSTSFGLALASYIASLWNHDGDPVQLLKISESVSRFRQCLKENPRYLQEKVQHYFKNNTHQLTLSMSPDERFLEKQAEAEEQKLQQKIQILSNEDRKDIYEKGLQLLAVQSTTQDASCLPALKVSDIEPIIPYTPVQLGAADGVPVQYCEQPTNGMVYFRAMSNINSLPEDLKIYVPLFCSVITKMGSGMLDYRQQAQRIELKTGGLSVSPQIIPDTEDLDLYE--QGIILSSSCLERNLPDMFQLWSDLFNSPRFDDEERLRVLVMM--SAQELSNGISYSGHMYAMTRAARSLTPTADLQESFSGMDQVKFLKRIAEMTDLT---SVLRKLPRIKRHLFNPENMRCALNATPQKMPDVAAEVERFIGNIAGNRKERKPVRPSVVERALGPEAGAAATRKLISEAHFKPCQMKTYFQLPFNVNFVSECVRTVPFTHADYASLCILGRMMTAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNSTQTLSAFRGGVEWARAGKFTQQDIDEAKLSVFSAVDAPVAPSDKGLGRFLNGITDEMKQAHRERLFAVTERNLIDVAGRYLGIGQQTCGVAILGPENE 1012          
BLAST of Presequence protease mitochondrial vs. Ensembl Zebrafish
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:406808])

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 399/999 (39.94%), Postives = 601/999 (60.16%), Query Frame = 3
Query:   81 RSKMMHSQLKNLK--VDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTME--------------------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            RS+   +  K LK  V   +  + + +   V +  +TA++L H+ T A++ H  RDD N  F V FRT P +S+GVPHILEHTVLCGS+++P RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N +D S+    KGVV+NEMKGVFS++       ++  LLP+ TY   SGG+P AIP L++EQLK FH   YHPSN++FFTYGD+ LE  L +I ++ L  + + + +T++  +  W  P+  +++C+ D +A +P +Q+++ +SF++ D   ++  FT+ ++S+L++SG NSP Y+ LIE  IG D++ +  GFD S R  +F +G+QG+ + D + V+ II   +  +I  GF  E+I +L+H+IE+ ++H   +FGL L   ++S  NHD     +LK  E V + +  L ENP+YLQ  V+ Y  +N H+LT+ MSP E F +++   E+  ++   + LSD +R  I EK   LL  Q TT+D +CLP L++SDI       P ++ +     +   E  TNG++Y + + ++  +   L  Y+PLF SVIT M +    YR+  Q  E  +GGL  +  +  +  DL+  +   G++LSS CL  N   M  LW D+    +F D +RL  L+ M  +    ++GIS S H YAM RA+  L+P   L E ++G++Q K MK +A M++ +   +++ KL ++K  +FN   ++ A+N     + D  + +  F  ++     E+ P+                           K C+    F LPF VN+VS  +R+VP+TH+DYA   IL +++++K+LH +IRE GGAYGGG  +  G L  FYSYRDP+ST+TL  F   +EWA     T+Q ++EAKLSVF  +D P++   KGL  F+ GI+DE++Q  RERLF VT ++L +VA        ++    I+GPE E
Sbjct:   22 RSRGSSAVEKALKYTVGQKIHNFTVKEVTAVPDLFLTAVKLSHDATGAQYLHAARDDSNNLFSVLFRTTPMDSTGVPHILEHTVLCGSQRFPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFKNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPTDPSSPLVFKGVVFNEMKGVFSDNERLYAQHLQNKLLPDHTYSVVSGGEPLAIPELTWEQLKHFHATHYHPSNARFFTYGDLPLEQHLQQIEEEALSKFERTEPNTAVPPQTPWDKPRMDHVSCRPDALAPDPVKQNTLCMSFLLGDITDTFEMFTLSLLSSLMMSGPNSPFYKALIEPKIGSDFSSS-AGFDGSTRQASFTIGLQGMAEDDTETVKHIIAQTIDDIIASGFEEEQIEALLHKIEIQMKHQSTSFGLALASYIASLWNHDGDPVQLLKISESVSRFRQCLKENPRYLQEKVQHYFKNNTHQLTLSMSPDERFLEKQAEAEEQKLQQKIQILSDEDRKDIYEKGLQLLAVQSTTQDASCLPALKVSDIEPIIPYTPVQLGAAGGVPVQYCEQPTNGMVYFRAMSNINSLPEDLKIYVPLFCSVITKMGSGMLDYRQQAQRIELKTGGLSVSPQIIPDTEDLDLYE--QGIVLSSSCLERNLPDMFQLWSDLFNSPRFDDEERLRVLVMM--SAQELSNGISYSGHMYAMTRAARSLTPTADLQESFSGMDQVKFMKRIAEMTDLT---SVLRKLPRIKRHLFNPENMRCALNATPQKMPDVAAEVERFIGNIAGNRKERKPVRPSVVERALGPEAGAAATRKLISEAHFKPCQMKTYFQLPFNVNFVSECVRTVPFTHADYASLCILGRMMTAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNSTQTLSAFRGGVEWARAGKFTQQDIDEAKLSVFSAVDAPVAPSDKGLGRFLNGITDEMKQAHRERLFAVTERNLIDVAGRYLGIGQQTCGVAILGPENE 1012          
BLAST of Presequence protease mitochondrial vs. Ensembl Xenopus
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:734137])

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 390/974 (40.04%), Postives = 598/974 (61.40%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKET-FDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPY---EQVPMSLDCTME----KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C TD  A++P++Q++V V+F++ +   ++  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  V   G  +ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   +QHR+T+ MSP E  +DKE     + L + + K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+  + ++L++ +   G++ SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RA   L+P G L E ++G++Q K++K +A M        I+ KL ++++ +   + ++ ++N     +      +  F        ++    RP+   + + + + C ++    K C+    F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   T+Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE+LF VT  DL   +     +    + + I+GPE
Sbjct:   43 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKQFHATHYHPSNARFFTYGNLPLEIHLKQIHEDALSKFERIDPKTSVPPQERWQSPREYSISCGTDSFASDPEKQTTVSVNFLLSEITDTFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKAIINKTINEVAEHGIEAERIEALLHKLEIQMKHQSTSFGLTLASYVASCWNHEGDPVDLLKIGDKISRFRECLKENPKFLQDKVKQYFQVSQHRMTLSMSPDEQHYDKEAQLEAEKLTQKV-KALSEEERKQIYEKGLELIRLQSKPQDASCLPALKVSDIEPKIPLTDLDITYAGDVPVQYCAQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHIITDDSNLDTYEQ--GVVFSSLCLDRNLPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRAGRTLTPAGELQELFSGMDQVKMIKRIAEMPEMG---PILRKLSRIRKYVLLSDNMRCSVNATPQQMPAASKEIEHFLAGISRSKKERKSIRPHVVEQPIILIIVCVLQDPTFKPCQMKTHFSLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKAADWAKSGQFTQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQKHREQLFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 1007          
BLAST of Presequence protease mitochondrial vs. Ensembl Xenopus
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:734137])

HSP 1 Score: 699.123 bits (1803), Expect = 0.000e+0
Identity = 388/974 (39.84%), Postives = 591/974 (60.68%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPY------------EQVPMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C TD  A++P++Q++V V+F++ +   ++  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  V   G  +ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   +QHR+T+ MSP E    ++  LE   +    K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+  + ++L++ +   G++ SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RA   L+P G L E ++G++Q K++K +A M        I+ KL ++++ +   + ++ ++N     +      +  F        ++    RP+             + P    C M+ +  F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   T+Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE+LF VT  DL   +     +    + + I+GPE
Sbjct:   22 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKQFHATHYHPSNARFFTYGNLPLEIHLKQIHEDALSKFERIDPKTSVPPQERWQSPREYSISCGTDSFASDPEKQTTVSVNFLLSEITDTFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKAIINKTINEVAEHGIEAERIEALLHKLEIQMKHQSTSFGLTLASYVASCWNHEGDPVDLLKIGDKISRFRECLKENPKFLQDKVKQYFQVSQHRMTLSMSPDEQHYDKEAQLEAEKLTQKVKALSEEERKQIYEKGLELIRLQSKPQDASCLPALKVSDIEPKIPLTDLDITYAGDVPVQYCAQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHIITDDSNLDTYEQ--GVVFSSLCLDRNLPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRAGRTLTPAGELQELFSGMDQVKMIKRIAEMPEMG---PILRKLSRIRKYVLLSDNMRCSVNATPQQMPAASKEIEHFLAGISRSKKERKSIRPHVVEFYYGHSWVPHKDPTFKPCQMKTH--FSLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKAADWAKSGQFTQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQKHREQLFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 985          
BLAST of Presequence protease mitochondrial vs. Ensembl Xenopus
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:734137])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 392/976 (40.16%), Postives = 596/976 (61.07%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKET-FDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPY--EQVPMSLDCTME-------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C TD  A++P++Q++V V+F++ +   ++  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  V   G  +ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   +QHR+T+ MSP E  +DKE     + L + + K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+  + ++L++ +   G++ SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RA   L+P G L E ++G++Q K++K +A M        I+ KL ++++ +   + ++ ++N     +      +  F        ++    RP+  E   +S   T +       K C+    F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   T+Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE+LF VT  DL   +     +    + + I+GPE
Sbjct:   34 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKQFHATHYHPSNARFFTYGNLPLEIHLKQIHEDALSKFERIDPKTSVPPQERWQSPREYSISCGTDSFASDPEKQTTVSVNFLLSEITDTFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKAIINKTINEVAEHGIEAERIEALLHKLEIQMKHQSTSFGLTLASYVASCWNHEGDPVDLLKIGDKISRFRECLKENPKFLQDKVKQYFQVSQHRMTLSMSPDEQHYDKEAQLEAEKLTQKV-KALSEEERKQIYEKGLELIRLQSKPQDASCLPALKVSDIEPKIPLTDLDITYAGDVPVQYCAQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHIITDDSNLDTYEQ--GVVFSSLCLDRNLPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRAGRTLTPAGELQELFSGMDQVKMIKRIAEMPEMG---PILRKLSRIRKYVLLSDNMRCSVNATPQQMPAASKEIEHFLAGISRSKKERKSIRPHVVEVHEISRRATRKLVGDPTFKPCQMKTHFSLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKAADWAKSGQFTQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQKHREQLFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 1000          
BLAST of Presequence protease mitochondrial vs. Ensembl Xenopus
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:734137])

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 391/978 (39.98%), Postives = 594/978 (60.74%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKET-FDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPYE---------------QVPMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C TD  A++P++Q++V V+F++ +   ++  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  V   G  +ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   +QHR+T+ MSP E  +DKE     + L + + K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+  + ++L++ +   G++ SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RA   L+P G L E ++G++Q K++K +A M        I+ KL ++++ +   + ++ ++N     +      +  F        ++    RP+                Q P    C M+ +  F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   T+Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE+LF VT  DL   +     +    + + I+GPE
Sbjct:   40 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKQFHATHYHPSNARFFTYGNLPLEIHLKQIHEDALSKFERIDPKTSVPPQERWQSPREYSISCGTDSFASDPEKQTTVSVNFLLSEITDTFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKAIINKTINEVAEHGIEAERIEALLHKLEIQMKHQSTSFGLTLY--VASCWNHEGDPVDLLKIGDKISRFRECLKENPKFLQDKVKQYFQVSQHRMTLSMSPDEQHYDKEAQLEAEKLTQKV-KALSEEERKQIYEKGLELIRLQSKPQDASCLPALKVSDIEPKIPLTDLDITYAGDVPVQYCAQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHIITDDSNLDTYEQ--GVVFSSLCLDRNLPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRAGRTLTPAGELQELFSGMDQVKMIKRIAEMPEMG---PILRKLSRIRKYVLLSDNMRCSVNATPQQMPAASKEIEHFLAGISRSKKERKSIRPHVVEVHSDSVLIIVCVLQDPTFKPCQMKTH--FSLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKAADWAKSGQFTQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQKHREQLFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 1004          
BLAST of Presequence protease mitochondrial vs. Ensembl Xenopus
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:734137])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 392/982 (39.92%), Postives = 595/982 (60.59%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKET-FDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPY--EQVPMSLDCTME-------------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C TD  A++P++Q++V V+F++ +   ++  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  V   G  +ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   +QHR+T+ MSP E  +DKE     + L + + K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+  + ++L++ +   G++ SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RA   L+P G L E ++G++Q K++K +A M        I+ KL ++++ +   + ++ ++N     +      +  F        ++    RP+  E  P S    +              K C+    F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   T+Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE+LF VT  DL   +     +    + + I+GPE
Sbjct:   44 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKQFHATHYHPSNARFFTYGNLPLEIHLKQIHEDALSKFERIDPKTSVPPQERWQSPREYSISCGTDSFASDPEKQTTVSVNFLLSEITDTFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKAIINKTINEVAEHGIEAERIEALLHKLEIQMKHQSTSFGLTLASYVASCWNHEGDPVDLLKIGDKISRFRECLKENPKFLQDKVKQYFQVSQHRMTLSMSPDEQHYDKEAQLEAEKLTQKV-KALSEEERKQIYEKGLELIRLQSKPQDASCLPALKVSDIEPKIPLTDLDITYAGDVPVQYCAQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHIITDDSNLDTYEQ--GVVFSSLCLDRNLPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRAGRTLTPAGELQELFSGMDQVKMIKRIAEMPEMG---PILRKLSRIRKYVLLSDNMRCSVNATPQQMPAASKEIEHFLAGISRSKKERKSIRPHVVEVHPSSSGSEISRRATRKLVGDPTFKPCQMKTHFSLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKAADWAKSGQFTQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQKHREQLFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 1016          
BLAST of Presequence protease mitochondrial vs. Ensembl Mouse
Match: Pitrm1 (pitrilysin metallepetidase 1 [Source:MGI Symbol;Acc:MGI:1916867])

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 383/996 (38.45%), Postives = 582/996 (58.43%), Query Frame = 3
Query:  117 KVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFK------MSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDL---------------------------------IARPYEQVPMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLR--NSSDKSSVIIGPE 2975
            KV   + G+ + +   V E  +TA++L H+ T A++ HL R+D+N  F VQFRT P +S+GVPH+LEHTVLCGS+KYP RDPFFKML RS +TFMNAMTA+D+TIYPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N  D  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + +L+  T++  +P W  P+  +I C  D +A    +Q++V VSF++ D   ++  FT+ ++S+LL++G NSP Y+ LIESG+G D++ ++ G++   R   F +G+QG+ + D+  V ++++  +  VI  GF  +RI +L+H+IE+  +H  A+FGL L   ++S  NHD    ++L+    + + +  L ENPK+LQ  V++Y  +NQH+LT+ M P + + +++  +E   +E     LS  ++  I EK   L   Q   +D +CLP L++SDI       PF        + D         TNG++Y +    L  +   L P +PLF SV+T +     +YRE  Q  E  +GG+    H+  + + L++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    ++GIS+S H YA  RAS  L+P G L E ++G++Q K+MK +A M++    + I+ KL ++K+ + N + ++ ++N     +      +  F +++                                 I R     P    C M+ +  FVLPF VNY+   +R+VPY   D+A  +IL++L+++K+LH +IRE GGAYGGG  ++  G    YSYRDP+S ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V    L  V+        S     I+GPE
Sbjct:   41 KVGEKIHGFTVNQVTPVPELFLTAVKLSHDNTGARYLHLAREDKNNLFSVQFRTTPMDSTGVPHVLEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAMTASDYTIYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPRDPQTPLIFKGVVFNEMKGAFTDNERIFSQHLQNKLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFQLEGHLKQIHEEALSKFQRLEQSTAVPAQPHWDKPREFHITCGPDSLATETAKQTTVSVSFLLPDITDTFEAFTLSLLSSLLIAGPNSPFYKALIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDVKTVRELVDRTIEEVIEKGFEDDRIEALLHKIEIQTKHQSASFGLTLTSYIASCWNHDGDPVELLQIGSQLTRFRKCLKENPKFLQEKVEQYFKNNQHKLTLSMKPDDKYYEKQTQMETEKLEQKVNSLSPADKQQIYEKGLELQTQQSKHQDASCLPALKVSDIE---PSMPFTKLDIGLAAGDIPVQYCPQPTNGMVYFRAFSSLNTLPEDLRPIVPLFCSVLTKLGCGILNYREQAQQIELKTGGMSVTPHVLPDDSQLDTYEQ--GVLFSSLCLERNLPDMMHLWSEIFNNPCFEEEEHFKVLVKM--TAQELSNGISDSGHLYAALRASKTLTPSGDLQETFSGMDQVKVMKRIAEMTDI---KPILRKLPRIKKYLLNCDNMRCSVNATPQQMPQAEKEVENFLRNVGRSKKERKPVRPHIVEKPTPSGPSGAAHVSGSQIVRKLVTDPTFKPCQMKTH--FVLPFPVNYIGECVRTVPYADPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLTHSGIFTLYSYRDPNSIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDSPVAPSDKGMDHFLYGLSDEMKQAYREQLFAVNHDKLTSVSHKYLGIGKSTHGLAILGPE 1023          
BLAST of Presequence protease mitochondrial vs. Ensembl Mouse
Match: Pitrm1 (pitrilysin metallepetidase 1 [Source:MGI Symbol;Acc:MGI:1916867])

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 373/996 (37.45%), Postives = 560/996 (56.22%), Query Frame = 3
Query:  117 KVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFK------MSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDL---------------------------------IARPYEQVPMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLR--NSSDKSSVIIGPE 2975
            KV   + G+ + +   V E  +TA++L H+ T A++ HL R+D+N  F VQFRT P +S+GVPH+LEHTVLCGS+KYP RDPFFKML RS +TFMNAMTA+D+TIYPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N  D  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + +L+  T++  +P W  P+  +I C  D +A    +Q++V VSF++ D   ++  FT+ ++S+LL++G NSP Y+ LIESG+G D++ +                                       +  GF  +RI +L+H+IE+  +H  A+FGL L   ++S  NHD    ++L+    + + +  L ENPK+LQ  V++Y  +NQH+LT+ M P + + +++  +E   +E     LS  ++  I EK   L   Q   +D +CLP L++SDI       PF        + D         TNG++Y +    L  +   L P +PLF SV+T +     +YRE  Q  E  +GG+    H+  + + L++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    ++GIS+S H YA  RAS  L+P G L E ++G++Q K+MK +A M++    + I+ KL ++K+ + N + ++ ++N     +      +  F +++                                 I R     P    C M+ +  FVLPF VNY+   +R+VPY   D+A  +IL++L+++K+LH +IRE GGAYGGG  ++  G    YSYRDP+S ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V    L  V+        S     I+GPE
Sbjct:   40 KVGEKIHGFTVNQVTPVPELFLTAVKLSHDNTGARYLHLAREDKNNLFSVQFRTTPMDSTGVPHVLEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAMTASDYTIYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPRDPQTPLIFKGVVFNEMKGAFTDNERIFSQHLQNKLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFQLEGHLKQIHEEALSKFQRLEQSTAVPAQPHWDKPREFHITCGPDSLATETAKQTTVSVSFLLPDITDTFEAFTLSLLSSLLIAGPNSPFYKALIESGLGTDFSPD---------------------------------------VGKGFEDDRIEALLHKIEIQTKHQSASFGLTLTSYIASCWNHDGDPVELLQIGSQLTRFRKCLKENPKFLQEKVEQYFKNNQHKLTLSMKPDDKYYEKQTQMETEKLEQKVNSLSPADKQQIYEKGLELQTQQSKHQDASCLPALKVSDIE---PSMPFTKLDIGLAAGDIPVQYCPQPTNGMVYFRAFSSLNTLPEDLRPIVPLFCSVLTKLGCGILNYREQAQQIELKTGGMSVTPHVLPDDSQLDTYEQ--GVLFSSLCLERNLPDMMHLWSEIFNNPCFEEEEHFKVLVKM--TAQELSNGISDSGHLYAALRASKTLTPSGDLQETFSGMDQVKVMKRIAEMTDI---KPILRKLPRIKKYLLNCDNMRCSVNATPQQMPQAEKEVENFLRNVGRSKKERKPVRPHIVEKPTPSGPSGAAHVSGSQIVRKLVTDPTFKPCQMKTH--FVLPFPVNYIGECVRTVPYADPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLTHSGIFTLYSYRDPNSIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDSPVAPSDKGMDHFLYGLSDEMKQAYREQLFAVNHDKLTSVSHKYLGIGKSTHGLAILGPE 984          
BLAST of Presequence protease mitochondrial vs. UniProt/SwissProt
Match: sp|Q28BR5|PREP_XENTR (Presequence protease, mitochondrial OS=Xenopus tropicalis OX=8364 GN=pitrm1 PE=2 SV=1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 391/986 (39.66%), Postives = 595/986 (60.34%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKET-FDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDI--PIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPY--EQV---------------------PMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C TD  A++P++Q++V V+F++ +   ++  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  V   G  +ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   +QHR+T+ MSP E  +DKE     + L + + K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+  + ++L++ +   G++ SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RA   L+P G L E ++G++Q K++K +A M        I+ KL ++++ +   + ++ ++N     +      +  F        ++    RP+  E+                      P    C M+ +  F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   T+Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE+LF VT  DL   +     +    + + I+GPE
Sbjct:   40 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKQFHATHYHPSNARFFTYGNLPLEIHLKQIHEDALSKFERIDPKTSVPPQERWQSPREYSISCGTDSFASDPEKQTTVSVNFLLSEITDTFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKAIINKTINEVAEHGIEAERIEALLHKLEIQMKHQSTSFGLTLASYVASCWNHEGDPVDLLKIGDKISRFRECLKENPKFLQDKVKQYFQVSQHRMTLSMSPDEQHYDKEAQLEAEKLTQKV-KALSEEERKQIYEKGLELIRLQSKPQDASCLPALKVSDIEPKIPLTDLDITYAGDVPVQYCAQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHIITDDSNLDTYEQ--GVVFSSLCLDRNLPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRAGRTLTPAGELQELFSGMDQVKMIKRIAEMPEMG---PILRKLSRIRKYVLLSDNMRCSVNATPQQMPVASKEIEHFLAGISRSKKERKSIRPHVVEKSSSPSSSGSEISRRATRKLVGDPTFKPCQMKTH--FSLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKAADWAKSGQFTQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQKHREQLFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 1014          
BLAST of Presequence protease mitochondrial vs. UniProt/SwissProt
Match: sp|Q6PF24|PREP_XENLA (Presequence protease, mitochondrial OS=Xenopus laevis OX=8355 GN=pitrm1 PE=2 SV=1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 393/986 (39.86%), Postives = 590/986 (59.84%), Query Frame = 3
Query:  132 LKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIP--IECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADI-SCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTF--------EQDLIARPY--EQV---------------------PMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSD--KSSVIIGPE 2975
            + G+ + +   V E  +TA++L H+ T AK+ H+ R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N  D ++    KG+V+NEMKG F+++       ++  LLP+ TY   SGG+P  IP L++EQLK FH   YHPSN++FFTYG++ LE  L +I++D L  + ++D  TS+  + RW SP+  +I+C  D  A++P++Q+ V V+F++ +   S+  FT+ ++S+L++ G NSP Y+ LIE+ +G D++ +  GF++  R T F +G+QG+ + D +KV+ IIN  +  +   G   ERI +L+H++E+ ++H   +FGL L   ++S  NH+    D+LK  + + + +  L ENPK+LQ+ VK+Y   NQHR+ + MSP E    ++  LE+  +    K LS+ ER  I EK   L+  Q   +D +CLP L++SDI   I         + D         TNG++Y + +  L  +   L PY+PLF SVIT +    Y+YRE  Q  E  +GG+    H+   I+D +S D    G+L SS CL  N   MM LW +I     F D +RL  L++M  +    ++GI +S H YA  RAS  L+P G L E ++G++Q K++K +A M +     +I+ KL ++++ +   + ++ +IN     +      +  F        ++    RP+  E+                      P    C M+ +  F L F VNY+   +R+VPYTH DYA  RIL++++++K+LH +IRE GGAYGGG  +S  G   FYSYRDP+S  TL  F+++ +WA +   ++Q ++EAKLSVF  +D PI+   KG+ HF+ GISDE++Q+ RE LF VT  DL   +     +    + + I+GPE
Sbjct:   40 IHGFTVNEVTPVPELFLTAVKLSHDNTGAKYLHVAREDSNNLFSVQFRTTPLDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPEDPNSPLIFKGIVFNEMKGAFTDNEKVFSQHLQNKLLPDHTYSVVSGGEPLNIPDLTWEQLKEFHATHYHPSNARFFTYGNLPLEMHLKQIHEDALSKFGRIDPKTSVPPQERWQSPREYSISCGVDSFASDPEKQTMVSVNFLLSEITDSFEAFTLSLLSSLMVDGPNSPFYKALIEANLGTDFSPD-TGFNNYTRETYFSIGLQGINKEDSEKVKHIINRTINEIAEQGIEPERIEALLHKLEIQMKHQSTSFGLTLASYIASCWNHEGDPVDLLKIGDKISRFRQCLKENPKFLQDKVKQYFQVNQHRMMLSMSPDEQHYDKEEQLEEEKLTQKVKALSEEERKQIYEKGLELISLQSKPQDFSCLPALKVSDIEPQIPLTDLEIAYAGDVPVQYCTQPTNGMVYFRAVSSLNTLPEELKPYVPLFCSVITKLGCGVYNYREQAQQMELTTGGMSVCPHI---ISDDSSLDTYEQGILFSSLCLDRNMPDMMHLWSEIFNSPHFDDEERLRVLVRM--SAQEMSNGIPDSGHVYASIRASRTLTPTGELQELFSGMDQVKMIKRIAEMPDMG---SILRKLSRIRKYVLLSDNMRCSINAAPQQMETASKEMEHFLTGITRSKKERKAIRPHVVEKSSNPSPSGSEISRTATRKLVGDPTFKPCQMKTH--FCLSFPVNYIGECVRTVPYTHPDYASLRILARIMTAKFLHGEIREKGGAYGGGAKLSFDGIFGFYSYRDPNSLSTLSTFQKATDWAKSGQFSQQDVDEAKLSVFSAVDSPIAPSDKGMNHFLHGISDEMKQRHREELFAVTHSDLTNASNKYLTAGQCTRGTAILGPE 1014          
BLAST of Presequence protease mitochondrial vs. UniProt/SwissProt
Match: sp|Q7ZVZ6|PREP_DANRE (Presequence protease, mitochondrial OS=Danio rerio OX=7955 GN=pitrm1 PE=2 SV=1)

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 398/999 (39.84%), Postives = 599/999 (59.96%), Query Frame = 3
Query:   81 RSKMMHSQLKNLK--VDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTME--------------------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            RS+   +  K LK  V   +  + + +   V +  +TA++L H+ T A++ H  RDD N  F V FRT P +S+GVPHILEHTVLCGS+++P RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N +D S+    KGVV+NEMKGVFS++       ++  LLP+ TY   SGG+P AIP L++EQLK FH   YHPSN++FFTYGD+ LE  L +I ++ +  + + + +T++  +  W  P+  +++C+ D +A +P +Q+++ +SF++ D   ++  FT+ ++S+L++SG NSP Y+ LIE  IG D++ +  GFD S R  +F +G+QG+ + D + V+ II   +  +I  GF  E+I +L+H+IE+ ++H   +FGL L   ++S  NHD     +LK  E V + +  L ENP+YLQ  V+ Y  +N H+LT+ MSP E F +++   E+  ++   + LS  +R  I EK   LL  Q TT+D +CLP L++SDI       P +  +     +   E  TNG++Y + + ++  +   L  Y+PLF SVIT M +    YR+  Q  E  +GGL  +  +  +  DL+  +   G++LSS CL  N   M  LW D+    +F D +RL  L+ M  +    ++GIS S H YAM RA+  L+P   L E ++G++Q K MK +A M++ +   +I+ KL ++K  +FN   ++ A+N     + D  + +  F  ++     E+ P+                           K C+    F LPF VN+VS  +R+VP+TH+DYA   IL +++++K+LH +IRE GGAYGGG  +  G L  FYSYRDP+ST+TL  F   +EWA     T+Q ++EAKLSVF  +D P++   KGL  F+ GI+DE++Q  RERLF VT ++L +VA        ++    I+GPE E
Sbjct:   22 RSRGSSAVEKALKYTVGQKIHNFTVKEVTAVPDLFLTAVKLSHDATGAQYLHAARDDSNNLFSVLFRTTPMDSTGVPHILEHTVLCGSQRFPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLEHENPTDPSSPLVFKGVVFNEMKGVFSDNERLYAQHLQNKLLPDHTYSVVSGGEPLAIPELTWEQLKHFHATHYHPSNARFFTYGDLPLEQHLQQIEEEAMSKFERTEPNTAVPPQTPWDKPRMDHVSCRPDALAPDPVKQNTLCMSFLLGDITDTFEMFTLSLLSSLMMSGPNSPFYKALIEPKIGSDFSSS-AGFDGSTRQASFTIGLQGMAEDDTETVKHIIAQTIDDIIASGFEEEQIEALLHKIEIQMKHQSTSFGLALASYIASLWNHDGDPVQLLKISESVSRFRQCLKENPRYLQEKVQHYFKNNTHQLTLSMSPDERFLEKQAEAEEQKLQQKIQILSSEDRKDIYEKGLQLLAVQSTTQDASCLPALKVSDIEPIIPYTPVQPGAAGGVPVQYCEQPTNGMVYFRAMSNINSLPEDLKIYVPLFCSVITKMGSGMLDYRQQAQRIELKTGGLSVSPQIIPDTEDLDLYE--QGIILSSSCLERNLPDMFQLWSDLFNSPRFDDEERLRVLVMM--SAQELSNGISYSGHMYAMTRAARSLTPTADLQESFSGMDQVKFMKRIAEMTDLT---SILRKLPRIKRHLFNPENMRCALNATPQKMPDVAAEVERFIGNIAGNRKERKPVRPSVVERALGPEAGAAATRKLISEAHFKPCQMKTYFQLPFNVNFVSECVRTVPFTHADYASLCILGRMMTAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNSTQTLSAFRGGVEWARAGKFTQQDIDEAKLSVFSAVDAPVAPSDKGLGRFLNGITDEMKQAHRERLFAVTERNLIDVAGRYLGIGQQTCGVAILGPENE 1012          
BLAST of Presequence protease mitochondrial vs. UniProt/SwissProt
Match: sp|Q5JRX3|PREP_HUMAN (Presequence protease, mitochondrial OS=Homo sapiens OX=9606 GN=PITRM1 PE=1 SV=3)

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 390/993 (39.27%), Postives = 592/993 (59.62%), Query Frame = 3
Query:  117 KVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISD----IPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINC-------EESAVTDTL-SLLNTFEQDLIARPY---EQVPMS--------------LDCTMEKNCR-------FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSP-GHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPE 2975
            K+ + + G+ + +   V E  +TA++L H+ T A++ HL R+D N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N SD  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + K++  T +  +  W  P+   I C  D  A +P +Q+++ VSF++ D   ++  FT+ ++S+LL SG NSP Y+ LIESG+G D++ ++ G++   R   F +G+QG+ + D++ V  +I+  +  V+  GF  +RI +L+H+IE+ ++H   +FGL L   ++S  NHD    ++LK    + K +  L ENPK+LQ  VK+Y  +NQH+LT+ M P + + +++  +E   ++   + LS  +R  I EK   L   Q   +D +CLP L++SD    IP+  E      + D         TNG++Y +    L  +   L PY+PLF SV+T +      YRE  Q  E  +GG+ A+ H+  + + +++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    A+GI +S H YA  RA   L+P G L E ++G++Q +LMK +A M++    + I+ KL ++K+ + N + ++ ++N         E AV D L S+  + ++    RP+   + VP S                  ME   +       F++PF VNYV   +R+VPYT  D+A  +IL++L+++K+LH +IRE GGAYGGG  +S  G    YSYRDP++ ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V+   L  V++    +   +    I+GPE
Sbjct:   41 KLGDKIHGFTVNQVTSVPELFLTAVKLTHDDTGARYLHLAREDTNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTLYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQNRLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFPLEQHLKQIHEEALSKFQKIEPSTVVPAQTPWDKPREFQITCGPDSFATDPSKQTTISVSFLLPDITDTFEAFTLSLLSSLLTSGPNSPFYKALIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDIETVRSLIDRTIDEVVEKGFEDDRIEALLHKIEIQMKHQSTSFGLMLTSYIASCWNHDGDPVELLKLGNQLAKFRQCLQENPKFLQEKVKQYFKNNQHKLTLSMRPDDKYHEKQAQVEATKLKQKVEALSPGDRQQIYEKGLELRSQQSKPQDASCLPALKVSDIEPTIPV-TELDVVLTAGDIPVQYCAQPTNGMVYFRAFSSLNTLPEELRPYVPLFCSVLTKLGCGLLDYREQAQQIELKTGGMSASPHVLPDDSHMDTYEQ--GVLFSSLCLDRNLPDMMQLWSEIFNNPCFEEEEHFKVLVKM--TAQELANGIPDSGHLYASIRAGRTLTPAGDLQETFSGMDQVRLMKRIAEMTDI---KPILRKLPRIKKHLLNGDNMRCSVNATPQQMPQTEKAVEDFLRSIGRSKKERRPVRPHTVEKPVPSSSGGDAHVPHGSQVIRKLVMEPTFKPWQMKTHFLMPFPVNYVGECIRTVPYTDPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLSHNGIFTLYSYRDPNTIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDAPVAPSDKGMDHFLYGLSDEMKQAHREQLFAVSHDKLLAVSDRYLGTGKSTHGLAILGPE 1024          
BLAST of Presequence protease mitochondrial vs. UniProt/SwissProt
Match: sp|Q8K411|PREP_MOUSE (Presequence protease, mitochondrial OS=Mus musculus OX=10090 GN=Pitrm1 PE=1 SV=1)

HSP 1 Score: 664.07 bits (1712), Expect = 0.000e+0
Identity = 383/996 (38.45%), Postives = 582/996 (58.43%), Query Frame = 3
Query:  117 KVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFK------MSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDL---------------------------------IARPYEQVPMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS-PGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLR--NSSDKSSVIIGPE 2975
            KV   + G+ + +   V E  +TA++L H+ T A++ HL R+D+N  F VQFRT P +S+GVPH+LEHTVLCGS+KYP RDPFFKML RS +TFMNAMTA+D+TIYPFS+ N KD+ NLLSVYLDA F P L E DF QEGWRLE +N  D  T    KGVV+NEMKG F+++       ++  LLP+ TY   SGGDP  IP L++EQLK FH   YHPSN++FFTYG+  LE  L +I+++ L  + +L+  T++  +P W  P+  +I C  D +A    +Q++V VSF++ D   ++  FT+ ++S+LL++G NSP Y+ LIESG+G D++ ++ G++   R   F +G+QG+ + D+  V ++++  +  VI  GF  +RI +L+H+IE+  +H  A+FGL L   ++S  NHD    ++L+    + + +  L ENPK+LQ  V++Y  +NQH+LT+ M P + + +++  +E   +E     LS  ++  I EK   L   Q   +D +CLP L++SDI       PF        + D         TNG++Y +    L  +   L P +PLF SV+T +     +YRE  Q  E  +GG+    H+  + + L++ +   G+L SS CL  N   MM LW +I     F++ +    L+KM  T    ++GIS+S H YA  RAS  L+P G L E ++G++Q K+MK +A M++    + I+ KL ++K+ + N + ++ ++N     +      +  F +++                                 I R     P    C M+ +  FVLPF VNY+   +R+VPY   D+A  +IL++L+++K+LH +IRE GGAYGGG  ++  G    YSYRDP+S ETL  F ++++WA +   T+Q ++EAKLSVF  +D P++   KG+ HF+ G+SDE++Q  RE+LF V    L  V+        S     I+GPE
Sbjct:   41 KVGEKIHGFTVNQVTPVPELFLTAVKLSHDNTGARYLHLAREDKNNLFSVQFRTTPMDSTGVPHVLEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAMTASDYTIYPFSTQNPKDFQNLLSVYLDATFFPCLRELDFWQEGWRLEHENPRDPQTPLIFKGVVFNEMKGAFTDNERIFSQHLQNKLLPDHTYSVVSGGDPLCIPELTWEQLKQFHATHYHPSNARFFTYGNFQLEGHLKQIHEEALSKFQRLEQSTAVPAQPHWDKPREFHITCGPDSLATETAKQTTVSVSFLLPDITDTFEAFTLSLLSSLLIAGPNSPFYKALIESGLGTDFSPDV-GYNGYTREAYFSVGLQGIAEKDVKTVRELVDRTIEEVIEKGFEDDRIEALLHKIEIQTKHQSASFGLTLTSYIASCWNHDGDPVELLQIGSQLTRFRKCLKENPKFLQEKVEQYFKNNQHKLTLSMKPDDKYYEKQTQMETEKLEQKVNSLSPADKQQIYEKGLELQTQQSKHQDASCLPALKVSDIE---PSMPFTKLDIGLAAGDIPVQYCPQPTNGMVYFRAFSSLNTLPEDLRPIVPLFCSVLTKLGCGILNYREQAQQIELKTGGMSVTPHVLPDDSQLDTYEQ--GVLFSSLCLERNLPDMMHLWSEIFNNPCFEEEEHFKVLVKM--TAQELSNGISDSGHLYAALRASKTLTPSGDLQETFSGMDQVKVMKRIAEMTDI---KPILRKLPRIKKYLLNCDNMRCSVNATPQQMPQAEKEVENFLRNVGRSKKERKPVRPHIVEKPTPSGPSGAAHVSGSQIVRKLVTDPTFKPCQMKTH--FVLPFPVNYIGECVRTVPYADPDHASLKILARLMTAKFLHTEIREKGGAYGGGAKLTHSGIFTLYSYRDPNSIETLQSFGKAVDWAKSGKFTQQDIDEAKLSVFSTVDSPVAPSDKGMDHFLYGLSDEMKQAYREQLFAVNHDKLTSVSHKYLGIGKSTHGLAILGPE 1023          
BLAST of Presequence protease mitochondrial vs. TrEMBL
Match: A0A4S2LFH6 (M16C_associated domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009042 PE=4 SV=1)

HSP 1 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 445/987 (45.09%), Postives = 634/987 (64.24%), Query Frame = 3
Query:  114 LKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQ--RYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISC-------GLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLA------NMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYE-QVPMSLDCTMEK------NCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL-RNSSDKSSVIIGPEQEIESDWQKI 3005
            +K D ++ G+ L ++  V EF++   EL+HEKT AK++HL RDD NKT+ VQFRT P ++SGV HILEHTVLCGS KYPVRDPFFKML RSQA+FMNA+TANDWT+YPFS+MN KD+ NLLSVY DAVF PKL+E DFMQEGWRLEP++L + S+   +KGVV+NEMKGVFSNS+N  G  V+ NL P TY   SGG P +IP L+++ LK+FH   YHPSN+ F+TYGD +L+  L  ++ +YL++Y  + +D  + +EP WT P+ +N+  + DPMA +PDRQ  V +S  + D  ++Y NF  G++S LL+ GDN+PLY+ LIESG G DWAG +CG D S RTT+FH+G+QGV    ++        VL  V+RDGFP ER+ + +HQ EL +RH+ A FGL LI GLS GLNHD+ L+++L+  + +++ + DL   P  LQ+IV++Y  DN+H L   M P E++  E+    + L+  L + L+D +R    +K + LLE Q+  ED++CLPCL + DIP+EC    F M+        +NE  TNGI+Y   L DL  + + LI Y+PLF ++   +   +  Y E+DQA +  +GGL+   H++ ++  L   D S         + LS +CL        +LW  ++    + D  RL TLI M  +G WSA+ +++SAH +AMRRA++ LS   R++E W+GLEQA L+K +A      NM + ++  ++  +++ + + I   +RLK +++ E   ++ +L  L      L   P++  +P     T+        N  F +PFTV+Y + A R+ PY   +YA  R+LS LL+SKYLH +IRE GGAYGG  T  P  L F+SYRDPH+  TL +F  +L+WA +     Q ++EAKL+VFQE+D+P+SAGS+GL HF+ GI D +RQ  R++LF V    L++ AE L  N       I+GPE+   +DW  I
Sbjct:    1 MKADKLVHGFLLKRSFEVPEFRLLVAELLHEKTGAKYYHLRRDDSNKTYSVQFRTTPRDNSGVSHILEHTVLCGSRKYPVRDPFFKMLHRSQASFMNALTANDWTMYPFSTMNDKDFQNLLSVYTDAVFNPKLNELDFMQEGWRLEPKDLMNPSSELRIKGVVFNEMKGVFSNSLNRFGQAVQNNLFPHTYGFVSGGHPESIPSLTWDALKAFHSSCYHPSNALFYTYGDANLDWCLEFLDTEYLRHYDAIKLDNKVHLEPAWTEPRTVNLTSEADPMAPDPDRQCIVSLSCRLGDILETYPNFVCGIVSKLLIDGDNAPLYRELIESGYGLDWAGGICGVDQSTRTTSFHVGVQGVKSDQLNDFSGRTREVLTKVVRDGFPKERVEATLHQYELAVRHESARFGLNLIFGLSHGLNHDADLQEMLQIEKIIQRFRADLEARPTMLQDIVQQYFLDNKHSLLTTMQPDESWKAEQTKGNETLLSKLTESLTDADRQVWAQKSQKLLEQQQLEEDLSCLPCLSLLDIPMECRPESFTMTQTNGCTVQLNEAPTNGIVYFHGLADLSSLPTDLIIYVPLFCTLFPRLGAGDLIYSEMDQAIDLHTGGLNVTTHVTPSLPTLEVPDKSLMMPTTRPSVHLSGYCLTSKLPNFFELWSKLLQTPDWLDKQRLMTLILMSASGDWSANVVADSAHHFAMRRAAANLSASARITELWDGLEQASLVKRIASKLGKDNMESDNVLTDLTQRMLSIWKHIIQPDRLKFSLHGESGGLSSSLPHLEQLVSALSKIPHDNSIPTGAADTLNSLPKLPLNSYFAMPFTVHYTAQAFRAPPYDSPEYASFRVLSHLLTSKYLHREIREKGGAYGGRATAKPEALLFFSYRDPHARRTLDIFRSALDWARSTEFNTQDVDEAKLAVFQELDQPVSAGSRGLRHFLHGIDDNLRQTHRKQLFAVDSTMLRQAAERLSSNVHLAGRTILGPEE--SADWTLI 985          
BLAST of Presequence protease mitochondrial vs. TrEMBL
Match: G7YD94 (Eupitrilysin (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_105236 PE=4 SV=1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 435/970 (44.85%), Postives = 625/970 (64.43%), Query Frame = 3
Query:  165 VTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQ--RYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISC-------GLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLA------NMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYE-QVPMSLDCTMEK------NCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL-RNSSDKSSVIIGPEQEIESDWQKI 3005
            V EF++   EL+HEKT AK++HL RDD NKT+ VQFRT P ++SG+ HILEHTVLCGS KYPVRDPFFKML RSQA+FMNA+TANDWT+YPFS+MN KD+ NLLSVY DAVF PKL+E DFMQEGWRLEP++L + S+   +KGVV+NEMKGVFSNS+N  G  V+ NL P TY   SGG P +IP L+++ LK+FH   YHPSN+ F+TYGD +L+  L  ++++YL++Y  + +D  I +EP WT P+ +N+ C+ DPMA +PDRQ  V +S+ + D  ++Y  F  G++S LL+ GDN+PLY+ LIESG G DWAG + G D S RTT+FH+G+QGV   D++        VL  V+RDGFP ER+ +++HQ EL +RH+ A FGL LI GLS  L HD+ L+++L+  + +++ + DL   P  LQ+I+++Y  DN+H L   M P E++  E+   ++ L+  L K L+D++R    +K + LLE Q+  ED++ LP L + DIP+EC   PF M+        +NE  TNGI+Y   L DL  + + LI Y+PLF ++   +   +  Y E+DQA +  +GGL+   H++ ++  L   D S         + LS +CL        +LW  ++    + D  RL TLI M  +G WSA+ +++SAHQ+AMRRA++ LS   R++E W+GLEQA L+K +A      N+ + ++  ++  +++ + + I   +RLK +++ E   ++ +L  L      L    ++  +P     T+        N  F +PFTV+Y + A  + PY   +YA  R+LS LL+SKYLH +IRE GGAYGG  T  P  L F+SYRDPH+  TL +F  +L+WA +     Q ++EAKL+VFQE+D+P+SAGS+GL HF+ GI D++RQ  R++LF V    L++ AE L  N       I+GP +   +DW  I
Sbjct:    4 VPEFRLLVAELLHEKTGAKYYHLRRDDSNKTYSVQFRTIPRDNSGMSHILEHTVLCGSRKYPVRDPFFKMLHRSQASFMNALTANDWTMYPFSTMNDKDFQNLLSVYTDAVFNPKLNELDFMQEGWRLEPKDLMNPSSELRIKGVVFNEMKGVFSNSLNRFGQAVQNNLFPHTYGFVSGGHPESIPSLTWDALKAFHSSYYHPSNALFYTYGDANLDWCLEFLDNEYLRHYDAIKLDNEIHLEPAWTEPRTVNLTCEADPMAPDPDRQCIVSLSYRLGDILETYPKFVCGIVSKLLIDGDNAPLYRELIESGYGLDWAGGISGMDQSTRTTSFHVGVQGVKSDDLNDFSGRTREVLTKVVRDGFPKERVEAILHQHELAVRHESARFGLNLIFGLSHVLIHDADLQEVLQIEKIIQRFRADLEARPTMLQDIIQQYFLDNKHSLLTTMQPDESWKAEQTKQDEMLLSKLTKSLTDSDRQVWAQKSQKLLEQQQLEEDLSSLPILSLLDIPMECRPEPFTMTQTNGCTVQLNEAPTNGIVYFHGLADLSSLPTDLIIYVPLFCTLFPRLGAGDLTYSEMDQAIDLHTGGLNVTTHVTPSLPTLEVPDKSLMMSTTRPSIHLSGYCLTSKLTNFFELWSKLLQTPDWLDKQRLMTLILMSASGDWSANVVADSAHQFAMRRAAANLSASARITELWDGLEQASLVKRIASRLGKDNVESDNVLTDLTQRMLSIWKHIIQPDRLKFSLHGESDGLSSSLPHLEQLVSALSKIHHDNSIPTGAADTLNSLPKLPLNSYFAMPFTVHYTAQAFSAPPYDSPEYASFRVLSHLLTSKYLHREIREKGGAYGGRATAMPEALLFFSYRDPHARRTLDIFRSALDWARSTEFNTQDIDEAKLAVFQELDRPVSAGSRGLRHFLHGIDDDLRQTHRKQLFAVDSTMLRQAAERLSSNVHLAGRTILGPAE--STDWSLI 971          
BLAST of Presequence protease mitochondrial vs. TrEMBL
Match: A0A1S8X948 (Peptidase M16 inactive domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_00888 PE=4 SV=1)

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 435/970 (44.85%), Postives = 623/970 (64.23%), Query Frame = 3
Query:  165 VTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQ--RYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISC-------GLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANM--SNSSLEENIIPKLIQ----LKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQ-VPMSLDCTMEK------NCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL-RNSSDKSSVIIGPEQEIESDWQKI 3005
            V EF++   EL+HEKT AK++HL RDD NKT+ VQFRT P ++SGV HILEHTVLCGS KYPVRDPFFKML RSQA+FMNA+TANDWT+YPFS+MN KD+ NLLSVY DAVF PKL+E DFMQEGWRLEP++L + S+   +KGVV+NEMKGVFSNS+N  G  V+ NL P TY   SGG P +IP L+++ LK+FH   YHPSN+ F+TYGD +L+  L  ++++YL++Y  + +D  +++EP W  P+ +N+  + DPMA +PDRQ  V +S+ + D  ++Y NF  G++S LL+ GDN+PLY+ LIESG G DWAG + G D S RTT+FH+G+QGV   +++        V   V+RDGFP ER+ + +HQ EL +RH+ A FGL LI GL+  LNHD+ L ++L+  + +++ + DL   P  LQ+IV++Y  DN+H L   M P E++  E+    + L+  L + L+D +R    +K + LLE Q+  ED++ LPCL + DIP+EC   PF M+        +NE  TNGI+Y   L DL  + + L+ Y+PLF ++   +      Y E+DQA    +GGLD   H++ ++  L   D S         + LS +CL        +L+ +++    + D  RL TLI M  +G WSA+ +++SAH +AMRRA++ LS   R++E W+GLEQA L+K +A+    +S+  +N++  L Q    + + I   +RLK +++ E   ++ +L  L      L   P++  +P     T+        N  F +PFTV+Y + A R+  Y   +YA  R+LS LL+SKYLH +IRE GGAYGG  +  P  L F+SYRDPH+  TL +F  +L+WA +     Q ++EAKL+VFQE+D+P+SAGS+GL HF+ GI D++RQ  R++LF V    L++ AE L  N+      I+GPE+   +DW  I
Sbjct:    4 VPEFRLLVAELLHEKTGAKYYHLRRDDSNKTYSVQFRTTPRDNSGVSHILEHTVLCGSRKYPVRDPFFKMLHRSQASFMNALTANDWTMYPFSTMNDKDFQNLLSVYTDAVFNPKLNELDFMQEGWRLEPKDLMNPSSELTIKGVVFNEMKGVFSNSLNRFGQAVQNNLFPHTYGFVSGGHPESIPSLTWDALKAFHSSCYHPSNALFYTYGDANLDWCLEFLDNEYLRHYDAIKLDNKVQLEPAWIEPRTLNLTSEADPMAPDPDRQCIVSLSYRLGDILETYPNFVCGIVSKLLIDGDNAPLYRALIESGYGLDWAGGISGVDQSTRTTSFHVGVQGVKCDELNDFSGRTREVFTKVVRDGFPKERVEAFLHQYELAVRHESARFGLNLIFGLAHSLNHDADLLEMLQIEKIIQRFRADLEARPTMLQDIVQQYFLDNKHSLLTTMQPDESWKVEQAKRSKMLLSKLTEGLTDADRQVWAQKSQKLLEQQQLEEDLSSLPCLSLLDIPMECRPEPFTMTQTDGCSVQLNEAPTNGIVYFHGLADLCSLPTDLLIYVPLFCTLFPRLGAGGLTYSEMDQAINLHTGGLDVTTHVTPSLPTLELPDKSLMMSTTRPSIHLSGYCLTSKLPNFFELYSNLLQTPDWLDKQRLMTLILMSASGDWSANVVADSAHHFAMRRAAANLSASARITELWDGLEQASLVKRIASKLGKDSADSDNVLSDLTQRMLSIWKHIIQPDRLKFSLHGESDGLSSSLPHLEQLVSALSKIPHDNCIPTGAADTLNSLPKLPLNSYFAMPFTVHYAAQAFRAPSYDSPEYASFRVLSHLLTSKYLHREIREKGGAYGGRASAKPEALLFFSYRDPHARRTLDIFRSALDWARSTEFNTQDIDEAKLAVFQELDQPVSAGSRGLRHFLHGIDDDLRQTHRKQLFAVDSTMLRQAAERLSSNAHLAGRAILGPEE--STDWSSI 971          
BLAST of Presequence protease mitochondrial vs. TrEMBL
Match: A0A0X3NW02 (Presequence protease OS=Schistocephalus solidus OX=70667 GN=PREP PE=4 SV=1)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 430/992 (43.35%), Postives = 626/992 (63.10%), Query Frame = 3
Query:  123 DNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIEC--EKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLA----NMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDC-----------TMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESL--RNSSDKSSV------IIGPEQEIESDWQKIVFN*WN 3023
            + ++ G++  +   + EF+++ +EL HEK+ A ++HL+RDD NKTFGVQFRT P NSSGV HILEHTVLCGS KYPVRDPFFKML RSQATFMNAMTA+DWTIYPFS+MN  D+ NLL+VY DA F PKL + DFMQEGWRLEP++L+   +   LKGVVYNEMKGVFSNS+N  G  VE NL+P TY + SGG P+ IP L++E L+ FH++ YHPSN+  FTYG+V LE  L+ ++ + L  ++  D   S+ +EPRW SP+ I + CQ D  A +  R     +SF + D    Y NF + ++  LL+ GDN+PLY+ LIESG+G DWAG + G + ++RTT+FH+G+QGV + D+DKV      +L  V++ GFP ER+ +++HQ E+ +R D A FGL LI+GL+  +NH   +E  L   + + + K+DL+  P +LQ +V++Y+ +N HRL   M P   ++  +   +Q  +E L   ++ ++R  +T+    L E Q+  ED++CLPCL + DIP  C  E Y   +  D+   +NE  TNG++YL  L DL  + + L+ Y+P+F+ + T +      Y E+D      +G + A+ H+S  +N+      +  +  SS CL E   KM +L         + D  R+ TL+ M T G WSA+ +S  AH++AMRRA+S LS LGR+ E W+GLEQA LM+ LA    + S S   ++ + K+ ++ + +  K++LK +++ E S++   +  L  F   L          S D             + +N  FVLP++V+Y S AL +  +   D+   ++L++LL+SK+LH ++RE GGAYGGG +VSPG   FYSYRDP++  TLG FE SL++A++   TEQ + EAKLSVFQ++D P+SAGS+GL  F+ GI+DE+RQ+ R R+F +  + L  VAE L  R S  K +V      ++GP++    DW+    N W+
Sbjct:   10 NKLIHGFKFKRLFDINEFRLSVVELRHEKSGANYWHLLRDDPNKTFGVQFRTTPKNSSGVSHILEHTVLCGSAKYPVRDPFFKMLRRSQATFMNAMTASDWTIYPFSTMNNVDFQNLLAVYADAAFFPKLEKLDFMQEGWRLEPEDLNKPQSALMLKGVVYNEMKGVFSNSLNLFGQAVENNLMPVTYGNVSGGHPDQIPSLTWEALRHFHQEYYHPSNASVFTYGNVQLEDSLAYLDSECLGKFTAKDPPPSVPVEPRWNSPRTIWLTCQDDLTAPDRTRTCFASISFALCDILDVYRNFALSIVCTLLMDGDNAPLYRGLIESGLGLDWAGTIAGMEKTSRTTSFHIGLQGVRKEDLDKVSTACLDILSSVVKSGFPPERVEAVLHQYEIAVRQDSAQFGLNLILGLAPIVNHGGDIESCLSVQKLIERFKSDLAAEPGFLQRLVREYMVENPHRLLSIMQPDAKWESAQRKRDQERLEQLTAKITPSDREEVTKLATELAEKQKKEEDLSCLPCLNLIDIPANCRLEPYTEALVLDRPMQLNEAPTNGLVYLHALADLRNLPADLLLYVPIFADLFTRLGADGLSYLEMDHLQHLNTGAVCASAHISAGLNEHLKDPCAMSVHFSSFCLKERVPKMFELLSRRFRATDWLDHTRILTLVNMITAGDWSANSVSCDAHRFAMRRAASNLSSLGRVHELWSGLEQASLMRRLATRLGDESQSRAFDDFLDKMTRIGQHVLQKDKLKFSLHAEGSSLAPAVESLQDFLTALPPSSGSPSSASSDDSTTSDPVGYLPVLPQNAYFVLPYSVHYTSLALPAPLFVSPDFPAYQVLAQLLNSKFLHRRVREQGGAYGGGASVSPGQFAFYSYRDPNAQTTLGAFEESLDFALSSTFTEQDVVEAKLSVFQQLDCPVSAGSRGLRAFLTGITDEVRQEHRARIFPLANEALHSVAEQLKARLSVGKGAVDSAGRAVLGPKE--SPDWKPSNLNEWS 999          
BLAST of Presequence protease mitochondrial vs. TrEMBL
Match: A0A0R3SFE5 (M16C_associated domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3555 PE=4 SV=1)

HSP 1 Score: 837.025 bits (2161), Expect = 0.000e+0
Identity = 433/998 (43.39%), Postives = 630/998 (63.13%), Query Frame = 3
Query:   93 MHSQLKNLKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQ-ADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRT--TEDVNCLPCLQISDIPIECEKYPFK--MSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLAN--MSNSSLE------ENIIPKLIQLKE-IIFNKNRLKIAINCEESAVTDTLSLLNTF-------EQDLIARPYEQVPMSLDCT-MEKNCRFV-LPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS----VIIGP-EQEIESDWQK 3002
            M  ++  L   ++L+G+R++K+  + EFK+  +++ HEK+ A   HL RDD N+TFGVQFRT P +++GV HILEHT LCGS+KYPVRDPFFKML RSQATFMNA TA+DWTIYPFS+MN  DY NLLSVY+DA F PKL++ DFMQEGWRLEP+NL+D S+ F LKG+VYNEMKGVFSNS+N+L    E NLLP +Y + SGG P+ IP L++E LK FH   YHPSN+ F+TYG+++L+  L  ++   L  +   D    + +EPRW +P+RI I CQ DP  A+P R   V VSF + D    Y NF + + ++LL+ GDN+PLYQ LIESG+G DWA  + G D +NRTT FH+G+QG+   AD ++VE  +  +L   I+ GFP ERI +++HQ E+ L+ D A FGL +I+GL+  +NH   ++  L   + V   K+ L+ +P+ LQ ++ +YL  N HRL+V M P ETF+ ++   E   +E   KDLS  ++  I ++   L E Q+    ED++CLP L + DIP  C   PF           +NE  TNG++Y  ML ++  +   L+ Y+P+F+S+ + +      Y+E+D   E  +G L A+ H   ++N       +  + +SS+CLY+   KM++L    +    + D  R++TL+  +  G WSA+ +S+ AH +AMRRAS+ L+ +GR+SE W G+EQA  M+ LA   ++N+  +      E+ I K+  + + ++ N +RL+ +++ E++ +      L  F       + D  +   E +  + D T +E N   V LP++V+Y S AL +  YT  D+   R+LSK L+S +LH  +RE GGAYGGG  V+PG   FYSYRDP +  TL VFE+SL++A++    EQ + EAKLSVFQE+D P+SAGS+GL  F+ GI DE RQ  RE LF V    LK+ A+ LR+   + +     ++GP + +IE D ++
Sbjct:    1 MMEKIAALNSGHLLRGFRVLKSFNIDEFKLFVVQMQHEKSKANLIHLFRDDPNRTFGVQFRTTPFDNTGVSHILEHTALCGSQKYPVRDPFFKMLRRSQATFMNAFTASDWTIYPFSTMNATDYENLLSVYVDAAFFPKLTKLDFMQEGWRLEPENLNDSSSKFLLKGIVYNEMKGVFSNSLNHLAQVTENNLLPVSYGYVSGGHPDCIPNLTWEALKKFHSNFYHPSNANFYTYGNMELDECLEYLDSQCLSKFDAQDPSPKVPLEPRWAAPRRIQITCQPDPTLADPTRTVVVSVSFALTDICDVYTNFALAIATSLLIDGDNAPLYQGLIESGLGLDWASPVNGMDRNNRTTCFHVGLQGIKPGADTERVEKTVMEILDKTIKTGFPKERIEAVLHQQEIALKQDNARFGLSVILGLAGIVNHGGDIQTALSVQQLVDTFKSQLAADPQVLQKLIDQYLVKNPHRLSVIMIPDETFEVKQKEKEIQRLEKAVKDLSPTKKEEIIKEAGELAEKQKNQENEDLSCLPSLSLVDIPPNCRPEPFTEIQIGGSSVQLNEAPTNGLVYFHMLANISDLSQDLLIYVPVFASLFSQLGADGLTYQEMDLQQELNTGSLSASPHAIISLNTPEVEPCTRHVHISSYCLYDKVPKMLELVAKHLHGNDWCDKTRITTLLSADAAGQWSANALSHDAHHFAMRRASANLNSIGRMSELWGGVEQAAFMRHLAARLLTNADSDDSDRAFEDFIKKMRMIADHLLLNPSRLRFSLHAEQNNLAPVCQQLEAFLKTIPLKQTDSTSAEVETLKSTPDPTALESNSAHVALPYSVHYTSLALPAPYYTAPDFPAYRVLSKFLNSAFLHTAVREQGGAYGGGSCVNPGRFAFYSYRDPSAGPTLKVFEKSLDFALSTEFKEQDIVEAKLSVFQELDSPVSAGSRGLNAFLTGIDDEKRQDHRELLFKVDEPALKQAAQHLRDQLARQTHVGRAVLGPKDAKIEQDGEQ 998          
BLAST of Presequence protease mitochondrial vs. Ensembl Cavefish
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:103025101])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 388/986 (39.35%), Postives = 594/986 (60.24%), Query Frame = 3
Query:  120 VDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTME----------------------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            V   + G+ + +   V +  +TA++L H+ T A++ H  RDD N  F VQFRT P +S+GVPHILEHTVLCGS+++P RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF QEGWRLE +N ++ S++   KGVV+NEMKGVFS++       ++  LLP+ TY   SGG+P AI  L++EQLK FH   YHPSN++FFTYGD+ LE  L +I ++ L  + +   +T++  +  W  P+  ++ C  D MA +P +Q+++ VS+++ D   ++  FT+ ++S+L++SG NSP Y+ LIE  IG D++ ++ G+D S +  +F +G+QG+ + D++ V+ IIN  +  +I  GF  ERI +L+H+IE+ ++H   +FGL L   ++S  NHD      LK  E V + +  L ENP+YLQ+ V++Y  +N H+L + MSP E + +++   E   ++   + L++ +R +I EK   LL  Q  T+D + LP L++SDI       P +MS+     +   E  TNG++Y + + +L  +   L  Y+PLF SVIT +      YR+  Q  E  +GG+     +  +  +L+  +   G+LL+S CL  N   M +LW D+     F D +RL  L+ M       ++GIS S H YAM RA+  L+P   L E ++G++Q K MK +A MS+ +   +++ KL ++K  +FN + ++ A+N     + D    +  F  ++ +   E+ P+  +                          K C+    F LP+ VN+VS  +R+VP+TH DYA   +L +L+S+K+LH +IRE GGAYGGG  +  G L  FYSYRDP+ ++TLG F   ++WA +   T+Q ++EAKLS+F  +D PI+   KGL  F+ G+SDEI+Q  RERLF VT K+L +VA        ++    ++GP+ E
Sbjct:   35 VGQKIHGFTVREVTPVPDLFLTAVKLDHDVTGAQYLHAARDDSNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQRFPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWQEGWRLENENPTNPSSSLVFKGVVFNEMKGVFSDNERVYAQHLQNKLLPDHTYSVVSGGEPLAITDLTWEQLKHFHATHYHPSNARFFTYGDLPLEQHLKQIQEEALCKFQRTYPNTAVPAQIHWHKPREDHVTCSPDSMAPDPTKQNTLCVSYLLGDITDTFEAFTLNLLSSLMISGPNSPFYKALIEPKIGSDFS-SVVGYDGSTKQASFSVGLQGMAEEDIETVKRIINQTIDDIIETGFEEERIEALLHKIEIQMKHQSTSFGLALASYIASCWNHDGDPVHSLKISENVSRFRQCLQENPRYLQDKVRQYFKENTHQLILSMSPDEQYVEKQNEAELEKLQQKIQALTEADRKNIYEKGLQLLSEQSKTQDASSLPALKVSDITPTIPYTPVQMSTAGGVPVQYCEQPTNGMVYFRAMCNLNTLPEDLKIYVPLFCSVITKLGCGEMDYRQQAQQMELKTGGMSVTPQILSDTAELDLYEQ--GILLNSSCLERNLPDMFNLWSDLFNSPHFDDEERLRVLVMM--AAQELSNGISYSGHLYAMTRAARTLTPSADLQETFSGMDQVKFMKRMAEMSDLT---SVLRKLPRIKRHLFNPDNMRCAVNATPQKIADAAVEVERFMGNIASHRKERKPVRPNIVKRPLDLHAPSGSAASRKLISEVNFKPCQMKTYFELPYPVNFVSECVRTVPFTHEDYASLCVLGRLMSAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNCSQTLGAFRSGVDWARDGKFTQQDVDEAKLSIFSAVDAPIAPSDKGLGLFLNGVSDEIKQAHRERLFAVTHKNLIDVAGRYLGIGQRTRGVAVLGPKNE 1012          
BLAST of Presequence protease mitochondrial vs. Ensembl Cavefish
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:103025101])

HSP 1 Score: 346.28 bits (887), Expect = 2.426e-103
Identity = 222/640 (34.69%), Postives = 348/640 (54.37%), Query Frame = 3
Query: 1185 LQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTME----------------------KNCR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE-IESDWQKIV 3008
            +  D  K   +  S LLG    GF  ERI +L+H+IE+ ++H   +FGL L   ++S  NHD      LK  E V + +  L ENP+YLQ+ V++Y  +N H+L + MSP E + +++   E   ++   + L++ +R +I EK   LL  Q  T+D + LP L++SDI       P +MS+     +   E  TNG++Y + + +L  +   L  Y+PLF SVIT +      YR+  Q  E  +GG+     +  +  +L+  +   G+LL+S CL  N   M +LW D+     F D +RL  L+ M       ++GIS S H YAM RA+  L+P   L E ++G++Q K MK +A MS+ +   +++ KL ++K  +FN + ++ A+N     + D    +  F  ++ +   E+ P+  +                          K C+    F LP+ VN+VS  +R+VP+TH DYA   +L +L+S+K+LH +IRE GGAYGGG  +  G L  FYSYRDP+ ++TLG F   ++WA +   T+Q ++EAKLS+F  +D PI+   KGL  F+ G+SDEI+Q  RERLF VT K+L +VA        ++    ++GP+ E I+ D   +V
Sbjct:  287 MAPDPTKQNTLCVSYLLG--ETGFEEERIEALLHKIEIQMKHQSTSFGLALASYIASCWNHDGDPVHSLKISENVSRFRQCLQENPRYLQDKVRQYFKENTHQLILSMSPDEQYVEKQNEAELEKLQQKIQALTEADRKNIYEKGLQLLSEQSKTQDASSLPALKVSDITPTIPYTPVQMSTAGGVPVQYCEQPTNGMVYFRAMCNLNTLPEDLKIYVPLFCSVITKLGCGEMDYRQQAQQMELKTGGMSVTPQILSDTAELDLYEQ--GILLNSSCLERNLPDMFNLWSDLFNSPHFDDEERLRVLVMM--AAQELSNGISYSGHLYAMTRAARTLTPSADLQETFSGMDQVKFMKRMAEMSDLT---SVLRKLPRIKRHLFNPDNMRCAVNATPQKIADAAVEVERFMGNIASHRKERKPVRPNIVKRPLDLHAPSGSAASRKLISEVNFKPCQMKTYFELPYPVNFVSECVRTVPFTHEDYASLCVLGRLMSAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNCSQTLGAFRSGVDWARDGKFTQQDVDEAKLSIFSAVDAPIAPSDKGLGLFLNGVSDEIKQAHRERLFAVTHKNLIDVAGRYLGIGQRTRGVAVLGPKNENIKKDPSWVV 917          

HSP 2 Score: 292.352 bits (747), Expect = 6.289e-84
Identity = 142/284 (50.00%), Postives = 195/284 (68.66%), Query Frame = 3
Query:  120 VDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQ 968
            V   + G+ + +   V +  +TA++L H+ T A++ H  RDD N  F VQFRT P +S+GVPHILEHTVLCGS+++P RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L E DF  EGWRLE +N ++ S++   KGVV+NEMKGVFS++       ++  LLP+ TY   SGG+P AI  L++EQLK FH   YHPSN++FFTYGD+ LE  L +I ++ L  + +   +T++  +  W  P+  ++ C  D MA +P +Q
Sbjct:   11 VGQKIHGFTVREVTPVPDLFLTAVKLDHDVTGAQYLHAARDDSNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQRFPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNAKDFQNLLSVYLDAVFFPCLRELDFWYEGWRLENENPTNPSSSLVFKGVVFNEMKGVFSDNERVYAQHLQNKLLPDHTYSVVSGGEPLAITDLTWEQLKHFHATHYHPSNARFFTYGDLPLEQHLKQIQEEALCKFQRTYPNTAVPAQIHWHKPREDHVTCSPDSMAPDPTKQ 294          
BLAST of Presequence protease mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003559.1 (pep scaffold:Pmarinus_7.0:GL477320:175254:211223:-1 gene:ENSPMAG00000003242.1 transcript:ENSPMAT00000003559.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 3.007e-14
Identity = 54/193 (27.98%), Postives = 83/193 (43.01%), Query Frame = 3
Query:  297 GVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKG-----------VFSNSM--NYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRIN 836
            G+PH LEH V  GSE+YP +     +  R  A   NA T  D T Y  ++  ++ + NLL +YLD +  P L+E  ++ E        +  I+ +    GVVY EM+               N+M     GY  E   + E    ++          S++++  +HR  Y P N      G VD E V   ++
Sbjct:    8 GLPHTLEHLVFMGSEEYPYKGVLDLLANRCLAQGTNAWTDTDHTCYTITTAGSEGFLNLLPIYLDHILYPTLTESSYITE--------VHHINGDGENAGVVYCEMQARENTGESRTHRAMLNAMYSGRCGYKSETGGMLENLRTST----------SHKKVCDYHRTFYRPENLCLIITGQVDPEEVFRALD 182          
BLAST of Presequence protease mitochondrial vs. Ensembl Yeast
Match: CYM1 (Lysine-specific metalloprotease of the pitrilysin family; metalloprotease of the intermembrane space; degrades proteins and presequence peptides cleaved from imported proteins; required for normal mitochondrial morphology [Source:SGD;Acc:S000002838])

HSP 1 Score: 531.946 bits (1369), Expect = 1.914e-173
Identity = 333/991 (33.60%), Postives = 558/991 (56.31%), Query Frame = 3
Query:  105 LKNLKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFP--SERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDL-SENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYINEYGTNGILYL---KMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQF-KDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANM--SNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTL-SLLNTFEQDLIARPYEQV----PMSLDCTM-EKNCRFVL---PFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVS--PGHLKFYSYRDPHSTETLGVFERSLEWAINE---NITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSSVIIGPEQE---IESDWQ 2999
            ++   V  +  GY + + + V E ++TA++L+H +T A+H H+ RDD+N  F + F+T PP+S+GVPHILEHT LCGS KYPVRDPFFKML +S A FMNAMT  D+T +PFS+ N +D+ NL  VYLD+   P L ++DF QEGWRLE +N++D  +N   KGVVYNEMKG  SN+  Y     +Q++ P    +NSGGDP  I  L Y  L  FH K YHPSN+K FTYG++ L   L ++N+ +   Y K      + M         + +  Q D M   P++Q+   ++++      +Y  F + V+ NLL+ G +S +YQ LIESGIG +++ N  G + +       +GIQGV  +D++  +D +N++   ++    P   +RI ++I Q+EL  +  KA+FGL+L+  +  G  +     + L   + +++ + DL ++     Q++++KY+  ++   T  +   E F K     EQ  +      L + ++ +I ++   L E Q   ED++CLP LQI DIP   +KY  +  ++    I +  TNGI Y+   ++L D+  I   L PYLPLF+  +T++ T+   + EI+   +  +GG+  ++ ++   +D N+ +           L   +  + + W  I+ E  F K+ D+L  LI++  + + S+  ++++ H +A   +++     G ++E  NG+EQ + +  L ++  +  + +  ++ KL +L++ I + N +   I  +      T+ S ++ F + L   P+       P + D  +    C+  L   PF V+Y S AL  VPYTH D +  +++S +L+ K+LH ++RE GGAYGGG + S   G   FYSYRDP   ++L  F+ S  + +N+    +T+  L+EAKL++FQ++D P S   +G+ +FM G++D+++Q +RE+L +V++ D+  VAE    + +  S +IGP  E   +  +W+
Sbjct:   17 VRKYPVGGIFHGYEVRRILPVPELRLTAVDLVHSQTGAEHLHIDRDDKNNVFSIAFKTNPPDSTGVPHILEHTTLCGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFFPFSTTNPQDFANLRGVYLDSTLNPLLKQEDFDQEGWRLEHKNITDPESNIVFKGVVYNEMKGQISNANYYFWSKFQQSIYPSL--NNSGGDPMKITDLRYGDLLDFHHKNYHPSNAKTFTYGNLPLVDTLKQLNEQF-SGYGKRARKDKLLMPIDLKKDIDVKLLGQIDTMLP-PEKQTKASMTWICGAPQDTYDTFLLKVLGNLLMDGHSSVMYQKLIESGIGLEFSVN-SGVEPTTAVNLLTVGIQGV--SDIEIFKDTVNNIFQNLLETEHPFDRKRIDAIIEQLELSKKDQKADFGLQLLYSILPGWTNKIDPFESLLFEDVLQRFRGDLETKGDTLFQDLIRKYIV-HKPCFTFSIQGSEEFSKSLDDEEQTRLREKITALDEQDKKNIFKRGILLQEKQNEKEDLSCLPTLQIKDIPRAGDKYSIEQKNNTMSRITD--TNGITYVRGKRLLNDI--IPFELFPYLPLFAESLTNLGTTTESFSEIEDQIKLHTGGISTHVEVT---SDPNTTEPRLIFGFDGWSLNSKTDHIFEFWSKILLETDFHKNSDKLKVLIRLLASSNTSS--VADAGHAFARGYSAAHYRSSGAINETLNGIEQLQFINRLHSLLDNEETFQREVVDKLTELQKYIVDTNNMNFFITSDSDVQAKTVESQISKFMERL---PHGSCLPNGPKTSDYPLIGSKCKHTLIKFPFQVHYTSQALLGVPYTHKDGSALQVMSNMLTFKHLHREVREKGGAYGGGASYSALAGIFSFYSYRDPQPLKSLETFKNSGRYILNDAKWGVTD--LDEAKLTIFQQVDAPKSPKGEGVTYFMSGVTDDMKQARREQLLDVSLLDVHRVAEKYLLNKEGVSTVIGPGIEGKTVSPNWE 985          
BLAST of Presequence protease mitochondrial vs. Ensembl Yeast
Match: SDD3 (Putative metalloprotease; overproduction suppresses lethality due to expression of the dominant PET9 allele AAC2-A128P [Source:SGD;Acc:S000005458])

HSP 1 Score: 92.0485 bits (227), Expect = 2.412e-19
Identity = 66/230 (28.70%), Postives = 108/230 (46.96%), Query Frame = 3
Query:  162 YVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPP--NSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATF----MNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE--TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLS 827
            YV ++ +T  + I E+T  +  H+         G  F  P    N SG PH LEH +  GS+ YP     +K L  +         NA T  D T+Y  SS   K +  LL  YLD +  P L+++  + E + ++P+NL D       KGVV++EM+ + +      G   ++ + PE   Y   +GG    +  L+ ++++ FH+ LY   N      G+V  + +L+
Sbjct:   13 YVPQYHIT--KYISERTKLQLVHINHKTSPLVHGY-FAVPTECLNDSGAPHTLEHLIFMGSKSYP-----YKGLLDTAGNLSLSNTNAWTDTDQTVYTLSSAGWKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGD-------KGVVFSEMEAIETQGWYISGLEKQRLMFPEGSGYRSETGGLTKNLRTLTNDEIRQFHKSLYSSDNLCVIVCGNVPTDELLT 227          
BLAST of Presequence protease mitochondrial vs. Ensembl Nematostella
Match: EDO46646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA0])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 411/995 (41.31%), Postives = 587/995 (58.99%), Query Frame = 3
Query:  111 NLKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLP-ETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFK--MSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLI--ARPYEQVPMSL-----------------------------DCTME-KNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDK--SSVIIGPEQEI 2984
             LK  + L GY + K + + E  + ++ELIH+ T A+H H+ RDD N  FGV  RT P +S+GVPHILEHT LCGSEK+P RDPFFKML RS ATFMNA TA+D+T+YPFS+ N+KDYFNLLS+YLDAVF P+L E DF QEGWR+E ++LS  S+    KGVV+NEMKG  S   +      ++ LLP  TY H SGGDP  IP L++EQLK FH   YHPSN++F+TYGD+ LE  L  I+   LQ + KL  +T I  E RW+  +  ++ C  DPMAA+PD+Q++V  S+++  +   + +F +G++S+LL+ G  SP YQ LIE  IG D++  + G+D+  +  +F +G+QG+ + D++KV++II +    V+ +GFP ERIAS++H++EL ++H  +NFGL L+M L     H     + L+  +Y+ K K  + E+ K+L+N V++Y  DN H LT+ MSP   ++ +   LE+  +E +   L+D+++ +I +KC  L   Q TTED++CLP + ISDI  + ++      + +      +E  TN + Y + +     I   L PYLPLF  VIT M   N  Y+E+ Q  E  +GGL    H+  N  D        G++ SSHCL +N   M  LW +I    +FKD +RL TLI M    S  A  I+ S H YA+  ASS L+P  RL E   GL Q   MK L +  + S    +I KL  +   +    + + A+N      + T + L  F   ++     Y  V M                               D T E +   F+LP+ VNY S  + +V Y H DYAK RIL+KLLSSK+LH +IRE GGAYG G  +  G   F+SYRDP+S  TL  F  S+ WA   N T+Q +NEAKL+VF  +D P+S  ++G+++F +GI+D +RQ QR+RLF V+  D+  V     +SS+   S  ++GPE ++
Sbjct:    1 QLKAGDNLHGYTVTKVVPIQELSLVSVELIHDATGAQHLHIARDDSNNVFGVGLRTTPLDSTGVPHILEHTALCGSEKFPCRDPFFKMLNRSLATFMNAFTASDFTMYPFSTQNSKDYFNLLSIYLDAVFFPRLRELDFWQEGWRMENEDLSASSSALTFKGVVFNEMKGALSTPESVFVTQAQKLLLPSHTYSHISGGDPLHIPDLTWEQLKKFHATHYHPSNARFYTYGDIPLEEHLQHISSLALQRFDKLQTETEIPHEERWSEAREAHVTCPIDPMAADPDKQTTVSRSYLVASTTDPFESFILGILSSLLIGGPTSPFYQALIEPNIGSDFSPGV-GYDNGTKDASFSIGLQGIKKEDVEKVKEIIKTTFDKVVEEGFPKERIASILHRVELSVKHQSSNFGLGLMMSLMHPWTHGGDPTEYLQINKYMEKFKACMEEDEKFLENKVREYFVDNTHNLTLVMSPDAEYEAKLAKLEKAKLEKMTSSLTDDDKENIYKKCLELASQQNTTEDLSCLPVMHISDIDPKIKRVVLDECIVAGVPAQFSEQPTNSVTYFRAISSTTDIPDELHPYLPLFCYVITKMGAGNLDYKEMAQLIERRTGGLSVGTHICTNHTD--PMKYEQGVMFSSHCLDKNLPHMFYLWGEIFGSPRFKDQERLRTLINM--LASDLASSIAQSGHSYAVSLASSSLTPAARLDEVLGGLSQVVFMKQLVDAEDLS---PVIEKLTTIAVHVLEGTQFRCAVNTMPETRSSTQTALEGFSAQILRDKSRYNDVRMQRDPPPRPRSRDSVTRYPAAARILRDKSRYNDFTPESRRTHFMLPYPVNYASRCVNAVTYNHEDYAKLRILAKLLSSKFLHREIREKGGAYGSGAKLGGGVFSFFSYRDPNSVGTLDAFNDSISWASQGNFTDQDINEAKLAVFAAVDSPVSPSNRGMLYFTQGITDAMRQAQRDRLFAVSRDDIVNVTRKYLSSSEATNSYALVGPENDV 987          
BLAST of Presequence protease mitochondrial vs. Ensembl Nematostella
Match: EDO34088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQB7])

HSP 1 Score: 66.6254 bits (161), Expect = 4.414e-11
Identity = 66/256 (25.78%), Postives = 98/256 (38.28%), Query Frame = 3
Query:  234 IRDDRNKTFGVQF-----RTPPPNS-----------SGVPHILEHTVLCGSEKYP------------------------VRDPFFK------------MLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE--TYPHNSGGD-PNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRIN 836
            ++  R+K  G+QF     R P  N             G+PH LEH V  GSE+YP                        V  PF              +  R  A   NA TA D T Y   +  ++ + NLL +YLD V  P L+E  ++ E        +  I+      GVVY EM+   ++  +     + +NL P    +   +GG   N     S++++  +H + Y P N      G VD E V   + 
Sbjct:   19 VKKYRSKRTGIQFCFAQVRGPLVNGFLCLATEAHDDDGLPHTLEHLVFMGSEQYPYKGQLPPHVRPWQDPVPPLPVTTDVTIPFPTEDESSGMGLLDLLANRCLAQGTNAWTATDHTCYTIETAGSEGFINLLPIYLDHVLYPTLTESAYITE--------VQHINGEGEDAGVVYCEMQARENSGNSRTHLALLRNLYPGHCGFKSETGGIMENLRTSCSHKKVCDYHHQFYRPDNLCVVITGQVDPEKVFEALT 266          
BLAST of Presequence protease mitochondrial vs. Ensembl Nematostella
Match: EDO41083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S593])

HSP 1 Score: 58.9214 bits (141), Expect = 4.583e-11
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 3
Query:  786 FFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQ 968
            F+TYGD+ LE  L  I+   LQ + KL  +T I  E RW+  +  ++ C  DPMAA+ D+Q
Sbjct:    2 FYTYGDIPLEEHLQHISSLALQRFDKLQTETEIPHEERWSEAREAHVTCPIDPMAADHDKQ 62          
BLAST of Presequence protease mitochondrial vs. Ensembl Medaka
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:101163109])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 401/1000 (40.10%), Postives = 612/1000 (61.20%), Query Frame = 3
Query:   81 RSKMMHSQLKNLKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIA--------------------RPYEQVPMSLDCTMEKN---CR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            +S  +  ++  L++   + G+ + + + V +  +TA++L H++T A++ H  RDD N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L EQDF QEGWRLE +N +D S+    KGVV+NEMKG FS++       ++  LLP+ TY   SGG+P AIP L++EQLK FH   YHPSN++FFTYGD+ LE  L +I+++ L  + ++D  T +  +P WTSP+  ++ C  D +A +  +Q+S+ VS+++ D   ++  FT+ ++S+L++SG NSP Y+ LIE  IG D++ ++ G+D S +  +F +G+QG+ + D +KV+ II+  +  +I  GF  ERI +L+H+IE+ ++H   NFGL L   ++S  NHD    ++L+  E V + +  L E+P++LQ+ VK Y  +N HRLT+ MSP   + +++ T E   ++   + L+D +R  I +K   LL AQ  T+D +CLP L++SDI         ++SS     +   E  TNG++Y + +  L  +   L  Y+PLF SV+T M      YR+  Q  E  +GG+ A+  +  +   +++     G+LLSS CL  N   M  LW DI     F++ +RL  L+ M  +    A+GIS S H YAM RA   L+P G L E + G+EQ K +K +A + + S   ++I  L+++K  + N + ++ AIN     ++D+ + L  F +++                      +P E    S     E N   C+    F +PF VN+VS  +R+VPY+H DYA   IL++++++K+LH +IRE GGAYGGG  +  G L  FYSYRDP+S +TL  F + ++WA + + T+Q ++EAKLSVF  +D P++   KG+  F+ GI+DE++Q  RERLF+V   +L +VAE   +   ++    I+GPE E
Sbjct:   25 KSTSVREKVLQLQLGQKIHGFTVREVVEVPDLFLTAVKLSHDQTGAQYLHAARDDSNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNEKDFQNLLSVYLDAVFFPCLREQDFWQEGWRLENENPTDPSSPLVFKGVVFNEMKGAFSDNERLFAQHLQNKLLPDHTYSVVSGGEPLAIPDLTWEQLKQFHATHYHPSNARFFTYGDLPLENHLKQIHEEALSKFERIDPKTEVPSQPHWTSPREDHVTCSPDALAPDQTKQNSLCVSYLLGDITDTFEGFTLSLLSSLMVSGPNSPFYKSLIEPKIGSDFS-SVVGYDGSTKEGSFSIGLQGMAEQDTEKVKQIISQTIDHIIETGFEEERIEALLHKIEIQIKHQSTNFGLSLASYIASSWNHDGDPVELLRISESVTRFRQALKEDPRFLQDKVKLYFKENTHRLTLSMSPDHDYTEKQATAEDQKLQQKVQALTDKDREKIYQKGLELLAAQSQTQDASCLPALKVSDIQPTTPPTAVQLSSAAGVPVQLCEQPTNGLVYFRAMCSLNTLPEDLRLYVPLFCSVLTKMGCGALDYRQQAQQMELRTGGMSASAQVVPDSAHIDT--FEQGILLSSSCLERNLPHMFHLWSDIFNSPHFENEERLRVLVTM--SAQELANGISYSGHMYAMTRAGRHLTPAGDLQETFAGMEQVKFVKRIAEVPDLS---HVIRTLVRIKRHLLNPDNMRCAINATPQKMSDSAAQLEVFMREVSESRKERKAVRSNILKKPLDPNKPAEDSGPSRKLITEPNFQPCQMKTFFQMPFPVNFVSECIRAVPYSHHDYAGLCILARMMTAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNSVQTLSAFRKGVDWAKSGHFTQQDIDEAKLSVFSAVDSPVAPADKGMSRFLSGITDEMKQSHRERLFSVDHPNLVDVAERYLSVGQRTCGVAILGPENE 1016          
BLAST of Presequence protease mitochondrial vs. Ensembl Medaka
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:101163109])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 401/1000 (40.10%), Postives = 612/1000 (61.20%), Query Frame = 3
Query:   81 RSKMMHSQLKNLKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPE-TYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYIN--EYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIA--------------------RPYEQVPMSLDCTMEKN---CR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            +S  +  ++  L++   + G+ + + + V +  +TA++L H++T A++ H  RDD N  F VQFRT P +S+GVPHILEHTVLCGS+KYP RDPFFKML RS +TFMNA TA+D+T+YPFS+ N KD+ NLLSVYLDAVF P L EQDF QEGWRLE +N +D S+    KGVV+NEMKG FS++       ++  LLP+ TY   SGG+P AIP L++EQLK FH   YHPSN++FFTYGD+ LE  L +I+++ L  + ++D  T +  +P WTSP+  ++ C  D +A +  +Q+S+ VS+++ D   ++  FT+ ++S+L++SG NSP Y+ LIE  IG D++ ++ G+D S +  +F +G+QG+ + D +KV+ II+  +  +I  GF  ERI +L+H+IE+ ++H   NFGL L   ++S  NHD    ++L+  E V + +  L E+P++LQ+ VK Y  +N HRLT+ MSP   + +++ T E   ++   + L+D +R  I +K   LL AQ  T+D +CLP L++SDI         ++SS     +   E  TNG++Y + +  L  +   L  Y+PLF SV+T M      YR+  Q  E  +GG+ A+  +  +   +++     G+LLSS CL  N   M  LW DI     F++ +RL  L+ M  +    A+GIS S H YAM RA   L+P G L E + G+EQ K +K +A + + S   ++I  L+++K  + N + ++ AIN     ++D+ + L  F +++                      +P E    S     E N   C+    F +PF VN+VS  +R+VPY+H DYA   IL++++++K+LH +IRE GGAYGGG  +  G L  FYSYRDP+S +TL  F + ++WA + + T+Q ++EAKLSVF  +D P++   KG+  F+ GI+DE++Q  RERLF+V   +L +VAE   +   ++    I+GPE E
Sbjct:   25 KSTSVREKVLQLQLGQKIHGFTVREVVEVPDLFLTAVKLSHDQTGAQYLHAARDDSNNLFSVQFRTTPMDSTGVPHILEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAFTASDYTMYPFSTQNEKDFQNLLSVYLDAVFFPCLREQDFWQEGWRLENENPTDPSSPLVFKGVVFNEMKGAFSDNERLFAQHLQNKLLPDHTYSVVSGGEPLAIPDLTWEQLKQFHATHYHPSNARFFTYGDLPLENHLKQIHEEALSKFERIDPKTEVPSQPHWTSPREDHVTCSPDALAPDQTKQNSLCVSYLLGDITDTFEGFTLSLLSSLMVSGPNSPFYKSLIEPKIGSDFS-SVVGYDGSTKEGSFSIGLQGMAEQDTEKVKQIISQTIDHIIETGFEEERIEALLHKIEIQIKHQSTNFGLSLASYIASSWNHDGDPVELLRISESVTRFRQALKEDPRFLQDKVKLYFKENTHRLTLSMSPDHDYTEKQATAEDQKLQQKVQALTDKDREKIYQKGLELLAAQSQTQDASCLPALKVSDIQPTTPPTAVQLSSAAGVPVQLCEQPTNGLVYFRAMCSLNTLPEDLRLYVPLFCSVLTKMGCGALDYRQQAQQMELRTGGMSASAQVVPDSAHIDT--FEQGILLSSSCLERNLPHMFHLWSDIFNSPHFENEERLRVLVTM--SAQELANGISYSGHMYAMTRAGRHLTPAGDLQETFAGMEQVKFVKRIAEVPDLS---HVIRTLVRIKRHLLNPDNMRCAINATPQKMSDSAAQLEVFMREVSESRKERKAVRSNILKKPLDPNKPAEDSGPSRKLITEPNFQPCQMKTFFQMPFPVNFVSECIRAVPYSHHDYAGLCILARMMTAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNSVQTLSAFRKGVDWAKSGHFTQQDIDEAKLSVFSAVDSPVAPADKGMSRFLSGITDEMKQSHRERLFSVDHPNLVDVAERYLSVGQRTCGVAILGPENE 1016          
BLAST of Presequence protease mitochondrial vs. Ensembl Medaka
Match: pitrm1 (pitrilysin metallopeptidase 1 [Source:NCBI gene;Acc:101163109])

HSP 1 Score: 317.775 bits (813), Expect = 1.815e-96
Identity = 196/557 (35.19%), Postives = 309/557 (55.48%), Query Frame = 3
Query: 1401 EYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIA--------------------RPYEQVPMSLDCTMEKN---CR----FVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHL-KFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSS--VIIGPEQE 2981
            E V + +  L E+P++LQ+ VK Y  +N HRLT+ MSP   + +++ T E   ++   + L+D +R  I +K   LL AQ  T+D +CLP L++SDI         +++      + E  TNG++Y + +  L  +   L  Y+PLF SV+T M      YR+  Q  E  +GG+ A+  +  +   +++     G+LLSS CL  N   M  LW DI     F++ +RL  L+ M  +    A+GIS S H YAM RA   L+P G L E + G+EQ K +K +A + + S   ++I  L+++K  + N + ++ AIN     ++D+ + L  F +++                      +P E    S     E N   C+    F +PF VN+VS  +R+VPY+H DYA   IL++++++K+LH +IRE GGAYGGG  +  G L  FYSYRDP+S +TL  F + ++WA + + T+Q ++EAKLSVF  +D P++   KG+  F+ GI+DE++Q  RERLF+V   +L +VAE   +   ++    I+GPE E
Sbjct:    6 ESVTRFRQALKEDPRFLQDKVKLYFKENTHRLTLSMSPDHDYTEKQATAEDQKLQQKVQALTDKDREKIYQKGLELLAAQSQTQDASCLPALKVSDIQPTTPPTAVQLTGVP-VQLCEQPTNGLVYFRAMCSLNTLPEDLRLYVPLFCSVLTKMGCGALDYRQQAQQMELRTGGMSASAQVVPDSAHIDT--FEQGILLSSSCLERNLPHMFHLWSDIFNSPHFENEERLRVLVTM--SAQELANGISYSGHMYAMTRAGRHLTPAGDLQETFAGMEQVKFVKRIAEVPDLS---HVIRTLVRIKRHLLNPDNMRCAINATPQKMSDSAAQLEVFMREVSESRKERKAVRSNILKKPLDPNKPAEDSGPSRKLITEPNFQPCQMKTFFQMPFPVNFVSECIRAVPYSHHDYAGLCILARMMTAKFLHGEIREKGGAYGGGARMGGGGLFSFYSYRDPNSVQTLSAFRKGVDWAKSGHFTQQDIDEAKLSVFSAVDSPVAPADKGMSRFLSGITDEMKQSHRERLFSVDHPNLVDVAERYLSVGQRTCGVAILGPENE 554          
BLAST of Presequence protease mitochondrial vs. Planmine SMEST
Match: SMESG000032460.1 (SMESG000032460.1)

HSP 1 Score: 1922.52 bits (4979), Expect = 0.000e+0
Identity = 939/945 (99.37%), Postives = 941/945 (99.58%), Query Frame = 3
Query:  180 MTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYPHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQXXXXXXXXXXXXHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNCRFVLPFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSSVIIGPEQEIESDWQKIVFN 3014
            MTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETY HNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQSSVVVSFVIDDSHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDN+HRLTVFMSPKETFDKEKL LEQNLIE LNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEE IIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNCRFVLPFTVNYVSTAL+SVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSSVIIGPEQEIESDWQKIVFN
Sbjct:    1 MTALELIHEKTNAKHFHLIRDDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEGWRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYRHNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRINDDYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQSSVVVSFVIDDSHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFDSSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQIELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSENPKYLQNIVKKYLFDNRHRLTVFMSPKETFDKEKLILEQNLIEKLNKDLSDNERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQRYYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYREIDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMDLWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRLSPLGRLSECWNGLEQAKLMKSLANMSNSSLEEKIIPKLIQLKEIIFNKNRLKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNCRFVLPFTVNYVSTALKSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGGVTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVFQEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRNSSDKSSVIIGPEQEIESDWQKIVFN 945          
The following BLAST results are available for this feature:
BLAST of Presequence protease mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PITRM10.000e+039.27pitrilysin metallopeptidase 1 [Source:HGNC Symbol;... [more]
PITRM10.000e+039.27pitrilysin metallopeptidase 1 [Source:HGNC Symbol;... [more]
PITRM11.065e-14640.94pitrilysin metallopeptidase 1 [Source:HGNC Symbol;... [more]
PITRM17.751e-8934.19pitrilysin metallopeptidase 1 [Source:HGNC Symbol;... [more]
PITRM12.563e-3733.92pitrilysin metallopeptidase 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C05D11.12.690e-1629.59pep chromosome:WBcel235:III:6436608:6439959:1 gene... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG31070.000e+036.93gene:FBgn0033005 transcript:FBtr0086077[more]
CG31070.000e+036.93gene:FBgn0033005 transcript:FBtr0086078[more]
CG31070.000e+036.93gene:FBgn0033005 transcript:FBtr0345009[more]
CG31070.000e+036.93gene:FBgn0033005 transcript:FBtr0111280[more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pitrm10.000e+040.45pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm10.000e+039.94pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitrm10.000e+040.04pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm10.000e+039.84pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm10.000e+040.16pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm10.000e+039.98pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm10.000e+039.92pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pitrm10.000e+038.45pitrilysin metallepetidase 1 [Source:MGI Symbol;Ac... [more]
Pitrm10.000e+037.45pitrilysin metallepetidase 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Presequence protease mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28BR5|PREP_XENTR0.000e+039.66Presequence protease, mitochondrial OS=Xenopus tro... [more]
sp|Q6PF24|PREP_XENLA0.000e+039.86Presequence protease, mitochondrial OS=Xenopus lae... [more]
sp|Q7ZVZ6|PREP_DANRE0.000e+039.84Presequence protease, mitochondrial OS=Danio rerio... [more]
sp|Q5JRX3|PREP_HUMAN0.000e+039.27Presequence protease, mitochondrial OS=Homo sapien... [more]
sp|Q8K411|PREP_MOUSE0.000e+038.45Presequence protease, mitochondrial OS=Mus musculu... [more]
back to top
BLAST of Presequence protease mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LFH60.000e+045.09M16C_associated domain-containing protein OS=Opist... [more]
G7YD940.000e+044.85Eupitrilysin (Fragment) OS=Clonorchis sinensis OX=... [more]
A0A1S8X9480.000e+044.85Peptidase M16 inactive domain protein (Fragment) O... [more]
A0A0X3NW020.000e+043.35Presequence protease OS=Schistocephalus solidus OX... [more]
A0A0R3SFE50.000e+043.39M16C_associated domain-containing protein OS=Hymen... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pitrm10.000e+039.35pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm12.426e-10334.69pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003559.13.007e-1427.98pep scaffold:Pmarinus_7.0:GL477320:175254:211223:-... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYM11.914e-17333.60Lysine-specific metalloprotease of the pitrilysin ... [more]
SDD32.412e-1928.70Putative metalloprotease; overproduction suppresse... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO466460.000e+041.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340884.414e-1125.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410834.583e-1142.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pitrm10.000e+040.10pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm10.000e+040.10pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
pitrm11.815e-9635.19pitrilysin metallopeptidase 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Presequence protease mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032460.10.000e+099.37SMESG000032460.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035053 ID=SMED30035053|Name=Presequence protease mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=3116bp
ATTGAAATATTCATAATAAGTCAAAATAACGTGAGTGCATGCTAATAATT
CCATTTATATAATAACGAATTGCATTCTGAAGGTCTAAAATGATGCACAG
TCAATTAAAAAATCTTAAAGTAGATAATGTTCTTAAAGGATATCGTCTCG
TTAAAAATATATACGTTACAGAATTTAAAATGACAGCTTTAGAACTAATT
CACGAAAAAACAAATGCTAAACATTTTCATTTAATCAGGGATGATAGAAA
TAAAACTTTTGGAGTACAATTCAGAACACCACCTCCAAATAGTTCAGGTG
TTCCACACATTTTGGAGCATACTGTTCTCTGTGGTTCTGAAAAATATCCA
GTAAGAGACCCATTTTTTAAAATGCTCACTAGAAGTCAAGCTACATTTAT
GAATGCAATGACAGCAAATGATTGGACAATCTATCCTTTCAGCTCCATGA
ATACAAAAGATTATTTTAATTTGCTATCAGTTTATTTGGATGCCGTTTTT
AAACCAAAATTATCGGAACAAGATTTTATGCAAGAAGGTTGGCGATTAGA
GCCGCAAAATCTTTCTGATATTTCAACAAATTTTAACTTGAAAGGTGTTG
TGTATAATGAAATGAAAGGAGTCTTCTCTAACAGTATGAATTATCTGGGA
TATACTGTGGAACAGAATCTTTTGCCAGAAACCTATCCCCACAATAGTGG
TGGCGATCCGAATGCCATTCCATTTTTAAGTTATGAACAATTGAAATCGT
TTCATAGGAAATTATATCATCCTTCGAATAGCAAATTTTTTACTTACGGC
GATGTTGATTTGGAGGCCGTTCTTTCCAGAATCAATGACGATTATCTTCA
GAATTATTCCAAATTAGATATCGATACATCCATTCGAATGGAGCCTCGAT
GGACCTCACCGAAAAGGATCAATATAAATTGCCAAACTGATCCAATGGCA
GCAAACCCTGATAGGCAGTCATCTGTAGTTGTTAGCTTTGTAATTGACGA
TTCTCATAAATCCTATCTCAATTTCACAATGGGAGTAATTAGCAATCTAC
TGTTGAGTGGAGATAATTCACCGCTTTATCAAGTTCTCATAGAGTCGGGT
ATCGGACAAGATTGGGCTGGTAATCTCTGTGGATTCGATAGTTCCAATCG
AACAACTACGTTCCATATGGGAATACAGGGGGTTCTCCAAGCCGATATGG
ATAAAGTTGAAGATATCATAAATTCGGTTCTATTAGGCGTGATTAGAGAT
GGGTTTCCCAGTGAACGAATCGCATCATTGATTCATCAAATAGAACTTGG
ACTGAGACACGATAAAGCTAATTTTGGGTTGAAATTGATCATGGGGTTAA
GTTCTGGTTTAAATCATGATTCCTCCTTAGAAGATATATTAAAAAGCCTT
GAATATGTGAGAAAAATCAAAAATGATCTTTCGGAAAATCCTAAATACTT
GCAAAATATCGTGAAGAAATATTTATTTGACAATCAACATCGTTTAACCG
TTTTCATGTCTCCAAAAGAAACATTCGACAAAGAAAAGCTTACACTTGAG
CAAAATTTAATTGAAAATCTCAATAAAGATTTGTCTGATAATGAAAGAAT
TTCAATAACCGAAAAATGCAAAAATCTTCTGGAAGCCCAAAGAACTACTG
AAGACGTAAATTGCTTGCCTTGTCTACAAATTAGTGACATTCCAATTGAA
TGTGAAAAATATCCATTTAAAATGAGTTCAGACCAGCGTTATTACATCAA
TGAATACGGAACAAATGGGATATTATATTTGAAAATGTTATTTGATCTCG
GTGGAATCGAATCAGCTCTCATTCCATATTTGCCATTATTTTCTTCGGTT
ATCACTAGCATGAGCACATCGAATTATCATTATCGTGAAATTGACCAAGC
TGCTGAATCGTGCTCCGGTGGTTTGGATGCGAATTTGCATTTATCTGGTA
ACATCAACGATCTCAATAGTGCTGATATCAGTTGTGGTTTACTGTTGTCA
AGTCATTGTCTGTATGAGAATTCTTTCAAGATGATGGATTTATGGAGGGA
TATTATCTGTGAAATTCAATTCAAAGATATTGATCGATTGAGTACTCTCA
TTAAAATGGAAACGACTGGTTCCTGGTCAGCGGACGGTATCTCTAATTCT
GCTCATCAATACGCAATGCGTAGAGCATCTAGCAGATTGTCTCCACTAGG
CCGATTATCTGAATGTTGGAACGGACTAGAACAAGCTAAACTAATGAAAT
CTTTAGCAAACATGTCTAATTCATCATTAGAAGAAAATATTATTCCTAAA
TTAATTCAATTAAAAGAAATAATTTTCAATAAAAATCGCCTGAAAATCGC
GATCAATTGTGAAGAAAGCGCAGTAACCGACACTTTATCACTACTGAATA
CATTTGAGCAAGATCTTATTGCTCGCCCCTACGAACAGGTTCCAATGTCA
TTAGATTGTACTATGGAAAAAAATTGTAGATTTGTACTACCTTTTACAGT
AAATTACGTTTCTACTGCCCTAAGATCTGTTCCATATACTCATTCTGATT
ATGCCAAAACACGAATTCTATCAAAGCTCTTATCTTCCAAATACCTCCAT
AATCAAATAAGAGAAATCGGGGGCGCATACGGTGGTGGGGTAACTGTGAG
TCCCGGGCATTTGAAATTCTACTCCTACAGAGATCCGCATTCCACCGAAA
CCCTTGGAGTATTTGAGCGGAGTCTCGAGTGGGCCATCAATGAGAACATA
ACCGAGCAATTGCTAAATGAGGCTAAACTATCAGTTTTTCAAGAAATCGA
TAAGCCGATCAGTGCAGGATCGAAAGGGCTCATACATTTCATGGAGGGGA
TTTCTGATGAAATCCGGCAGCAACAAAGAGAACGATTGTTCAATGTTACG
ATAAAAGACCTGAAGGAAGTTGCAGAAAGTCTGAGAAATAGTTCCGATAA
GAGCAGTGTTATCATTGGTCCAGAACAAGAGATTGAATCTGATTGGCAGA
AAATTGTATTTAATTGATGGAATAAATTTTGAGGAAACATGTAATTATAT
TCTCTTTTGAAATTGAATTTGTTGCTTTTATCAAATATTTCTATGAAATA
TACGGTTTGACTTGTG
back to top

protein sequence of SMED30035053-orf-1

>SMED30035053-orf-1 ID=SMED30035053-orf-1|Name=SMED30035053-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=976bp
MMHSQLKNLKVDNVLKGYRLVKNIYVTEFKMTALELIHEKTNAKHFHLIR
DDRNKTFGVQFRTPPPNSSGVPHILEHTVLCGSEKYPVRDPFFKMLTRSQ
ATFMNAMTANDWTIYPFSSMNTKDYFNLLSVYLDAVFKPKLSEQDFMQEG
WRLEPQNLSDISTNFNLKGVVYNEMKGVFSNSMNYLGYTVEQNLLPETYP
HNSGGDPNAIPFLSYEQLKSFHRKLYHPSNSKFFTYGDVDLEAVLSRIND
DYLQNYSKLDIDTSIRMEPRWTSPKRININCQTDPMAANPDRQSSVVVSF
VIDDSHKSYLNFTMGVISNLLLSGDNSPLYQVLIESGIGQDWAGNLCGFD
SSNRTTTFHMGIQGVLQADMDKVEDIINSVLLGVIRDGFPSERIASLIHQ
IELGLRHDKANFGLKLIMGLSSGLNHDSSLEDILKSLEYVRKIKNDLSEN
PKYLQNIVKKYLFDNQHRLTVFMSPKETFDKEKLTLEQNLIENLNKDLSD
NERISITEKCKNLLEAQRTTEDVNCLPCLQISDIPIECEKYPFKMSSDQR
YYINEYGTNGILYLKMLFDLGGIESALIPYLPLFSSVITSMSTSNYHYRE
IDQAAESCSGGLDANLHLSGNINDLNSADISCGLLLSSHCLYENSFKMMD
LWRDIICEIQFKDIDRLSTLIKMETTGSWSADGISNSAHQYAMRRASSRL
SPLGRLSECWNGLEQAKLMKSLANMSNSSLEENIIPKLIQLKEIIFNKNR
LKIAINCEESAVTDTLSLLNTFEQDLIARPYEQVPMSLDCTMEKNCRFVL
PFTVNYVSTALRSVPYTHSDYAKTRILSKLLSSKYLHNQIREIGGAYGGG
VTVSPGHLKFYSYRDPHSTETLGVFERSLEWAINENITEQLLNEAKLSVF
QEIDKPISAGSKGLIHFMEGISDEIRQQQRERLFNVTIKDLKEVAESLRN
SSDKSSVIIGPEQEIESDWQKIVFN*
back to top

protein sequence of SMED30035053-orf-2

>SMED30035053-orf-2 ID=SMED30035053-orf-2|Name=SMED30035053-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
TSQTVYFIEIFDKSNKFNFKREYNYMFPQNLFHQLNTIFCQSDSISCSGP
MITLLLSELFLRLSATSFRSFIVTLNNRSLCCCRISSEIPSMKCMSPFDP
ALIGLSIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013578Peptidase_M16C_assoc
IPR011765Pept_M16_N
IPR011237Pept_M16_dom
IPR007863Peptidase_M16_C
IPR011249Metalloenz_LuxS/M16
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003824catalytic activity
GO:0008233peptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013578Peptidase M16C associatedSMARTSM01264M16C_assoc_2coord: 473..722
e-value: 8.5E-73
score: 257.8
IPR013578Peptidase M16C associatedPFAMPF08367M16C_assoccoord: 473..722
e-value: 1.8E-62
score: 210.7
NoneNo IPR availableGENE3DG3DSA:3.30.830.10coord: 262..494
e-value: 2.8E-63
score: 215.2
NoneNo IPR availableGENE3DG3DSA:3.30.830.10coord: 537..792
e-value: 7.5E-140
score: 468.6
NoneNo IPR availableGENE3DG3DSA:3.30.830.10coord: 506..947
e-value: 7.5E-140
score: 468.6
NoneNo IPR availableGENE3DG3DSA:3.30.830.10coord: 2..261
e-value: 1.4E-85
score: 288.9
NoneNo IPR availablePANTHERPTHR43016FAMILY NOT NAMEDcoord: 4..966
NoneNo IPR availablePANTHERPTHR43016:SF3PRESEQUENCE PROTEASE, MITOCHONDRIALcoord: 4..966
IPR007863Peptidase M16, C-terminalPFAMPF05193Peptidase_M16_Ccoord: 213..399
e-value: 1.4E-16
score: 61.0
IPR011765Peptidase M16, N-terminalPFAMPF00675Peptidase_M16coord: 65..148
e-value: 7.0E-7
score: 29.3
IPR011249Metalloenzyme, LuxS/M16 peptidase-likeSUPERFAMILYSSF63411LuxS/MPP-like metallohydrolasecoord: 20..249
IPR011249Metalloenzyme, LuxS/M16 peptidase-likeSUPERFAMILYSSF63411LuxS/MPP-like metallohydrolasecoord: 529..776
IPR011249Metalloenzyme, LuxS/M16 peptidase-likeSUPERFAMILYSSF63411LuxS/MPP-like metallohydrolasecoord: 796..971
IPR011249Metalloenzyme, LuxS/M16 peptidase-likeSUPERFAMILYSSF63411LuxS/MPP-like metallohydrolasecoord: 268..530