Sperm associated antigen 17

Overview
NameSperm associated antigen 17
Smed IDSMED30035047
Uniprot Best hitSperm-associated antigen 17 OS=Homo sapiens OX=9606 GN=SPAG17 PE=2 SV=1 (E=4.07708e-58)
Length (bp)6693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sperm associated antigen 17 (SMED30035047) t-SNE clustered cells

Violin plots show distribution of expression levels for Sperm associated antigen 17 (SMED30035047) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sperm associated antigen 17 (SMED30035047) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sperm associated antigen 17 (SMED30035047) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035047

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035047SMESG000038878.1 SmedASXL_018068SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035047SMESG000038878.1 dd_Smed_v6_9301_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30035047SMESG000038878.1 dd_Smed_v4_9301_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sperm associated antigen 17 vs. Ensembl Human
Match: SPAG17 (sperm associated antigen 17 [Source:HGNC Symbol;Acc:HGNC:26620])

HSP 1 Score: 227.639 bits (579), Expect = 8.490e-59
Identity = 223/822 (27.13%), Postives = 368/822 (44.77%), Query Frame = 2
Query: 4172 LLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSS-------SSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFS---------YVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVN-QSDEEKKIADEILEKF----KVLKFSKESIANAIGSLVNINSTQGEMSSKAF-ETNAKTALPKNPSH----RKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREG---TDVNDLKDKN-EF----LNETETSEV-SLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELS------------NINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENY 6496
            LL+  ATDP  G  + TR D  +++  +D G  + +H+DGTR T ++ V +          +T  P  ++R    + + +ES +Y  VI +  +       G    +++   G +     +   +    D   ++    +S + Y     PF          Y+   TS VICE++D EG  F V  +G     + +K           LE D +  K    +S+ SM  + N   Q Y +H PR F +  DGSG ELLR  DI + L  +  + N    +E +Q  P  +  T+L    +  PW+ +    T++P  L  R  +TFP  E KT GPPFG  + KGL I S  +    V  P    +    L   Q RQF  +  I  +V+      L DY   IL++    +++ + + +++EE+  A ++L+      K+ + +K  +      L ++         K   +T  K    K   H    ++    +++ +   E        +KN I+P +F S   + + S Q   L SL+K +  F    E    T V D  D N +F    ++E ++S V SL  P+   D  + + +N T+N   L K      + A +Y           EP ++P  S             + LP+YL + +P  +P    A V+D V  KV T+S+   +  +   +    G ++ P+ V  G+LKEG  Y   +KL N G +   FK+KQP  STG+ V + PGP+AAG+  +LNI ++A A   E  +   + + H ++I T  + L +P+   V+T+ NY
Sbjct: 1417 LLSFQATDPVNGTVMTTREDKVVIVERKD-GTRIVDHADGTRITTFYQVYEDQIILPDDQETTEGPRTVTRQ--VKCMRVESSRYATVIANCEDSSCCATFGDGTTIIAKPQGTYQVLPPNTGSLYIDKDCSAVYCHESSSNIYY-----PFQKREQLRAGRYIMRHTSEVICEVLDPEGNTFQVMADGSISTILPEKK----------LEDDLN-EKTEGYDSLSSMHLEKNHQ-QIYGEHVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPVQEQPGTLTITVLRPFHEASPWQVK-KEDTIVPPNLRSRSWETFPSVEKKTPGPPFGTQIWKGLCIESKQL----VSAPGAILKSPSVL---QMRQFIQHEVIKNEVKLRLQVSLKDYINYILKKEDELQEMMVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHVTEVAAHLTDLFKQSLATPPKCPPDTFGKDFFEKTWRHTASSKRWKEKIDKTRKEIETTQNYLMDIKNRIIPPFFKSELNQLYQS-QYNHLDSLSKKLPSFTKKNEDANETAVQDTSDLNLDFKPHKVSEQKSSSVPSLPKPEISADKKDFTAQNQTEN---LTKSP----EEAESY-----------EPVKIPTQSLLQDVAGQTRKEKVKLPHYLLSSKPKSQP---LAKVQDSVGGKVNTSSVASAAINN--AKSSLFGFHLLPSSVKFGVLKEGHTYATVVKLKNVGVDFCRFKVKQPPPSTGLKVTYKPGPVAAGMQTELNIELFATAVG-EDGAKGSAHISHNIEIMTEHEVLFLPVEATVLTSSNY 2185          

HSP 2 Score: 184.111 bits (466), Expect = 1.568e-45
Identity = 130/464 (28.02%), Postives = 232/464 (50.00%), Query Frame = 2
Query:   23 MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDF----GNPKSKKGKE-----APLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDM-KNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEP-PSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKT---LLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPV---------KTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTP 1345
            M+ K+ K    N +S   WE ++ AA+ N+++W  S++ ++ N  +D   I  + + +    RK F++++ + I Q IN+     G+  SKK K+     APL +E+    K+ +D  E L  P + K +K+ +L  K +D  +   +     D    +  K   KS + K +   K ++  GK  PE    VK+  +L++RG+ D   +YIDDEPDDG+  Y ++ G  +  LLA +A++G   TS++K++ + + P +     V  Q+ +   S+   ++    E  I+ LK+FW  + PVLN+ K    L +   +  + K   FP +  + ++ +K   ++FE++A LMYD+LD KRQ ++YL+  +LI +P              ++  +   P    K+     P       +    + ++ YYN+LL  +  E  S+ L +  ML+QV  T  +  P
Sbjct:    1 MAPKKEKGGTVNTSS-KIWEPSLIAAQFNQNDWQASIAFVVGNQIEDDLLIQALTVAVQVPQRKLFSMVSWQDILQQINEINTLVGSASSKKAKKPVGGNAPLYYEVLTAAKAIMDSGEKLTLPLIGKLLKFQLLQIKFKDQQRRENEKKVIEDKPKLEKDKGKAKSPKEKKAPSAKPAKGKGKDQPEANAPVKKTTQLKRRGEDDHTNRYIDDEPDDGAQHYIIVVGFNNPQLLAIMAELGIPITSVIKISSENYEPLQTHLAAVNQQQEVLLQSEDLEAEKLKKENAIKELKTFWKYLEPVLNNEKPETNLFDVARLEYMVKAADFPSDWSDGEMMLKLGTDIFENIACLMYDILDWKRQHQHYLESMQLINVPQVVNEKPVLEAMPTSEAPQPAVPAPGKKKAQYEEPQAPPPVTSVITTEVDMRYYNYLLNPIREEFISVPLILHCMLEQVVATEEDLVP 463          

HSP 3 Score: 85.1149 bits (209), Expect = 1.810e-15
Identity = 41/119 (34.45%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 2222 LDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIK 2578
            L+ +   ++R+  +W F E ++P VLLQ++ ++  +   +D Y   + +  L+V HNP +   + +   WN  LHSNVGFRNYL+ V   I DW   +EAIYQ + +N+++     E++
Sbjct:  768 LEDIKKTQQRSLMDWSFTEHFKPKVLLQVLQEAHKQYRCVDSYYHTQDNSLLLVFHNPMN-RQRLHCEYWNIALHSNVGFRNYLELVAKSIQDWITKEEAIYQESKMNEKIIRTRAELE 885          
BLAST of Sperm associated antigen 17 vs. Ensembl Human
Match: SPAG17 (sperm associated antigen 17 [Source:HGNC Symbol;Acc:HGNC:26620])

HSP 1 Score: 189.504 bits (480), Expect = 3.818e-49
Identity = 185/655 (28.24%), Postives = 299/655 (45.65%), Query Frame = 2
Query: 4610 YVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVN-QSDEEKKIADEILEKF----KVLKFSKESIANAIGSLVNINSTQGEMSSKAF-ETNAKTALPKNPSH----RKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREG---TDVNDLKDKN-EF----LNETETSEV-SLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELS------------NINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVM 6481
            Y+   TS VICE++D EG  F V  +G     + +K           LE D +  K    +S+ SM  + N   Q Y +H PR F +  DGSG ELLR  DI + L  +  + N    +E +Q  P  +  T+L    +  PW+ +    T++P  L  R  +TFP  E KT GPPFG  + KGL I S  +    V  P    +    L   Q RQF  +  I  +V+      L DY   IL++    +++ + + +++EE+  A ++L+      K+ + +K  +      L ++         K   +T  K    K   H    ++    +++ +   E        +KN I+P +F S   + + S Q   L SL+K +  F    E    T V D  D N +F    ++E ++S V SL  P+   D  + + +N T+N   L K      + A +Y           EP ++P  S             + LP+YL + +P  +P    A V+D V  KV T+S+   +  +   +    G ++ P+ V  G+LKEG  Y   +KL N G +   FK+KQP  STG+ V + PGP+AAG+  +LNI ++A A   E  +   + + H ++I T  + L +P+   ++
Sbjct:   51 YIMRHTSEVICEVLDPEGNTFQVMADGSISTILPEKK----------LEDDLN-EKTEGYDSLSSMHLEKNHQ-QIYGEHVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPVQEQPGTLTITVLRPFHEASPWQVK-KEDTIVPPNLRSRSWETFPSVEKKTPGPPFGTQIWKGLCIESKQL----VSAPGAILKSPSVL---QMRQFIQHEVIKNEVKLRLQVSLKDYINYILKKEDELQEMMVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHVTEVAAHLTDLFKQSLATPPKCPPDTFGKDFFEKTWRHTASSKRWKEKIDKTRKEIETTQNYLMDIKNRIIPPFFKSELNQLYQS-QYNHLDSLSKKLPSFTKKNEDANETAVQDTSDLNLDFKPHKVSEQKSSSVPSLPKPEISADKKDFTAQNQTEN---LTKSP----EEAESY-----------EPVKIPTQSLLQDVAGQTRKEKVKLPHYLLSSKPKSQP---LAKVQDSVGGKVNTSSVASAAINNA--KSSLFGFHLLPSSVKFGVLKEGHTYATVVKLKNVGVDFCRFKVKQPPPSTGLKVTYKPGPVAAGMQTELNIELFATAVG-EDGAKGSAHISHNIEIMTEHEVLFLPVEANIL 660          
BLAST of Sperm associated antigen 17 vs. Ensembl Zebrafish
Match: si:dkey-208b23.5 (si:dkey-208b23.5 [Source:ZFIN;Acc:ZDB-GENE-081104-362])

HSP 1 Score: 182.185 bits (461), Expect = 2.958e-46
Identity = 164/674 (24.33%), Postives = 300/674 (44.51%), Query Frame = 2
Query:   23 MSKKRNKS-------PAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKV--TRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLND---NKTLLNTPIITLVAKHLMFPVER------ENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVK----TSVAQTHENT------TPRESIKE----GVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIYFPXXXXXXXXXXXXIPLDDDDENRNKDQNSPIHVLDSITQRDREINTKNFGKNGAL-------GHELQMLVASFRHFDLLK--------------FIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPY 1885
            M  KRNKS       P    A+   WE++++AA   E+ W  SLS++     +D + I  +   +   +R+ F++++ E   + IN+ GNPK++K K+ P+ FE+ E+ K+ +D  E +    +AK IK+ +L      +KNT  T +  + K  +          + +          GK+  + P   +D KL++RG+ +  I+YIDDEPDDG  +Y +I G  + LL+A L  +G   ++++K+   RD H          + +    + S+++     L + + + L  FW  ++ VLN       L +   +  + K  + P  +      EN D ++     +FE +A L+YD LD +RQ+ +YL   +LI +P      + + Q+   +      TPR+ +      G++  P++          + ++ YY  LL  VP E TS+ L +  ML+QV  +  E     +    D  +  N    D+   +  ++               + L  D+E + +       ++  +  +D  I+T    +N  L          LQ L      FD++K               +    + +  R  + QEL+++  +   S  E+   ++LF+ E+++L+ VDE+G   IN    +    N   WD P+
Sbjct:    1 MPPKRNKSSTPSGATPTGAGAANKSWETSLSAAVFEENEWRASLSVVQVEKAEDEQLIGSLVQAVQQPMRRLFSVLSWEDTLEKINELGNPKTRKTKDVPMFFEVTEVAKAVMDAGEEMTVDLIAKLIKFQLLI-----IKNTDVTRRASELKAVEENAHVKVGLNSANKDQGGKGAAKGKKVADIPVPTKDTKLKRRGEEENTIKYIDDEPDDGPQQYILIVGFYEPLLIAVLDSMGIHVSNVIKLGLQRDEH-----SEALEDTEAEEDHQSNEDQEVETLKQKRQQELDVFWKQLDQVLNSENMGSRLSHVARLNYIVKSQLLPQAKCNTEAMENRD-QLAFGAAIFEGVACLVYDSLDWRRQYCHYLSSMRLIQVPAACKSGSPIQQSRPQSSTEVVQTPRKKVASEEDPGIRQEPESP-----VLSTEVDMRYYCDLLNRVPAEITSVPLILHCMLEQVLASEQET----KAGLCDSEERFNRSDQDIMSYMLSSV---------------LSLPQDEEQKKE-------LMKDLGMKDSSISTNQKCRNTLLINHHDERARRLQPLPV-LDDFDVVKTEADIMKQSHEWTSLMSRHTESTTDRLTRAQELLHFCTDEFTSWSELQRLLQLFVFESMSLTTVDESGC--INRSQSH--PPNPTPWDKPF 627          

HSP 2 Score: 60.077 bits (144), Expect = 3.555e-8
Identity = 38/126 (30.16%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2192 QNDEGF-QEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVE 2566
            +NDE    E+ L  L     R   ++ F E +   V  Q++  +      +D + Q R +   V+ HNP     +     W   LH++VGFRNYL++V D I+DW + +E  +Q   + QE ++ E
Sbjct:  649 ENDEQMGNEVTLTDLQETLIRRLEDYNFVEKHSADVFPQVLQSASEMYRCVDTF-QCRDNAVYVICHNPMS-QQRSCKEFWEGSLHTDVGFRNYLEYVADSISDWTKQEEEKWQ---MEQEKKVSE 769          
BLAST of Sperm associated antigen 17 vs. Ensembl Zebrafish
Match: si:dkey-208b23.5 (si:dkey-208b23.5 [Source:ZFIN;Acc:ZDB-GENE-081104-362])

HSP 1 Score: 92.8189 bits (229), Expect = 6.734e-19
Identity = 78/317 (24.61%), Postives = 137/317 (43.22%), Query Frame = 2
Query: 4496 IFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKP-WKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNP-------MQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVN-QSDEEKKIADEIL 5419
            I+ HS    +    DG  ++++  + +     P G   YV N  ++V+C++ DSE   F V  +G   V  N       E   +  ET+ D+    ++N+              +  H PRLF +N DGS SELLR  D+ D L  +  D +     + + +S +    T+L     IK  W        ++P  L  R  ++FP  E KT GP FG ++G  L+    P  + +V            + P       +  RQ    P + +  R     K+  Y +++LQ+   ++ +++ + ++ +EK   +E+L
Sbjct:   27 IYPHSGGV-LHIDKDGGAVYSSKASKEQPERDPTG--QYVMNHRADVLCQVTDSEWNHFQVCADGHTAVTTN-------ESEKRKTETETDV----QVNA-------------GFKTHPPRLFVVNEDGSASELLRAGDVEDLLQKAYCDSSIAVLTDPLPDSQESFGITLLRPFPDIKSHWLSSKQDDDIIPTNLKSRKWESFPASEKKTPGPVFGTTLGCSLQFKEKPSKSDSVH-----------VQPVLECPEVLLVRQITQNPPVTESTRRKLQNKVKAYLEQLLQREAQWEKMQLKDPRTAQEKSHQNELL 305          
BLAST of Sperm associated antigen 17 vs. Ensembl Xenopus
Match: mstn.1 (myostatin, gene 1 [Source:Xenbase;Acc:XB-GENE-483324])

HSP 1 Score: 197.978 bits (502), Expect = 8.289e-50
Identity = 164/639 (25.67%), Postives = 288/639 (45.07%), Query Frame = 2
Query:  110 EDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPE-PPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQI------ENLKSFWTNINPVLNDNKT---LLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALP-VKTSVAQTHENTTPRESIKEGVQASPDN-----TD-----------SHMNFTFD------KFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNE----------DSIDVFKKITDNIY----FPXXXXXXXXXXXXIPLDDDDE-NRNKDQNSPIHVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDP 1882
            +D+W  S++ +IEN P+D      ++  +S  LR+ F++++   + + + + GNPK KK KE+PL +E+ E  K  LD  E LP   +AK +K+  L  K +D++       +   K +   K+ +K  +AKS G +   +  GK+ PE PP V++   L++RG+ +   +YIDDEPDDG+  Y ++ G     L+A LA++G   + I++++   +                +N  D   +   L   Q+      ++L++FW  + P+LN       LL    +  + K   FP +  + DL +  A EL E++A LMYD LD +RQ + YL   +LI +P V    +   +N  P     + + +SP       TD           S M+   +      + +  +Y  LL D+P E  S+ + +  +L+QV  T  +  P  +      P  L+           DS+ +  K   N+Y      +      +      L+  D+      Q  P   LD +                      Q ++       LL+F     + + +R A++ EL++Y  +       +++A KLF LE+L L+G+D+ G +  +  +   Q++    WDDP
Sbjct:   17 QDDWRVSIAFVIENRPEDEAHTKALSQAVSVPLRRLFSVVSWADMIRQVQELGNPKVKKTKESPLYWEVTEAAKLLLDHGEKLPLSLIAKLLKFQFLNIKQKDLQR------REAEKKAPEDKSKNKPTKAKSPGARSAGKSKGKKGPEAPPPVQKVTSLKRRGEEEETNRYIDDEPDDGAQHYIIVLGFYQPQLVALLAELGISVSCIIRISSQNY------------TSLPANEPDPTVAPEVLEAEQLRKVTLTKSLETFWKYLEPILNSGPPGSRLLEVARLHYMVKERHFPQDWGDSDLLLAYATELDENVACLMYDCLDWRRQHRRYLRNLRLIRVPSVSVGKSPDRQNVPPEAQEADPIPSSPTGRRKTQTDVAPPAASLPPSSPMHMEVEGPSGAAEVDTRFYTDLLSDLPEELQSVPVILHCVLEQVVATTEDLVPPSQAAPKPRPDGLDPNIASHMISVLDSLSLSNKEKKNLYNAFRAQEAEGERAEERRPELLNHHDKIGHRAAQAQPPSALDPVRIE-------------------QEIIGKLPLAQLLRFPQPAAERNSRRLAQIHELMHYCTSDLTPWEGVSWAFKLFTLESLPLTGLDDLGEVEGSGVE--VQQDGDIPWDDP 616          

HSP 2 Score: 142.51 bits (358), Expect = 5.189e-33
Identity = 197/832 (23.68%), Postives = 319/832 (38.34%), Query Frame = 2
Query: 3677 EIGRYITSDGRVVTIFKNELIKVLFPDGTVAXXXXXXXXXXXXDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRKWT---------ITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSS--SSTYEPGEISRAKIS--ELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQM--SYLQPD-GPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGL------EIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAM--DLQSLNKSMKLFP----------ISREGTDVNDLKDKNEFLNETETSE---VSLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELSNINLPNYLYAERPSIEPNI 6061
            E  R IT+ G V+    +   KVLFPDGT++ S  S                  I   ++P      + S     EP         ++SK +    RK           + +      ET    +S  N KP    I T    +      ++ LE N                 L++  ATDP  G  ++TR D  + ++  D G  + EH+DGTR T ++   +        E GE+    I   E + +ES  +  VI++          G    +L+   G +    S +  +    DG+ +++   ++ +  S  Q D  P SY+ + T+ VICE++D EG  F V ++G   V I        EE  +    + D             T + +  V  YD H PR F +N DGSG E+LR R++ D L +   D      RE     P I   T+L    +  PW  +     ++P  L  R    FPP E    GPP G+ V KGL      E  S+P   K    PK           +Q RQ   Y  I K+ R      L  Y   + +     K+ E++  +++E +  +       VL F +   ++ I SL  +      +   A   + +   P    HR      E  +  +E++    A ++   +P YF S  G+ F+  Q    D+  L+  +  FP              G+D     +  E  + +E S+    S  +P+   +  ++ P    +NS+       II  R    +    N  +   P++      + LP  + + +P+  PNI
Sbjct: 1190 EASRVITAQGSVIKYMLDGSTKVLFPDGTISRSPDSGP----------------IVQPQTPPPSSSGEASAHAETEPPPQSLPTTPQESKEAAAEVRKGKSGQKVPVGKMEIPEPSFPETSPLTSSATNVKPAGTWITTTSSGQQIGTRGSERLELNP----------------LMSYMATDPVNGTVMITREDQVVTVLKSD-GTKIVEHADGTRITTFYQETEMPVLRDHMETGEVPPTVIKRVEFVRVESPDFATVILNQEENICCVVFGDGTEVLATPQGTYQVHPSMSGTLTINQDGDAVYSPRTSASILASPRQKDLPPGSYIMSHTAPVICEVLDPEGNLFQVLVDGSTSVHIASGESGEEEEDGEKGLAEAD-------------TREPSPEV--YDLHVPRFFIVNADGSGGEILRNREVEDFLASCYSDPATAVIREPAPELPGIQFITVLKPLPETSPWVVQKETSDLVPPNLISRPWHNFPPIERVRAGPPLGIGVWKGLSIGAKGEARSHPPALKC---PKV----------LQIRQLSCYEPISKEQRERLQLSLKGYIDHVRK-----KEAELMEAANKEPRTENSTDLLKLVLSFPESRESSQISSLDQVQDDIVTLYESAVAPSPEPPAPPAQPHRHGGDWQEIRREIQEQKETLEA-MRGRDIPPYFQSEMGRAFLDTQVSVPDMDLLSSRLPPFPQSQEREEQQESGSSGSDPAADLNHGEGPSSSEESDEPTRSSSAPRRDTEAAKEPPPYVPENSEPNFNWAEIIPPRNYYPMARSLNFDVTGRPRK----GKVKLPTSILSSKPASVPNI 1950          

HSP 3 Score: 74.3294 bits (181), Expect = 2.846e-12
Identity = 41/123 (33.33%), Postives = 72/123 (58.54%), Query Frame = 2
Query: 2198 DEGFQEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVE 2566
            +E  Q  L D +   ++R+ S+WC+ E +   +L Q+V  +      +D Y   + +  L+V+HNP +P  + +  SW+  LHSNV FRNYL+ V + I++W R++E  YQ  +  +EL+ ++
Sbjct:  664 EEAAQTQLGD-IRRTQRRSLSDWCYWEHFNSELLKQVVCDAAQPYRCVDYYYHSQDNSLLLVMHNPMNPYHQ-SEESWDMALHSNVSFRNYLELVAESISNWVREEEEKYQEEMAVRELEALK 784          

HSP 4 Score: 54.6842 bits (130), Expect = 2.783e-6
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 2
Query: 3005 FISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDPTYSPDSQIDNFDQILEQFSHSKNICNYGASTCTFNDGITIAASNNGYSGSQLKNKSPIGA 3367
            F+ Y++ ++L    G   HLFP+DG  I+   +     ++ V+V ++    H F +HI +PT    +Q +  + +       K++  +G+ + T  +GI ++ S+ G SG   + K P  A
Sbjct:  934 FLGYNMGDNLIQVSGGSRHLFPTDGGQIQAEHVHFEKGSSFVKVKLL-KDGHTFLVHITNPTRP--TQEEQEETVWRPNITKKSVSEFGSFSATLENGIQLSLSHYGASGKGPEEKDPALA 1051          
BLAST of Sperm associated antigen 17 vs. Ensembl Mouse
Match: Spag17 (sperm associated antigen 17 [Source:MGI Symbol;Acc:MGI:1921612])

HSP 1 Score: 154.066 bits (388), Expect = 1.427e-36
Identity = 129/473 (27.27%), Postives = 230/473 (48.63%), Query Frame = 2
Query:   23 MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGN----PKSKKGKEA-----PLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGG-----KKGSQVPGK-RSPEPP----SVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKT---LLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESI---------KEGVQASPDNTDSHMNFTF-DKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTP 1345
            M+ K+ K   +  A+   WE ++ AA LN+++W  S++ ++ N  +D   I+ ++L +    RK F++++ E I Q +++  +      +KKGK+      PL++E+    K  ++  E L  P + K +K  +L  K++D +   +  K V+ +         KSE+ K  G      K  S  PGK +S + P    +V++  +L++RG+ D    YIDDEPDDG+  Y ++ G  +  LLA + ++G   TS++K++ + + P +     V  Q+      +   ++    +  I+ L+ FW  + P+LN+ K    L +   +  + K   FP +  + +  +    E+FE++A LMYD LD KRQ  +YL   +LI +P   S     E  T  E           K+  Q    +    + F    + ++ YYN LL  +P E  S+ L +  M++QV  T  +  P
Sbjct:    1 MAPKKEKPTGS--ANYKIWEPSLIAAHLNQNDWKASIAFVVGNRVEDDLLIHALDLAVRLPQRKLFSIVSWEDILQQMDEIQSLAESASAKKGKKPTSVNLPLHYEVFLAAKIIMESGEKLTLPLIGKLLKCQLLHIKSKDQQRRENEKKMVEERT--------KSEKDKGKGKSPKEKKVASAKPGKGKSKDQPEATVTVRKTTQLKRRGEDDEAKSYIDDEPDDGAQYYIIVVGFNNPQLLAIMTELGIPITSVIKISSENYEPLQTHLAAVRQQQEAVLQPEDIEAEKLKRKNSIKELEVFWKYLEPILNNEKLEIHLFDVARLQYMVKATYFPSDWSDNEQMLALGTEIFENIACLMYDSLDWKRQHHHYLQSMQLINVPQVVSEKTVLEAITIPEPPPSTAPAPTGKKKAQYEESHAPPTVAFIITTEVDMRYYNDLLNPIPEEFISVSLILHCMVEQVVATEEDLIP 463          

HSP 2 Score: 133.265 bits (334), Expect = 3.269e-30
Identity = 164/642 (25.55%), Postives = 250/642 (38.94%), Query Frame = 2
Query: 4187 ATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNV-------EKSSSSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDG--------------PFS---------YVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNP---IMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKDKNEFLNETETSEV-----SLLSPKF--QVDYLEQS----PENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNE 5980
            ATDP  G  + TR D  +++  +D G  + +H+DGTR T ++ V            +T  P  ++R    + + IES  Y  +I   TN +  + C + G               D T I  +P G        N+   Y+  D               PF          Y+   TS VICE+ D EG  F V  +G     + KK           LE D ++ ++    S+ S+  + N ++Q Y +H PR F +  DGSG ELLR  DI + L  +  +      +E +Q  P  ++ T+L    +   W  +    T++P  L  R  + FP  E KT GPPFG  + KGL I S     I A  ++ PK           +Q RQF  +  I  +V+      L DY   IL++    +++ + +   EE++                    NA   L  +      MS    E   K+ + K  +H  L V+ +Q   +                PK     Y K+F+ K+   L       +     R     N++K    +L + +T EV     S LS  F  + DYLE+     P    KN   L+         A   LY DS L +  E
Sbjct: 1440 ATDPINGTVMTTREDKVIIVEKKD-GTRVVDHADGTRITTFYQVYEDHITPSNDEETTEGPRTVTRQ--VKCMRIESSHYATII---TNCEDSSCCATFG---------------DGTSIIAKPQGSYQVLPP-NTGCLYIDKDCSATYCHESSNNLYHPFQKREQLRASRYIMKHTSEVICEVQDPEGNTFQVMADGSVSTTLPKKK----------LEDDFNV-QMEGYESLSSLHLEKN-HMQIYGEHVPRFFVVYTDGSGVELLRDSDIEEYLSLAYGESTTVVLQEPVQEYPGALSITVLRPFHEASQWIMKKELDTIVPPNLQSRSWERFPSVEKKTPGPPFGTQIWKGLSIGSKQLTNIPAPILEGPKV----------LQMRQFIQHEVIKNEVKLKLQISLKDYINHILKKEDELQEMTVKDSRTEEER-------------------GNAADLLKLV------MSFPKMEETTKSHMTKVAAH--LTVLFKQSMAS---------------APKCSPDSYSKEFLEKKWRSLSQGTSWKEKLEQQR-----NNIKKTQSYLMQIKTKEVTPYFKSELSSLFKSKYDYLEKFSKSLPPFVKKNEAKLMT--------AVPDLYSDSTLTVDTE 1982          

HSP 3 Score: 100.138 bits (248), Expect = 3.093e-20
Identity = 56/163 (34.36%), Postives = 90/163 (55.21%), Query Frame = 2
Query: 6008 INLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENY 6496
            + LP Y+ + +P  +P    A VEDPV  +V T+S+   +  +        G ++ P  V  G+LKEG  Y   +KL N G +   F++KQP  STG+ V + PGP+AAGL  +L + ++A+A   E  +   + + H ++I T  D L +P+   V+T+ NY
Sbjct: 2126 VRLPYYMMSSKPKSQP---YAKVEDPVGGRVNTSSIASAAMYNP--NASPFGFHLLPPSVKFGVLKEGHTYATIVKLKNVGVDFCRFRVKQPPPSTGLKVTYKPGPVAAGLQAELKVELFAMAVG-EDGAKGSAHISHNIEIMTEHDVLFLPVEATVLTSSNY 2282          

HSP 4 Score: 85.5001 bits (210), Expect = 1.016e-15
Identity = 41/112 (36.61%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 2243 RKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIK 2578
            ++R+  +W F E+++P VLLQ++ ++  +   +D Y   + +  L+V HNP +       H WN  LHSNVGFRNYL+ V   I DW   +EA YQ   + +EL  +  E++
Sbjct:  776 QQRSLMDWSFTEYFQPKVLLQVLQEAHQQYRCVDSYYHTQDNSLLLVFHNPMNLQRLQCEH-WNIALHSNVGFRNYLELVAKSIEDWVTQEEAKYQEAKMAEELNRIRIELE 886          
BLAST of Sperm associated antigen 17 vs. UniProt
Match: sp|Q6Q759|SPG17_HUMAN (Sperm-associated antigen 17 OS=Homo sapiens OX=9606 GN=SPAG17 PE=2 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.077e-58
Identity = 223/822 (27.13%), Postives = 368/822 (44.77%), Query Frame = 2
Query: 4172 LLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSS-------SSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFS---------YVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVN-QSDEEKKIADEILEKF----KVLKFSKESIANAIGSLVNINSTQGEMSSKAF-ETNAKTALPKNPSH----RKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREG---TDVNDLKDKN-EF----LNETETSEV-SLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELS------------NINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENY 6496
            LL+  ATDP  G  + TR D  +++  +D G  + +H+DGTR T ++ V +          +T  P  ++R    + + +ES +Y  VI +  +       G    +++   G +     +   +    D   ++    +S + Y     PF          Y+   TS VICE++D EG  F V  +G     + +K           LE D +  K    +S+ SM  + N   Q Y +H PR F +  DGSG ELLR  DI + L  +  + N    +E +Q  P  +  T+L    +  PW+ +    T++P  L  R  +TFP  E KT GPPFG  + KGL I S  +    V  P    +    L   Q RQF  +  I  +V+      L DY   IL++    +++ + + +++EE+  A ++L+      K+ + +K  +      L ++         K   +T  K    K   H    ++    +++ +   E        +KN I+P +F S   + + S Q   L SL+K +  F    E    T V D  D N +F    ++E ++S V SL  P+   D  + + +N T+N   L K      + A +Y           EP ++P  S             + LP+YL + +P  +P    A V+D V  KV T+S+   +  +   +    G ++ P+ V  G+LKEG  Y   +KL N G +   FK+KQP  STG+ V + PGP+AAG+  +LNI ++A A   E  +   + + H ++I T  + L +P+   V+T+ NY
Sbjct: 1417 LLSFQATDPVNGTVMTTREDKVVIVERKD-GTRIVDHADGTRITTFYQVYEDQIILPDDQETTEGPRTVTRQ--VKCMRVESSRYATVIANCEDSSCCATFGDGTTIIAKPQGTYQVLPPNTGSLYIDKDCSAVYCHESSSNIYY-----PFQKREQLRAGRYIMRHTSEVICEVLDPEGNTFQVMADGSISTILPEKK----------LEDDLN-EKTEGYDSLSSMHLEKNHQ-QIYGEHVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPVQEQPGTLTITVLRPFHEASPWQVK-KEDTIVPPNLRSRSWETFPSVEKKTPGPPFGTQIWKGLCIESKQL----VSAPGAILKSPSVL---QMRQFIQHEVIKNEVKLRLQVSLKDYINYILKKEDELQEMMVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHVTEVAAHLTDLFKQSLATPPKCPPDTFGKDFFEKTWRHTASSKRWKEKIDKTRKEIETTQNYLMDIKNRIIPPFFKSELNQLYQS-QYNHLDSLSKKLPSFTKKNEDANETAVQDTSDLNLDFKPHKVSEQKSSSVPSLPKPEISADKKDFTAQNQTEN---LTKSP----EEAESY-----------EPVKIPTQSLLQDVAGQTRKEKVKLPHYLLSSKPKSQP---LAKVQDSVGGKVNTSSVASAAINN--AKSSLFGFHLLPSSVKFGVLKEGHTYATVVKLKNVGVDFCRFKVKQPPPSTGLKVTYKPGPVAAGMQTELNIELFATAVG-EDGAKGSAHISHNIEIMTEHEVLFLPVEATVLTSSNY 2185          

HSP 2 Score: 184.111 bits (466), Expect = 7.528e-45
Identity = 130/464 (28.02%), Postives = 232/464 (50.00%), Query Frame = 2
Query:   23 MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDF----GNPKSKKGKE-----APLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDM-KNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEP-PSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKT---LLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPV---------KTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTP 1345
            M+ K+ K    N +S   WE ++ AA+ N+++W  S++ ++ N  +D   I  + + +    RK F++++ + I Q IN+     G+  SKK K+     APL +E+    K+ +D  E L  P + K +K+ +L  K +D  +   +     D    +  K   KS + K +   K ++  GK  PE    VK+  +L++RG+ D   +YIDDEPDDG+  Y ++ G  +  LLA +A++G   TS++K++ + + P +     V  Q+ +   S+   ++    E  I+ LK+FW  + PVLN+ K    L +   +  + K   FP +  + ++ +K   ++FE++A LMYD+LD KRQ ++YL+  +LI +P              ++  +   P    K+     P       +    + ++ YYN+LL  +  E  S+ L +  ML+QV  T  +  P
Sbjct:    1 MAPKKEKGGTVNTSS-KIWEPSLIAAQFNQNDWQASIAFVVGNQIEDDLLIQALTVAVQVPQRKLFSMVSWQDILQQINEINTLVGSASSKKAKKPVGGNAPLYYEVLTAAKAIMDSGEKLTLPLIGKLLKFQLLQIKFKDQQRRENEKKVIEDKPKLEKDKGKAKSPKEKKAPSAKPAKGKGKDQPEANAPVKKTTQLKRRGEDDHTNRYIDDEPDDGAQHYIIVVGFNNPQLLAIMAELGIPITSVIKISSENYEPLQTHLAAVNQQQEVLLQSEDLEAEKLKKENAIKELKTFWKYLEPVLNNEKPETNLFDVARLEYMVKAADFPSDWSDGEMMLKLGTDIFENIACLMYDILDWKRQHQHYLESMQLINVPQVVNEKPVLEAMPTSEAPQPAVPAPGKKKAQYEEPQAPPPVTSVITTEVDMRYYNYLLNPIREEFISVPLILHCMLEQVVATEEDLVP 463          

HSP 3 Score: 85.1149 bits (209), Expect = 8.694e-15
Identity = 41/119 (34.45%), Postives = 70/119 (58.82%), Query Frame = 2
Query: 2222 LDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIK 2578
            L+ +   ++R+  +W F E ++P VLLQ++ ++  +   +D Y   + +  L+V HNP +   + +   WN  LHSNVGFRNYL+ V   I DW   +EAIYQ + +N+++     E++
Sbjct:  768 LEDIKKTQQRSLMDWSFTEHFKPKVLLQVLQEAHKQYRCVDSYYHTQDNSLLLVFHNPMN-RQRLHCEYWNIALHSNVGFRNYLELVAKSIQDWITKEEAIYQESKMNEKIIRTRAELE 885          
BLAST of Sperm associated antigen 17 vs. UniProt
Match: sp|Q5S003|SPG17_MOUSE (Sperm-associated antigen 17 OS=Mus musculus OX=10090 GN=Spag17 PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 9.980e-36
Identity = 129/473 (27.27%), Postives = 230/473 (48.63%), Query Frame = 2
Query:   23 MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGN----PKSKKGKEA-----PLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGG-----KKGSQVPGK-RSPEPP----SVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKT---LLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESI---------KEGVQASPDNTDSHMNFTF-DKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTP 1345
            M+ K+ K   +  A+   WE ++ AA LN+++W  S++ ++ N  +D   I+ ++L +    RK F++++ E I Q +++  +      +KKGK+      PL++E+    K  ++  E L  P + K +K  +L  K++D +   +  K V+ +         KSE+ K  G      K  S  PGK +S + P    +V++  +L++RG+ D    YIDDEPDDG+  Y ++ G  +  LLA + ++G   TS++K++ + + P +     V  Q+      +   ++    +  I+ L+ FW  + P+LN+ K    L +   +  + K   FP +  + +  +    E+FE++A LMYD LD KRQ  +YL   +LI +P   S     E  T  E           K+  Q    +    + F    + ++ YYN LL  +P E  S+ L +  M++QV  T  +  P
Sbjct:    1 MAPKKEKPTGS--ANYKIWEPSLIAAHLNQNDWKASIAFVVGNRVEDDLLIHALDLAVRLPQRKLFSIVSWEDILQQMDEIQSLAESASAKKGKKPTSVNLPLHYEVFLAAKIIMESGEKLTLPLIGKLLKCQLLHIKSKDQQRRENEKKMVEERT--------KSEKDKGKGKSPKEKKVASAKPGKGKSKDQPEATVTVRKTTQLKRRGEDDEAKSYIDDEPDDGAQYYIIVVGFNNPQLLAIMTELGIPITSVIKISSENYEPLQTHLAAVRQQQEAVLQPEDIEAEKLKRKNSIKELEVFWKYLEPILNNEKLEIHLFDVARLQYMVKATYFPSDWSDNEQMLALGTEIFENIACLMYDSLDWKRQHHHYLQSMQLINVPQVVSEKTVLEAITIPEPPPSTAPAPTGKKKAQYEESHAPPTVAFIITTEVDMRYYNDLLNPIPEEFISVSLILHCMVEQVVATEEDLIP 463          

HSP 2 Score: 133.265 bits (334), Expect = 2.287e-29
Identity = 164/642 (25.55%), Postives = 250/642 (38.94%), Query Frame = 2
Query: 4187 ATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNV-------EKSSSSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDG--------------PFS---------YVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNP---IMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKDKNEFLNETETSEV-----SLLSPKF--QVDYLEQS----PENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNE 5980
            ATDP  G  + TR D  +++  +D G  + +H+DGTR T ++ V            +T  P  ++R    + + IES  Y  +I   TN +  + C + G               D T I  +P G        N+   Y+  D               PF          Y+   TS VICE+ D EG  F V  +G     + KK           LE D ++ ++    S+ S+  + N ++Q Y +H PR F +  DGSG ELLR  DI + L  +  +      +E +Q  P  ++ T+L    +   W  +    T++P  L  R  + FP  E KT GPPFG  + KGL I S     I A  ++ PK           +Q RQF  +  I  +V+      L DY   IL++    +++ + +   EE++                    NA   L  +      MS    E   K+ + K  +H  L V+ +Q   +                PK     Y K+F+ K+   L       +     R     N++K    +L + +T EV     S LS  F  + DYLE+     P    KN   L+         A   LY DS L +  E
Sbjct: 1440 ATDPINGTVMTTREDKVIIVEKKD-GTRVVDHADGTRITTFYQVYEDHITPSNDEETTEGPRTVTRQ--VKCMRIESSHYATII---TNCEDSSCCATFG---------------DGTSIIAKPQGSYQVLPP-NTGCLYIDKDCSATYCHESSNNLYHPFQKREQLRASRYIMKHTSEVICEVQDPEGNTFQVMADGSVSTTLPKKK----------LEDDFNV-QMEGYESLSSLHLEKN-HMQIYGEHVPRFFVVYTDGSGVELLRDSDIEEYLSLAYGESTTVVLQEPVQEYPGALSITVLRPFHEASQWIMKKELDTIVPPNLQSRSWERFPSVEKKTPGPPFGTQIWKGLSIGSKQLTNIPAPILEGPKV----------LQMRQFIQHEVIKNEVKLKLQISLKDYINHILKKEDELQEMTVKDSRTEEER-------------------GNAADLLKLV------MSFPKMEETTKSHMTKVAAH--LTVLFKQSMAS---------------APKCSPDSYSKEFLEKKWRSLSQGTSWKEKLEQQR-----NNIKKTQSYLMQIKTKEVTPYFKSELSSLFKSKYDYLEKFSKSLPPFVKKNEAKLMT--------AVPDLYSDSTLTVDTE 1982          

HSP 3 Score: 100.138 bits (248), Expect = 2.164e-19
Identity = 56/163 (34.36%), Postives = 90/163 (55.21%), Query Frame = 2
Query: 6008 INLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENY 6496
            + LP Y+ + +P  +P    A VEDPV  +V T+S+   +  +        G ++ P  V  G+LKEG  Y   +KL N G +   F++KQP  STG+ V + PGP+AAGL  +L + ++A+A   E  +   + + H ++I T  D L +P+   V+T+ NY
Sbjct: 2126 VRLPYYMMSSKPKSQP---YAKVEDPVGGRVNTSSIASAAMYNP--NASPFGFHLLPPSVKFGVLKEGHTYATIVKLKNVGVDFCRFRVKQPPPSTGLKVTYKPGPVAAGLQAELKVELFAMAVG-EDGAKGSAHISHNIEIMTEHDVLFLPVEATVLTSSNY 2282          

HSP 4 Score: 85.5001 bits (210), Expect = 7.104e-15
Identity = 41/112 (36.61%), Postives = 65/112 (58.04%), Query Frame = 2
Query: 2243 RKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIK 2578
            ++R+  +W F E+++P VLLQ++ ++  +   +D Y   + +  L+V HNP +       H WN  LHSNVGFRNYL+ V   I DW   +EA YQ   + +EL  +  E++
Sbjct:  776 QQRSLMDWSFTEYFQPKVLLQVLQEAHQQYRCVDSYYHTQDNSLLLVFHNPMNLQRLQCEH-WNIALHSNVGFRNYLELVAKSIEDWVTQEEAKYQEAKMAEELNRIRIELE 886          
BLAST of Sperm associated antigen 17 vs. TrEMBL
Match: gnl|BL_ORD_ID|15734200 (tr|R7TXJ7|R7TXJ7_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_206219 PE=4 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 1.581e-149
Identity = 548/2041 (26.85%), Postives = 906/2041 (44.39%), Query Frame = 2
Query:  104 LNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKV-----TRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVL---NDNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALP--------VKTSVAQTHENTTPRESIKEG-VQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSID--VFKKITDNIYFPXXXXXXXXXXXXIPLDDDDENRNKDQ----NSPIHVL---------DSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPYMILNDVAQSIIDEENKTLKXXXXXXXXXXXXXXXXXPALSFIKNENFTEGILKXXXXXXXXXXPENIKSRRKSSVHF---LETERVESP----------------TMSTETQMDIMAFINNQNDEGFQEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQEL-QIV-ETEIKETEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQELSLIVPGSLKAQKLXXXXXXXXXXXXXXXXXXXRQLSAQK-KTEKDLAKNVEKTKDSKRPXXXXXXXXXXXXXXFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDP-----------------------TYSPDSQIDNFDQIL------EQFSHSKNICNYGASTCTFNDGITIAASNNGYSGSQLKNKS----PIGAPNDEISSHRSNDLTVNGNKEEIFQNDTNETNEKIITQKNPFVNHMDYIDSPN------------IILTTPDGVQVSVGYESA-----ENENQRNLLLFMCKFESSLKPSVPPELSSIQA---------PEIGRYITSDGRVVTIFKNELIKVLFPDGTVAXXXXXXXXXXXXDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRF-TKYFNVEKSSSSTYEPGEISRAKISELLLI--ESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQK----YDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTIL--HSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKL---IDYNKKILQQRQLYKDLEIVN-QSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKDKNEFLNETETSEVSLLSPKFQ 5848
            L +D W+ S++ +I +  +D E ++++   I+ G R+ F++ T +++ +++ND GNPK+KK KE P   EICE  K HLD  E +P P LAK IK+ +L  K +D+K      +    K    KKA    ER KS G  KG +     +P+PPS + D KL+KRG+ D D +YIDDEPDDG   Y +I G     LL+ LAD+     SI++       R I  P +   E  ++++ ++     E   + + E   + +  FW +I  ++   +    L +   +  + K  + P   E+  LK +  ++++E +A +MYDL+D KRQW+NYL+   L+ +P          T    +    TP  ++  G    S    DS       + ++ +Y  L+  VP ES+SI L M  ML+QV  T  ++ P      S+ P     D +D  V   I+   +             K+ L +D++     Q    + P  ++         D IT+R   +  K      A+  EL ML       DL KF    +Q++++RAA LQEL+++    GL+ +EI +A+  F+LE + LS  +E+ ++     D  F + N   WD P+     +  +  DE+   L + +                 S  +      GILK       S++P     +   SVHF    E   V  P                + S  T  D M+ +N++                +KR   +WCF E ++P +LLQ+++Q++   PY+D Y  RR +  LVVLHNP H     +   W   LHSNVGFRNY+D V   I +W R +E+ YQA +L +E+ QI+ + E   +          ++  K     +    +S  SS+ E  T     I  GSLKA K +Q+K+   + E+E +K++KR  SA+K K+ KD+  + +++K  KRP S+ S+KS+  K          D+    E+  D    E +WPFI Y + N+L H  G +  LFP+DG  I+  K + +  T SV+ +V+    HVFT+HILDP                       T   D    N ++ +      E+ +    + ++G+ +  F+DG+ ++ S  G SG  +        P  AP     S +  D +   +K +    D   T +    +++  +   + +++P+            + L+ PDG+ ++   ES+     ++E+ R+LL         ++ S P +   IQA          E+ R I +DG V     +  I V+F DG V+    S        +          + +E+P  K+ +++S    V  + P     VE+ +    +   W  TL +G   E VA+    ++  P+                                       +      ATDP TG+T+ TR D  + +   D G  + EH+DGTR  T    +E    +  E GE    ++  L LI  E   Y  V  D       T  G+   + ++  G +   H D   +    DG  ++     +++    P     Y+   +S+VICE +D+ G  F V+  GE  V + +  D      S  +ET+                   +D +QK    Y QHAP  F I+ DGSG+ELLRY+D+   + +++ D +     + + +   +I  T+L  + +   + W   Y   T++P GL  RD K+ PPKE+   GP FG +VG+GL I S         K +         + +Q RQ   Y  +  ++R+     L    ++ KK L+Q++L   L++++ +SDEE+  A+++  +  V   ++  +      +          + +A  ++A                 EQ+K    +E E + +LK H VPKYF S  GK F+  QA D++SL K  +L   +R G        +N  +++T +     +SP  Q
Sbjct:   87 LKKDKWNASVAFVIGHQAEDYEHLSHLVAAINAGTRRLFSIFTKDELYEMVNDLGNPKAKKAKEIPQFSEICEPCKMHLDNGEDIPMPLLAKLIKFRLLDIKQKDLKRRETEKRIGGDKDKGGKKADKGKERTKSPGKGKGGKK----TPDPPSARGDTKLKKRGEEDIDNKYIDDEPDDGPQHYIMICGFHQPRLLSHLADLSICVDSIIRFKSEDYARFIPDPTDEDLEMDKDEKMLA----LEEVRSQVKEKLSKEIAQFWKDILLIMRAASPASPLHDVAQLEYIVKESIIPPNMEDNGLKTQFGVDMYEDIACMMYDLMDAKRQWRNYLESLHLLPVPEYGLPPPSPDTKDGTSQPAVTPAPTMMTGKADNSSQPGDSCEPKLSHEVDMRFYQDLMNTVPQESSSIPLIMHCMLEQVVATEEDREP-----PSETPHPTRADGLDDTVASHISSMAF-------------KLALSEDEQQALSQQLDTVSCPAPLMKQPLLLSYHDDITRRLNHL--KPVDDFDAMKAELSML-GFLPMADLAKFKQPSEQLAKERAASLQELLHFCITGGLTQLEIEHAMCQFVLECVELSETNEDSIVCQRPRD--FPQYNIP-WDHPFPFFQGMILA-CDEDAIPLDESS-----------------SSTRKSRPGSGILK------SSRTPSATSRKPIHSVHFERDGEGNEVVQPGDDKTPADTPSNYDHGSGSVPTNTDPMSVVNDK---------------AQKRVLDQWCFAEHHKPKILLQVMNQALSTHPYMDTYYHRRDNSLLVVLHNP-HSSELQSFTKWEHSLHSNVGFRNYMDHVAGSIEEWTRAEESKYQAAMLAKEVDQIMNDAEEASSPPTSGKGGKKKERSKSPKKSTSRAKSSSRSSSVERPTSGNMYIRQGSLKAWKEDQDKVRAEEDEKERQKQEKRAKSAEKRKSAKDIGDDDKESK--KRPGSRQSSKSRQSKEDIVQ-----DQTLSDEVAPD----EPFWPFIGYDVGNNLIHASGSLTTLFPADGGQIKTEKTEFIQGTLSVKTNVL-KDGHVFTVHILDPKKGGEDEEAKEEEEEAMEKGELETQEKDESDKNGERKVVAEKQEEKKAEKPCVGHFGSFSALFSDGLNVSLSTYGASGMPINGSKYEPVPYIAPAVRSPSPQGKDGSPTKHKRDK-SKDKAATPDPSAQRESELLAKEEEVEAPSEPEPVPHQPFQQLFLSCPDGLNLTYFLESSLGIHPKSEDSRHLL---------VRQSYPYKTKGIQACEGARKNAMTEVSRIINADGTVTKTNTDGTITVMFADGAVSHYCTSSALLPGSRNASPTRVGSAKSDRETPTRKKGSRRSGKKEVVLEQP-----VEEDRADKAF---WITTLPSG---ERVASQGRTYSKVPV---------------------------------------KMAKICVATDPQTGQTMHTRDDHVVTIYMPD-GSMVVEHADGTRINTLQHQLELKVEAEGETGEDGETRVKNLKLISVECPGYATVKFDSDAGHCSTELGNGDCVYTSLDGTYDLHHHDGGCLHMETDGTSVYFPMPANEVDMPNPTQQLQYIMRHSSDVICETVDNMGNTFTVSNAGEGSVVLAQGQD------SVAMETE----------------GGESDLIQKQVVTYKQHAPHFFIIHKDGSGTELLRYQDVASYVSDAESDPSTAILMDPLPDHMGVIGITVLKPYMNGISESWLKNYEMDTIIPAGLISRDFKSVPPKEVVKPGPKFGTNVGQGLAIGS-------AMKGQPVLPMLKCPSVLQLRQILQYKPVTSELRTKLGTSLKMYAEFVKKRLEQQEL---LQVIDPRSDEERSAAEQLQGQVLVPGLAQGDVKGLYEKVTAPPVPSPPPNPQAKRSSAD---------------WEQDKRILAEEKECKRALKQHDVPKYFDSEIGKSFLLSQAPDMESLTK--QLADDTRRG--------RNPVISQTSSESSPQISPDQQ 1925          

HSP 2 Score: 113.235 bits (282), Expect = 6.750e-21
Identity = 60/125 (48.00%), Postives = 77/125 (61.60%), Query Frame = 2
Query: 6002 SNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIA 6376
            S   LP Y+ AERP   PN     VEDPVRRKV T SL G +   + L +  RG ++ P  ++ G LKEG  Y   + L NTG ++  FK+KQP  STG+ V +  GPIAAGL+R+L + IYAIA
Sbjct: 2065 SGTLLPGYMRAERPGAVPNDKYIEVEDPVRRKVNTISLTGATPHGKHLLKHMRGCHLLPEAINFGWLKEGNTYAMSVLLKNTGVDTCRFKVKQPPPSTGLNVIYKLGPIAAGLNRELIVEIYAIA 2189          
BLAST of Sperm associated antigen 17 vs. TrEMBL
Match: gnl|BL_ORD_ID|23861352 (tr|V3ZPH0|V3ZPH0_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_232733 PE=4 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 6.958e-113
Identity = 453/1684 (26.90%), Postives = 760/1684 (45.13%), Query Frame = 2
Query:   23 MSK--KRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKV-TRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLY----EMQIEN-LKSFWTNINPVL---NDNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKE----------GVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIYFPXXXXXXXXXXXXIPLDDDDENRNKDQNSPIHVLDSITQRDREINTKNFGKNGALG-HELQMLVASFRHF-DLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPYMILND-------------------------VAQSIIDEENKTLKXXXXXXXXXXXXXXXXXPALSFIKNENFTEGILKXXXXXXXXXXPENIKSRRKSSVHFLETERVESPTMSTETQMDIMAFINNQNDEGFQEILLDYLSNL---RKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIKETEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQELS-LIVPGSLKAQKLXXXXXXXXXXXXXXXXXXXRQLSAQKKTEKDLAKNVEKTKDSKRPXXXXXXXXXXXXXXFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDP----------------TYSPDSQIDNFDQILEQFSHSKNIC--------NYGASTCTFNDGITIAASNNGYSGSQLKNK--------------SPIGAPNDEISSHRSNDLTV--------------NGNKEEIFQNDTNETNEKIITQKNPFVNHMDYIDSPNIILTTPDGVQVSVGYES-----AENENQRNLLLFMCKFESSLKPSVPPELSSIQA----------PEIGRYITSDGRVVTIFKNELIKVLFPDGTVAXXXXXXXXXXXXDDEVEEFKIENINVKESPNSK--RKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSS-SSTYEPGE--ISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDV 4702
            MSK  KR KS  A    G+KW+  + +  L E+NW  +++ ++ N P+D   I  +   +  G RK F+LI+ + + Q + D GNPK KK KE P NFEICE  K HLD  + +P P LAK IK+ +L  K +D+K   +  KK +   + + +   K ++     GK  S+  GK++PEPPS K+ +KLRKRG+ D + +++DDEPDDG+  Y +I G     L   L+++G     I+++ ++D  I           Q    N  D++ ++  L       Q++  LK FW +I  VL   +DN  L +  I+    K ++FP   E+ + K+     LFE +A  +YDL+D +R +  YL+  KL  +PV   V Q H      +S              V A+    DS         ++ YY+ L+  VP ES S+ L +  ML+QV  T   K P  E         LN         +   +   ++    L  ++ +P            N+P   L      +  +   +     +L   +++  +  F  F +++K       ++++RAA+LQELI++  N  ++  EI+ A K F+ E + L+  D NG I     +G    ++   WDDPY                              +   ++  E ++ +        D++S  +S P+ S  K     +GILK     SRSQSP +    R +SVHF++ E    P  + E    +  F   + ++  ++ + D +  +   +KRN  E+C  E+YEP+VLLQ++  + Y LP+++ Y  +R    ++VLH+P H     +H  W+  LHSN+GFRNY+++V + I +W ++++A Y A +L++E++ ++ E +   +  +  K  +  KK   ++++S  TSR SS E+ ++++ S  I  GSLKAQK       +   + + ++E+K +LS  K+++    K  ++ K+ KRP S+ S KSKT     E   E+   + ++E        E+YWPF  + + N+L H  G+   LFPSDG  IRV + + +  TTS+  +V+    H+F++HIL+P                    + +  +  +  EQ    K+          ++G+ T T NDG+T+A S  G +G   + K              +P+  P       +                    +G+KEE  ++D N +N+                    + LT PDG+ V    ES     A++   R LL         +K S P +   IQA           E  R I SDG VV    +  ++VL+ DGT++        + S++   +          +SP  K  R    SK++S + Q       V++ +  C    +W  T  NGE + +V    ++ + KP                                          ++   A+DP T +++ TR D  ++ VS   G  + EHSDGTR T Y+           E GE  IS  + ++ + +E   Y  V  + +  +  T  G+  ++     G ++ +H D   I+   +G + + A ++     LQ +    YV    ++VICE +D+EG  F V   G+F V
Sbjct:    1 MSKAGKRVKSGTAP-QGGSKWDIALQSTPLEEENWKSNITFVVGNSPEDYSHIKLLGQAVLGGTRKLFSLISKDDLIQEVQDLGNPKVKKTKENPQNFEICEACKLHLDLGDEIPLPLLAKLIKYRLLNIKQKDLKRR-ELEKKANAPEAASGQDKGKKDKGGKDRGKSPSKKGGKKTPEPPSAKEGSKLRKRGEEDVESKFLDDEPDDGAQHYVIIYGFHQPHLFTHLSEVGINVDCILRISSQDYSI---------FQQPSTENNPDEKAANAELILKEERKQLKKELKKFWKDILLVLQKNSDNSKLHDIAILDYEIKTILFPSNIEDPEQKLNFCTTLFEDVACKIYDLIDSRRLYHTYLENLKLSHVPV---VGQPHIQHIDGQSTASAATPAPGGAAPVSATALPPDSATEAP--SVDMRYYSDLMNCVPQESASVPLILHCMLEQVVATEENKEPPSEQVPPQRSDGLNPQLASYLSSMAFKLALSEDEHKSLGETMDLP--------EIPPNAPPQPLLMNYHDENTVRCHHLKPQYSLDPKQVEEDMLQFSPFSEVVKLERPTTPVAKERAARLQELIHFCANEMMTQAEIDRAFKQFLFECMDLTTTDSNGFIMTLEGEGL--EHSAIPWDDPYPFFKGMIPHHEKHLDIQVPSESSASSYEEKINNDMVVPETRSSRVGFVDDIIDNVSQTKSRPSSSDSK-----KGILK---PRSRSQSPTHGGRSRSNSVHFMKEEGEPLPLNADE----LKEFEGIKEEDIKEKTIEDSMMEVVDAQKRNLDEFCISEYYEPNVLLQVLRDAAYYLPFVNTYYNKRDHSLMLVLHSP-HNSELQSHVDWHTELHSNMGFRNYIEYVQESIGEWLKEKQAEYDAKMLSKEVEKLQFEDEAAALLAEKMKQPDSPKKSSRARTKSPKTSRNSSVEKLASEKSSQFIRAGSLKAQK-------EEADKIKAEEEEKERLSQMKRSKSSQKKEEKEEKEKKRPGSRGSAKSKTSTKEIEPQQESIPLDLHEE--------EKYWPFTGFDVGNNLIHVSGITTSLFPSDGGQIRVERTEFVQGTTSINSTVL-KDGHIFSVHILEPKEDEIISEDEEEEQQLDKDEEEEKKDLPEKCEQEKFEKDGAEGKKVVKSSFGSVTATLNDGMTLAVSQFGSTGEVPEGKKYEPQPYMPPVSSPTPVSQPASPGKGKKGEKTKEKGVPTPEPPQIQAEDGDKEEDTKDDQNSSNQSFQ----------------QLFLTCPDGLHVRYFLESSIGIKADSVLDRRLL---------VKQSYPYKTKGIQACESRRKKYMLSEQSRVIASDGTVVKTMVDGTVEVLYADGTISSRVGKWPLASSRNSSPQR---NTSGRSDSPTKKNVRSKGSSKNLSAKKQ---EEAPVDEEEKKC----RWITTYPNGEKY-SVRTDGTVEDLKP------------------------------------------VMICLASDPETRQSMATRDD-KVVTVSYPDGTTIVEHSDGTRITTYYCESAVPLDDEDETGETPISDVRTTKFVKVECPAYATVEFNCSTSENLTIFGNNTSVNVFPDGFYMIQHIDGGRIQVDTEGTVTYYARLDRPKDNLQRE--LQYVLRHNADVICETVDTEGNIFNVKHTGDFSV 1548          

HSP 2 Score: 134.806 bits (338), Expect = 1.850e-27
Identity = 67/169 (39.64%), Postives = 106/169 (62.72%), Query Frame = 2
Query: 5993 PELSNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENYQ 6499
            P   +++LP  +   RP+ E NI    +E+PVRRKV  T + G +E  +      RGLN+ P +V+ G+L+EG  Y++ + L NTG ++  +KIKQP  +TG+ V + PGP+AAG+  +L + ++AIA    +  S V  +EH LQITT TD+L +P+   ++TA+ Y+
Sbjct: 1993 PRSDSVSLPESIMGARPNAEKNIKFLEIEEPVRRKVKNTMITGATEKGRAELEDMRGLNILPDKVNFGVLREGYTYSYSVYLKNTGVDTCRYKIKQPPPATGLKVIYKPGPVAAGMRAELRLELFAIAVG-VEGESGVGGIEHNLQITTETDKLYLPVRATILTAQEYE 2160          

HSP 3 Score: 67.0106 bits (162), Expect = 8.164e-7
Identity = 64/259 (24.71%), Postives = 110/259 (42.47%), Query Frame = 2
Query: 4961 CREEIQNSPKIIAHTILHS--DSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVN-QSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNI--------NSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQA 5704
            C++ I   P +    +L        + W  +Y   +++P G+  RD+   PPKE K  GPPFG +VGKGL I S        QK  +        + ++ RQ   Y  I   +R      L  Y + ++ + +  + +++ + +S +E+ +A ++           +S+A  +GS             +T  E+   A      +  P     RK     E+++     E+E RA L+N  +PKYF S  G  F   Q+
Sbjct: 1558 CKDPITECPGVFGINVLKPFLGGPSQQWFKDYDLDSIIPNGIRSRDLTNLPPKEYKKPGPPFGTNVGKGLAIGS-------TQKTSRRVAILKCPDILEIRQLVQYEPITDPLRIKLCNGLRSYAEYVMARNKESEMMQVNDPRSKKEQMLAHDL----------NKSVARQLGSGCEELQEQPSYDPTTVKEIYESATTAPEPSPPPTPMPKRKAS-DWERDQKEIALELEGRAMLRNKTIPKYFDSELGMAFFQLQS 1798          
BLAST of Sperm associated antigen 17 vs. TrEMBL
Match: gnl|BL_ORD_ID|21420177 (tr|A0A430QR50|A0A430QR50_SCHBO Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0006870 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 7.716e-88
Identity = 433/1671 (25.91%), Postives = 700/1671 (41.89%), Query Frame = 2
Query: 2231 LSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSN-VGFRNYLDFVHDKITDWNRDQEAIYQANLLNQE-LQIVETEIKETEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQEL---------SLIVPGSLKAQKLXXXXXXXXXXXXXXXXXXXRQLSAQKKTEKDLAKNVEKTKDSKRPXXXXXXXXXXXXXXFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDPTYSPDSQIDNFDQILEQFSHSKNICN----------YGASTCTFNDGITIAASNNGYSGSQLKNKSPIGAPNDEISSHRSNDLTVNGNKE-----EIFQNDTNETNEKIITQKNPFVNHMDYIDSPNIILTTPDGVQVSVGY-----------ESAE------------------NENQRNLLL-----FMCKFESSLKPSVPPELS-------SIQAPEIGRYITSDGRVVTIF-------KNELIKVLFPDG-------TVAXXXXXXXXXXXXDDEVEEFKIENINVKESP---------------------------NSKRKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRK-----WTITLSNGEVF-----ETVANLNSIFNPKPLIETIETKLDDEATTDENNDILE-ANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGI---FLCEHSDGTRFTK-YFNVEKSSSSTYEPGEISRAKISELLL-IESKQYPAVIIDLTNEKIETRCGSMGALLSN----SCGHHIFKHSDNTEIEYRPDGEIIFTA------SVNSQMSY----------LQPDGPFSYVFNPTSNVICEIIDSEGTEFIVN------INGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTND-SNDNVQKYDQHAPRLFTINP-DGSGSELLRY----------------RDIVDTLV--------------NSDIDENYF---HCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTF-------PPKEIKTDGPPFGMSVGKGLEIY------------SNPIMAKNVQKPKKSFRQDHWLNP------MQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQ-----RQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGS--LVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKDKNEFLNETETSEVSLLSPKFQVDYL-------EQSPENSTKNSKN--LLKPKLI----------IQKRATN---YLYYD-----------SNLFIPNEPKRLPELSNINLPNYLYAERPSIEP--------------NIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIY-AIANNLEKNSSNVSLLEHFLQITTNTD 6448
            L+  +  + +EW  EE  EP+VLLQ +H   Y+ PY+D+Y +   D   ++ H+PF    + NH++W  W H N +GFR YL  +   I +W R+QEAIY+A  L+ E LQ  +     TE            K  K +KS    +  GS +EE+  Q             I+PGSLKA + +QE+    K  EE +KE KR  SA+K TE++++   ++    KR  S        K    ++S +       Q++ T R   E +WPF  Y + N L H  G V H+FP+DG  I+  + +      ++RVS++    HVFTIH +D    P+   +N ++I      ++  C+          + + T  F+DGI +A S       ++    P   PN +I S++ N    N + +      I  N  N  +    TQ  PF  H        I L+TPDG QV+V +           E AE                  N+ Q N LL      + K  SS +  +   ++       S +  E+ R+ITSDG V+ I         +  I++L+PDG       TVA      ++        +E K + IN++  P                             K+    +++ +    T + T L   S P    +       W ITL +GE F     + + N+ S     P     ++   +    D  ND ++    P++   SF+            A DP+TGETL TR +  L+ V          + +H+DGTR T+     EK +         S A   ++ +  E   +PAVI++ +  + E          S       GHHI +H +  ++   PD  + +T+      ++N    Y          L+   P   V+   +   C ++ +      V+      +N  +  +I  +N++  E++   +  ++D     ++N      N+ SND    YD+H PRLF  +P      EL+ +                R  ++ L                S  D +++   + RE +QN+P++   T++ S    +  KY Y ++ ++P+GL+ RD +T        P  +I+      G   GKGL+I                +     QK K   R++H  N          R+F  +P I  ++   F   L  Y +  L +      Q    L  + QS E +   D I     VL  +K+ I++ I +  + +++S+  + ++ + E +  T    +P+ ++   +L QE     ++   RA+L++   P YF S  G  F+  Q  D++ L+K   L P        N  ++    L E  T  +S   P      L       E   E  T N+ N  L   KLI          +  R T    + YYD            +  +P +   L +   + +P YLYA+RPS+                N+ QAL+EDPVRR+   TS+IGG    Q   R+ RGL + P+R++ G+L  G+  +F +KL+N GPE++ FKIKQ    +GI V + PGPI AGLSR+L I +     + LE   SN  + +  LQ T N D
Sbjct:  876 LNKAKNIHLNEWSVEEKLEPNVLLQRLHSLNYEKPYLDVYKRLYDDSLFIISHHPFDRTIRSNHYTWCSWFHVNKIGFRPYLQLIEGHIRNWTREQEAIYEAAKLSAEILQTDDIHGSSTEQSPTKPIKKNSPKSQKGAKSNRNRSISGSESEESIVQNEIKSLLGDPNEFILPGSLKAAQRDQERAKLKKDLEERQKETKRVKSAKKPTEREISPTEKRKTSGKRNKSPHPKSPVHKNDQDDESIQP------QQLRTKRTSNE-FWPFTGYDISNLLPHITGEVTHMFPTDGGTIKTQRNEIPTGQANLRVSLMK-DGHVFTIHKIDGPPEPNIPYENPNEIKLNDQENEEGCDGLKTFSSPELFSSITACFSDGICLAVS-------RVNKIDPQPNPNYQIESNQLNKFNKNSDSDNNNDCRIRPNSVNLNDNSETTQNKPF-QHF-------IHLSTPDGAQVAVYHCVNEVSNRAIDECAEENIPSKEALINPESKCQTNDGQNNALLNSQHSILLKL-SSARTCINDSINIDDLKKRSDKEYEVTRFITSDGIVIQILMPSCTSSASCAIRILYPDGAIMERGTTVAEELRRNENPQFTLSNPQEEKQQEINIQSEPAMPSALQVINIQPRKSSSKRKSSRRKIEEKKTEDDARNETCLVSTDIATALTPSSTPRSTTNDSDDNLPWLITLLSGERFWFKLIKPLTNIGSSVEDTPTTNASDSVSHESVNLDTLNDAVKYETYPSKPMESFR------------AYDPATGETLYTRPEDNLIAVEPHPDSPFKLIVQHADGTRLTQILLASEKLNDECNSVDLNSNANKPQMFIRTECVGFPAVILNKSTGEFEISLFGKSQFSSTFHFTPKGHHILQHFNGGQLNINPDSSVYYTSQSLEIVNLNEPTVYEMRSKDMESLLECTDPHKNVYTVDNWANCNVLLTGNKRHTVDEDLNTEVNQIYSTEITNENNQQIEDSFHTVLQNKDNADNNEINE--PHNNEISNDGCCLYDEHIPRLFYFDPIKRIAIELIHHEEYKCLLRRAHNIQSPRHHINKLTMEEKLMYMNTKSQNTSTSDSDFYEGLYLREPMQNNPRVFGLTLMKSLPTNETGKY-YVQENIIPEGLSSRDFQTITHSSNSNPHSDIRK----LGERAGKGLDIIMPSLEYLGLKLPETNVTLLPAQKGKSIKRENHKFNAYYQALHANVRRFTEFPLITSEINQRFLGVLCAYTEYYLNRLNEWCSQQPTRLSEIMQS-ELRLFLDPIPTVSSVLSRNKQ-ISDPIENENITDVSSSPSQQTTVSQEISQPTN-KYSPARQEAFKLLRQEIEKAMRD---RAALRSTHTPNYFRSQEGIGFLLSQIPDVKKLSK---LVPELSNLPSQNPKQNDKSTLTEQSTLILSDSPPNIPSPLLRTIENDNELITEKITGNTNNSHLTMNKLIYNDGYKTGMKMSTRETTKKCFYYYDIDPSQIKMIDNHSTHVPLDAVALAKQKQLRVPKYLYAKRPSLPKCNNGVNGISHATNFNVKQALIEDPVRRRALFTSIIGGPPFGQFSLRRMRGLRLTPSRINVGVLPYGVTRSFSVKLVNWGPETAYFKIKQLPIQSGIRVFYTPGPIPAGLSRRLAIEVSNQRQDRLESYPSNQQIDDRGLQQTANHD 2494          

HSP 2 Score: 144.821 bits (364), Expect = 1.834e-30
Identity = 122/459 (26.58%), Postives = 225/459 (49.02%), Query Frame = 2
Query:   35 RNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQ---------IENLKSFWTNINPVLNDN--KTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESI---KEGVQASPDNTDSHM--------NFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTP 1345
            ++K+P A+I   + WES +    L+++ W  SLS++  ++  + E I+ +   I  G R++FT+IT E +   I  F   K+K  K+AP  FEIC + K+ ++  + L    L+K +K++  + KT D+K        +   + K     D  ++      K G++V   +S EPP  K  +KL KRG+   + +Y+ DEPD+G SRY ++       LL  L  +     SI++    +H+ ++   + +  +++       + S+ +L +M+          E L+ +W   + ++ D+    L N   +    K  + P +    + +      +F  ++ ++YDL+D +RQWKNYL+  K+I LP+   +   +++ +  + +   K  +   PDN D               D  ++ +YN +LQ +PIESTS+ L + A+L+QV     E  P
Sbjct:    9 KSKTPRASIGVAD-WESKLCDLNLDDEVWKMSLSILSPSLLTENEIISILAASIVNGQRQRFTVITYEDVLNQI--FTQCKAKSQKDAPEFFEICNVAKNAIETVDELNPQTLSKVLKFMFNSIKTLDIKQQS-----LRKSIPKTNHMEDTKKKENPKDKKSGAKV--IKSQEPPVNKAKSKLYKRGEEALEEKYLGDEPDNGISRYILLVNFEKCGLLEELCRLKIDIHSIIR----LHVNDQKQLQILITKQKAEKMWGSKGSEQDLEQMRSEEEALLLAEEQLRQYWRTTSILMRDHVYDRLGNIATLDYNVKTELLPDDLNGAENRASFGATMFNEISTILYDLIDFRRQWKNYLEHIKVIHLPICPPLLNENDSVSSNQLLKMSKPAIGLHPDNLDKTAIKSEDCGDILAEDFVDMRFYNEILQGLPIESTSVELILHAVLEQVIANENEILP 453          
BLAST of Sperm associated antigen 17 vs. TrEMBL
Match: gnl|BL_ORD_ID|17229310 (tr|A0A433UDD6|A0A433UDD6_ELYCH Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_000422 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 6.462e-87
Identity = 263/903 (29.13%), Postives = 434/903 (48.06%), Query Frame = 2
Query:   23 MSKKRNKSPAANI----ASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVP---GKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLN---DNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPV----KTSVAQTHENTTPRESIKEGVQAS--PDNTDSHMNFTFDKFNID--YYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIYFPXXXXXXXXXXXXIPLDDDDENRNKDQNSPIHVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPY----MILNDVAQSIID------EENKTLKXXXXXXXXXXXXXXXXXPALSFIKNENF---TEGILKXXXXXXXXXXPENIKSRRKSSVHFLETERVESPTMSTETQ---------MDIMAFINNQNDEGFQEIL-LDYLSNLRKRNFSEWCFE---------------EFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIV 2563
            MSK   +  + ++    A G KW+  I++    E++W+  ++ ++    +D++ I  +N+ + TG RK F++IT E +   + D GNPK+KK KE P N EICE  K ++D  E +P P LAK IKW +L  K  D+K       +     +KA     K  +    GGK+ ++ P   GK++PEP + K  +KLRKRG+ D D +YIDDEP+DG   Y +++G  D  +   L +I     S++ +    + P +                D++       E+Q E L  FWT++ P+L    D  +L +   +    K LM P +  + + K++ +  LFE +AV++YDLLD +R +K YL+  KL  +PV    +++        TP  ++  GV ++  P    +          +D  YYN L+  VP ES S+ L +  ML+Q+      + P  E      P  +N         +   +   +     L   L++P    D+    +    I+V D I+ R + +   ++G N A   ++ +    F      +  PT  + SR RAA+LQELI+Y     LS  EI+ A K F+ E++ L+ VD NG I    ++G  Q      WDDPY    ++L    +  +D          +    AA   + S+    S  A ++   + F     G       +SR     ++   RK S+  L + R  SP   T  +          D++A      +E  Q+I  +D   N+R +   E   E               E ++P +LLQI+ ++ Y LP+ +IY  +R +  ++VL+NPF  +  +NH  W+K LHSN+GFRNYLD V + I++W +++EA YQA++L++E++ +
Sbjct:    1 MSKAGKRGKSGDVKGGPAGGGKWDQAISSGVFQEESWNPCVTWVVGQQAEDSKHIESLNIIVQTGTRKLFSVITKELLYADVRDLGNPKNKKVKETPANSEICEACKPYVDTEEPIPLPLLAKLIKWKLLAIKATDLKR---REAEGKALKAKAVSEKKKGNKDAKDGGKERAKSPKKGGKKTPEPQTAKDGSKLRKRGEEDSDNKYIDDEPEDGCQHYILVTGFHDPRIFQFLEEIKVTVDSVIGIRSQDYTPLKRPPPPEAEPPAEPTEEDRK-----FKELQDE-LCLFWTDLLPLLQRLPDASSLHDIARLDYEVKALMVPSDPMDTEQKVQYSTSLFEDVAVMIYDLLDARRLYKTYLENLKLTRIPVYGLEESTAITPVPPPTPGAAVAPGVTSAVEPGGAAAAPESRIPPPPVDMRYYNDLMNTVPQESVSVPLILHCMLEQITANEEGREPPSEQAPPIRPDGVNFHLASYLTGVAFKLGLTESEHQMLSEVLELPSPPPDQPGPPEL---INVQDDISNRTQHLQ-PHYGFNPAAVEKVMLQFVPFAKLWHHQQRPTSAE-SRLRAARLQELIHYCVTEELSKSEIDRAFKQFVFESMDLATVDSNGFILDKGKEGLHQ--TAVPWDDPYPFFKVMLPQNKRPSLDIRCSSLSSEDSRSATAAQHRRASLQQERSRDAPAYTNGKMFGGTGRGACTPEIDTSRESRRGSLDESRKKSI--LVSARTSSPRDGTPKESRSNSVHWDADVLA------EEPIQDIQDVDMPPNIRTKTVEEGVLEMVEAQQRNLDQWCFAEHFKPDILLQILREASYMLPFHEIYHHKRDETHMLVLYNPFGAEL-HNHVDWHKELHSNMGFRNYLDCVAESISEWLKEKEAEYQAHVLSKEVESI 878          

HSP 2 Score: 162.155 bits (409), Expect = 1.009e-35
Identity = 117/437 (26.77%), Postives = 209/437 (47.83%), Query Frame = 2
Query: 4187 ATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSSSSTYEPGEISRAKISELLL----IESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQK----YDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKP--------WKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYS---NPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILEK-FKVL 5437
            ATDPST +T+ TR D  ++ VS   G  + EH+DGTR T Y+   +++ S  E  E+  A +S   L    +E   +  V  + +  +  T  GS  ++     G++I  HS    IE   +G +++    +  + +L P+    YV    +++I E +D +G  F V   G+++V   + +D                          ++++DS ++  K    Y QHAPR F I+ DGSG+ELLRY+D+ + L+ ++ +      ++ + + P +   T+L      KP        W   Y +++++P G+ CRD+KT PPKE    GP FG +VG+GL + +    P+    ++ P+K          ++ RQ   Y  +   +RS   + L  Y + ++ + +     E +   D+ + + ++IL +  KVL
Sbjct: 1459 ATDPSTSQTMATRDD-HVITVSYPDGTTVVEHADGTRITVYYR--ETAMSVEENDEVCSAIVSTQTLKFVKVECPAFATVEFNTSTSENLTVFGSGTSINVFPDGYYILHHSKGGRIEVDTEGTMVYFPRRSRFLEHLMPERELQYVLRHNADIILETVDPDGNVFNVRSTGDYNVIPVQADD--------------------------ALSDDSEEHTSKKIAHYGQHAPRFFIIHGDGSGTELLRYQDVAEYLMLAEQNPATAVLKDVLPDHPGVKGITVL------KPYLLGLSEKWFKNYDQESIVPSGIRCRDLKTLPPKEFVKPGPKFGTNVGQGLNVGAANTGPVRVPILKCPRK----------LELRQVVQYKPMADSLRSVLRKGLRSYAEAVVGRMR----AEALTNIDDIRTVDEQILAQDLKVL 1846          

HSP 3 Score: 137.117 bits (344), Expect = 3.756e-28
Identity = 70/164 (42.68%), Postives = 99/164 (60.37%), Query Frame = 2
Query: 6008 INLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQ-RKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENY 6496
            + LP  +   RP   PN+    +EDPVRRKV+T+   G +E  ++ Q    RGL   P  V+ G+LKEG  Y + + L NTG ++  FKI+QP  +TG+ V + PGP+AAG+  +L + +YAIAN +E   S V  L H L+I T TD L +PIV  ++TA  Y
Sbjct: 2129 VPLPGSIKGGRPGAMPNVKYHTIEDPVRRKVFTSLTAGAAERGRLPQLAGMRGLICQPEGVNFGVLKEGCTYRYAVMLRNTGVDTCRFKIRQPPPATGLRVIYKPGPVAAGMCVELALELYAIANGVE-GESGVGSLGHVLEIITETDLLELPIVATILTAHEY 2291          

HSP 4 Score: 66.2402 bits (160), Expect = 1.433e-6
Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 2
Query: 2990 EEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDP 3187
            E YWPF  Y   N L H  G+   LFPSDG  I+  + + +  TT++R SV+    HVF+IH+L+P
Sbjct: 1018 EPYWPFYGYDSGNQLIHVSGITTTLFPSDGGTIKTERTEFVQGTTAIR-SVLQKDGHVFSIHVLNP 1082          
BLAST of Sperm associated antigen 17 vs. TrEMBL
Match: gnl|BL_ORD_ID|22738074 (tr|A0A094ZYX3|A0A094ZYX3_SCHHA Sperm-associated antigen 17 OS=Schistosoma haematobium OX=6185 GN=MS3_06764 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 1.635e-83
Identity = 424/1656 (25.60%), Postives = 699/1656 (42.21%), Query Frame = 2
Query: 2210 QEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSN-VGFRNYLDFVHDKITDWNRDQEAIYQANLLNQE-LQIVETEIKETEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQEL---------SLIVPGSLKAQKLXXXXXXXXXXXXXXXXXXXRQLSAQKKTEKDLAKNVEKTKDSKRPXXXXXXXXXXXXXXFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDPTYSPDSQIDNFDQILEQFSHSKNICNYGASTCTFNDGITIAASNNGYSGSQLKNKSPIGAPNDEISSHR-----SNDLTVNGNKEEIFQNDTNETNEKIITQKNPFVNHMDYIDSPNIILTTPDGVQVSVGY-----------ESAE------------------NENQRNLLL-----FMCKFESSLKPSVPPELS-------SIQAPEIGRYITSDGRVVTIF-------KNELIKVLFPDG-------TVAXXXXXXXXXXXXDDEVEEFKIENINVKESP---------------------------NSKRKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRK-----WTITLSNGE-----VFETVANLNSIFNPKPLIETIET------KLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGI---FLCEHSDGTRFTKYFNVEKSSSSTYEPGEI-SRAKISELLL-IESKQYPAVIIDLTNEKIETRCGSMGALLSN----SCGHHIFKHSDNTEIEYRPDGEIIFTA------SVNSQMSY----------LQPDGPFSYVFNPTSNVICEIIDSEGTE-FIVN------INGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTND-SNDNVQKYDQHAPRLFTINP-DGSGSELLRY----------------RDIVDTLV--------------NSDIDENYF---HCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTF-------PPKEIKTDGPPFGMSVGKGLEIY------------SNPIMAKNVQKPKKSFRQDHWLNP------MQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQ-----RQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGS--LVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKDKNEFLNETET-SEVSLLSPKFQVDYLEQSPEN-------STKNSKNLLKPKLIIQKRATNY-----LYYDSN--LFIPNEPKRLPELSNINLPNYLYAERPSIEP--------------NIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIY-AIANNLEKNSSNVSLLEHFLQITTNTD 6448
            QE     L+  +  + +EW  EE  EP+VLLQ +H   Y+ PY+D+Y +   D   ++ H+PF    + NH++W  W H N +GFR YL  +   I +W R+QEAIY+A  L+ E LQ  +     TE            +  K +KS+   +  GS +EE+  Q             I+PGSLKA + +QE+    K  EE +KE KR  SA+K TE++++   ++    KR  S        K    ++S +       Q++ T R   E +WPF  Y + N L H  G V H+FP+DG  I+  + +      ++RVS++    HVFTIH +D    P+   +N ++I                    ND                +N+ P   PN +I S++      N  + N N   I  N  N  +    TQ  PF + + +        +TPDG QV+V +           E AE                  N+ Q N LL      + K  SS +  +   ++       S +  E+ R+ITSDG V+ I         +  I++L+PDG       TVA      ++        +E K + IN++  P                             K+    +++ +    T + T L   S P    +       W ITL +GE     +F+ + N+ S     P     ++       LD  ++   N+ +     P++   SF+            A DP+TGETL TR +  L+ V          + +H+DGTR T+     +  +    P ++ S A   ++ +  E   +PAVI++ +  + E          S       GHHI +H +  ++   PD  + +T+      ++N    Y          L+   P   V+   +   C ++ + G +   VN      +N  +  ++  +N++  E++   +  ++D     ++N      N+ SND    YD+H PRLF  +P      EL+ +                R  ++ L                S  D +++   + RE +QN+PK+   T++ S S  +  KY Y ++ ++P+GL+ RD +T        P  +I+      G   GKGL+I                +     QK K   R+ H  N          R+F  +P I  ++   F   L  Y +  L +      Q    L  + QS E +   D I     VL  +K+ I+  I +  + +++S+  + ++ + E +  T    +P+ ++   +L QE     ++   RA+L++   P YF S  G  F+  Q  D++ L+K   L P      ++++L  +N   N+  T +E S L        L  SP N       + +N   L+  K+      ++      +Y D N    +P +   L +   + +P YLYA+RPS+                N+ QAL+EDPVRR+   TS+IGG    Q   R+ RGL + P+R++ G+L  G+  +F +KL+N GPE++ FKIKQ    +GI V + PGPI AGLSR+L I +     + LE   SN  + +  L+ T N D
Sbjct:  832 QENFGTLLNKAKNIHLNEWSVEEKLEPNVLLQRLHSLNYEKPYLDVYKRLYDDSLFIISHHPFDRTIRSNHYTWCSWFHVNKIGFRPYLQLIEGHIRNWTREQEAIYEAAKLSAEILQTDDINGSSTEQSPTKPIKKNSPRSQKGAKSKRNRSISGSESEESIVQNEIKSLLGDPNEFILPGSLKAAQRDQERAKLKKDLEERQKETKRVKSAKKSTEREISPTQKRKTSGKRNKSPHPKSPVQKNDQDDESIQQ------QQLRTKRTSNE-FWPFTGYDISNLLPHITGEVTHMFPTDGGTIKTQRNEIPTGQANLRVSLMK-DGHVFTIHKIDGPPEPNIPYENPNEI------------------KLNDQ---------------ENEQP--NPNYQIESNQLNKSNKNSDSDNNNDCRIRPNSVNLNDNSETTQNKPFQHFIHF--------STPDGAQVAVYHCVNEVSNRAIDECAEENIPSKEALINPESKCQTNDGQNNALLNSQHSILLKL-SSARTCINDSINIDDLKKRSDKEYEVTRFITSDGIVIQILMPSCTSSASCAIRILYPDGAIMERGTTVAEELRRNENPQFTLSNPQEEKQQEINIQSEPAMPSALQVINIQPRKSSSKRKSSRRKIEEKKTENDARNETCLVSTDIATALTPSSTPRSTTNDSDDNLPWLITLLSGERFWFKLFKPLTNIGSSVEDTPTTNASDSVSHESVNLDTLSSKRLNDAVKYETYPSKPMESFR------------AYDPATGETLYTRPEDNLIAVEPHPDSPFKLIVQHADGTRLTQILLASEKLNDECNPVDLNSNANKPQMFIRTECVGFPAVILNKSTGEFEVSLFGKSQFSSTFHFTPKGHHILQHFNGGQLNINPDSSVYYTSQSLEIVNLNEPTVYEMRSKDMESLLECTDPHKNVYTVDNWANCNVLLTVGNKKHTVNEDLNTEVNQIYSTELTNENNQQIEDSFHTVLQNKDNADNNEINE--PHNNEISNDGCCLYDEHIPRLFYFDPIKRIAIELIHHEEYKCLLRRAHNIQSPRHHINKLTMEEKLMYMNTKSQNTSTSDSDFYEGLYLREPMQNNPKVFGLTLMKSLSTNETGKY-YVQENIIPEGLSSRDFQTITHSSNSNPHSDIRK----LGERAGKGLDIIMPSLEYLGLKLPETNVTLLPAQKGKSIKREIHKFNAYYQALHANVRRFTEFPLITSEINQRFLGVLCAYTEYYLNRLNEWCSQQPTRLSEIMQS-ELRLFLDPIPTVSSVLSRNKQ-ISYPIENENITDVSSSPSQQTTVSQEISQPTN-KYSPARQEAFKLLRQEIEKAMRD---RAALRSTHTPNYFRSQEGIGFLLSQIPDVKKLSK---LVP------ELSNLPSRNPKQNDKSTLTEQSTL-------ILSDSPPNIPSPLLRTIENDNELITEKITGNTNNSHLTMNKLIYNDDNHSTHVPLDVVALAKQKQLRVPKYLYAKRPSLPKCNNGVNGISHATNFNVKQALIEDPVRRRALFTSIIGGPPFGQFSLRRMRGLRLTPSRINVGVLPYGVTRSFSVKLVNWGPETAYFKIKQLPIQSGIRVFYTPGPIPAGLSRRLTIEVSNQRQDRLESYPSNQQIDDRGLKQTANHD 2394          

HSP 2 Score: 129.798 bits (325), Expect = 6.897e-26
Identity = 110/417 (26.38%), Postives = 199/417 (47.72%), Query Frame = 2
Query:  161 DTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQ---------IENLKSFWTNINPVLNDN--KTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKE---GVQASPDNTDSHM--------NFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTP 1345
            + E I+ +   I  G R++FT+IT E +   I  F   K+K  K+AP  FEIC + K+ ++  + L    L+K +K+++ + KT D+K        +   + K     D  ++      K G++V    S EPP  K+ +KL KRG+   + +Y+ DEPD+G SRY ++       LL  L  +     SI++    +H+ ++   + +  +++       + S+ +L +M+          E L+ +W   + ++ D+    L N   +    K  + P +    + +      +F  ++ ++YDL+D +RQWKNYL+  K+I LP+       ++  +  + +K     +   PDN D               D  ++ +YN +LQ +PIESTS+ L + A+L+QV     E  P
Sbjct:   13 ENEIISILAASIVNGQRQRFTVITYEDVLNQI--FTQCKAKSQKDAPEFFEICNVAKNAIETVDELNPQTLSKVLKFMLNSIKTLDIKQQS-----LRKSIPKTNHMEDTKKKENPKDKKSGAKV--IISQEPPVNKEKSKLYKRGEEALEEKYLGDEPDNGISRYILLVNFEKCGLLEELCRLKIDIHSIIR----LHVNDQKQLQILITKQKAEKMWGSKGSEQDLEQMRSEEEALLLAEEQLRQYWRTTSILMRDHVYDRLGNIATLDYNVKTELLPDDLNGAENRASFGATMFNEISTILYDLIDFRRQWKNYLEHIKVIHLPICPPSLNENDPVSSNQLLKMSKLAIGLHPDNLDKPAIKSEDCGDILAEDFVDMRFYNEILQGLPIESTSVELILHAVLEQVIANENEILP 416          
BLAST of Sperm associated antigen 17 vs. Ensembl Cavefish
Match: si:dkey-208b23.5 (si:dkey-208b23.5 [Source:ZFIN;Acc:ZDB-GENE-081104-362])

HSP 1 Score: 140.198 bits (352), Expect = 4.269e-33
Identity = 110/420 (26.19%), Postives = 197/420 (46.90%), Query Frame = 2
Query:   77 WESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSG--GKKGSQ-VPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKT---LLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQV 1318
            W+S +  A   E++W  S+ +++    +D   +N +   +   LRK FTL++ E   + IN+ GNPK++K K+ P+ +E+ E+ +S LD  E L    +AK +K+ +L  K  D++      +K  G+ + A  A DK+ +  + G   KKG +  P K          + KL++RG+ +   +YI DEPDDG   Y +++G     L++ L  +G + ++++++  D                +    +DKE+  +       ++L  FWT ++ VLN       L +   +    +  + P + E+        + +FE +A L+YD LD +R  + YL+  KLI +P +   A   E          G+ A  D              +  Y+ LL  +P +  S+ L +  ML+QV
Sbjct:   23 WDSALCTAGFEEESWKASVCLVVAGSVEDEVCVNALKRAVQQPLRKLFTLLSWENTLEKINELGNPKTRKIKDLPMYYEVMELARSELDTGEELSVDLVAKLVKFQLLNIKNSDLQRRA-VEEKAKGRAAPASAAKDKTAKVSAKGEKAKKGLEAAPAK----------ETKLKRRGEEEETTKYI-DEPDDGPQHYILMTGFQQPQLISLLDSLGILVSTVIRLISD--------------PPQDPAAADKEHLKS------AQDLDVFWTKLDTVLNVGGVGSRLHDVAKLDYRVERSLLPTDPEDTQ---SLGVTVFEGVACLLYDSLDWRRHHQLYLNSMKLIHVP-RVGRADRPERV--------GLSAEVD--------------MRLYSDLLNQMPAKIVSVPLILHCMLEQV 384          

HSP 2 Score: 53.5286 bits (127), Expect = 2.709e-6
Identity = 25/103 (24.27%), Postives = 47/103 (45.63%), Query Frame = 2
Query: 2222 LDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQ 2530
            ++ L  +  R    W   E ++PH+  Q++         +D +     D    + HNP  P  + +   W   LH+++ F NYL+ V +++ DW R ++   Q
Sbjct:  573 MEELQKMLTRRLRHWTITEHHDPHIFPQVLQAVSETYRCVDTFTSSSDDTIFTISHNPMGPQ-RSSKECWEVCLHTDIRF-NYLEHVAERVRDWTRAEDQKQQ 673          
BLAST of Sperm associated antigen 17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009916.1 (pep scaffold:Pmarinus_7.0:GL476547:717219:757547:-1 gene:ENSPMAG00000008955.1 transcript:ENSPMAT00000009916.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 4.579e-50
Identity = 160/637 (25.12%), Postives = 284/637 (44.58%), Query Frame = 2
Query:  110 EDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQV---PGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYE----MQIENLKSFWTNINPVL---NDNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALP-VKTSVAQTHENTTPRESIKEGVQA------SPDNTDSHMNFTFDK---FNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIYFPXXXXXXXXXXXXIPLDDDDENRNKDQNSPI------HVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTD-----------DQISRKRAAKLQELINYLNNTG--LSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPYMILNDV 1903
            +D W  S++M++    +D   I  +   I   LR+ FT IT + +   IN+ GNPK K+ K+ P+ +EI E+ K+ +D  +A+  P LAK IK+++L  K +D +     NK  + K  +  +     E  KS   K+G       GK+ PEPP +K+D KL +RG+      Y DDEPDDG   Y  + G +   LL  L ++G   ++++ V+   +           +  ++ N  D   S  ++ E     ++E L++FW  ++PVL       +L     +     + + P +  +++  +K    LFE +A LMYDLLD ++ +++YL+  +L+ +P +  S+ +T         ++ G+ A       P  T        ++    ++ +Y  LL  +P E  S+ L +  +L+QV  T   + P  +L        L+ D  +      +   FP                DD+E+      + +      H+   I   + EI ++      A G ++  +       D+L+ +P             D  +R RA   QEL+ Y +     +    + +A++ F+ ENL LS VDE G + + ++      N    WD+P     +V
Sbjct:   11 KDGWQASVAMVVCGRVEDEAHIPAMLQAIRVPLRRLFTAITWDDVMTQINELGNPKGKRPKDLPVYYEILEVAKTAVDAGQAISLPVLAKLIKFMLLGVKQKDQQWREAKNKAAEEKAKEMAEVDCGKEPVKSPVKKRGKSAKGNKGKKLPEPPQIKKDTKLMRRGEQGHLRCYSDDEPDDGPQHYVFLMGFLQPQLLPMLKELGVTVSAVICVSSQTYT---EDKPAQAHATKMLNSCDLSLSGGDIVEELLAGRVEELQAFWRYLSPVLEGVGHGYSLDTVARLQYTVHNSLLPEDPADQNTMVKFGAALFEDMACLMYDLLDWRQHYRHYLNNMELLQIPTIGQSLVRTDNEAMQASEVRNGISANGKRKGQPSETTDLPPLVREEPSAVDMRFYRDLLDPIPPECVSVPLMIHCILEQVVATEEGRPPPSQLRDPPRADGLHPDLANSLSAAANR--FPLS-------------PDDNESLAALFGTSLCSLGQEHIKPKILSFNDEIMSRTHHLQAADGLDVAQI-----EKDMLRRLPVCGMLLDPGLHKVDNATRIRA---QELLQYCSGCAGQVEQASMQHAVRQFVFENLELSSVDEAGELTVVHQ----ADNVALAWDNPLAFAKNV 617          

HSP 2 Score: 192.971 bits (489), Expect = 3.214e-49
Identity = 207/820 (25.24%), Postives = 345/820 (42.07%), Query Frame = 2
Query: 4187 ATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYF-NVEKSSSSTYEPGE--ISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHH----------IFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPD-GPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSK--IKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGL------EIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNP-------------------SHRKLDVILEQXXXXXXXXXXXR---ASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFP--------ISREGTDVNDLKDKNEFLNETETSEVSLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELSNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSL--IGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMT 6484
            ATDP TG  ++TR D  + +   D G  + +H DGTR T Y  ++   +S   E GE  +   +  + + +ES   P +          T  GS   L +   G +          +F  SD  E  Y P    + + +++S      P   P +Y     + + CE +D  G  F V  NGE    +        E+     E  Q                       +YD HAPRLF I+ DGSG+EL+R  D    L  ++        R+ + + P +   T+L    K   + W  +     + P+ L  R  +TFP +E K  GP FG  +G+GL      E+   P ++  V+K     R          RQ   YP +  ++R      L +Y +++LQ+ +  ++++I     ++ ++ADE     ++LK    S+        N +  + E++   +E +  T  P  P                   S R   +  E+    +++  + +    +LK+ I+  YF+S  G+ F+  QAMDL++L+K +   P         + E  D   L D        E S V ++ P F       + + ST     + +  L   + AT +      L +    +R      + LP  + A RP    N   A V     + + ++S+  +G S  S++LQ    G  + P RV+ G L++G +   +I+L N G E   FK+K P SSTGI V + PGP+AAG      IHI  I   LE  + N+  + + +QI T  + L++P+   +++
Sbjct: 1388 ATDPQTGAVMITREDKVVTVTDAD-GRIVADHVDGTRITTYHRHILDHNSDEQETGEGMVRTVRRVKCVRVESVGLPTLQCRPDEGSCITLFGSGTVLHAKPDGTYQLCPSGGEGSLFIASDG-EARYSPGR--VSSPALDSLPGTRDPALTPGTYFLRHVAPLACEAVDVYGNHFQVLCNGEASTSLAGAAGAGAEDERGDGEEAQ--------------------KPARYDTHAPRLFAIHADGSGTELIRREDAERFLSWAEGHPITTVIRDTLPDHPAVQGVTVLSPVEKDVRQRWLLQKQESDITPQSLRSRQWRTFPAREEKKAGPRFGTCIGRGLTIDRPCELNVRPAVSPCVEKRPDVLRA---------RQLLCYPAVTTEMRCKLQLCLKEYLEQLLQREKQREEMKI-----QDPRLADEKTHISQLLKLVL-SMPEDSPRYYNEDERRAELAD-LYEQSFTTQPPSFPPDAQAEQEYFKKSLWREEASQRTQALWAEKIAKERQEVEQAKEDIQALKHKIITPYFSSELGRTFLLSQAMDLEALSKEVPHTPRKPSPALDCTSEDGDSCHL-DYRPMCWAAEGSAVPMM-PAFTTSVFIAN-KMSTMTVPAVAERHL---RDATRHHAKSLALDVTGSARR----ERVRLPAAVLASRPRSVHNEKVARVSQSHPKIMESSSITNVGASARSEVLQ----GFTLLPTRVNFGCLRQGSSNVRRIRLQNVGTEQHRFKVKAPPSSTGIRVIYTPGPVAAG------IHIELI---LELKAENLGPVSYEVQIQTEAETLLVPVTANILS 2144          

HSP 3 Score: 63.5438 bits (153), Expect = 5.944e-10
Identity = 34/91 (37.36%), Postives = 54/91 (59.34%), Query Frame = 2
Query: 2249 RNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVL-HNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQE 2518
            R   +W + E YEP VL+Q++ ++  +   +D Y +  +DG L++  HNP   D   +   W+  LH+NV FR+YL+ V + +TDW R QE
Sbjct:  751 RCLDDWNYTERYEPDVLIQVLVEASERYICMDTY-RLNLDGSLLLFFHNPMS-DELQSLEYWDIALHTNVSFRDYLEHVAELLTDWLRGQE 839          
BLAST of Sperm associated antigen 17 vs. Ensembl Nematostella
Match: EDO30301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T172])

HSP 1 Score: 117.472 bits (293), Expect = 5.325e-26
Identity = 190/918 (20.70%), Postives = 347/918 (37.80%), Query Frame = 2
Query: 2990 EEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDP----------------TYSPD------SQIDNFDQILEQFSHSKN---------------ICNYGASTCTFNDGITIAASNNGYSGSQLKNKSPIGAPNDEISSHRSNDLTVN------------GNKEEIFQNDTN---------------------ETNEKII--TQKNPFVNHMDYIDSPNIILTTPDGVQV---------SVGYESAENENQRNLLLFMCKF---ESSLKPSVPPELSSIQAPEIGRYITSDGRVVTIFKNELIKVLFPDGTVAXXXXXXXXXXXXDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSSSSTYEPGEISRAKIS----ELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDG-----------EIIFT-ASVNSQMSYLQPDGPFS-----YVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFH--CREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILE 5422
            EE++ FI Y + ++L H  G ++ LFP DG  IRV K   +    +VRVSV     ++F +H L+P                T  P+      + +D  ++ +E+     N                 ++ +    F+DG+T+  S  G SG +L  K  +G   D ++     D +              G+ +   + D +                     E N++     QK PF N         + +T PDG+ +         S+G        QR  +    K    E+ LKP++          E  R + +DG ++ +  +  ++VLFPDG +A                   K  ++ +K      +    S     EPQ P   +  + S+                          S+  P P+I   E  +   AT ++   I+   QP  +      ++  + +L S  T P +G+ L TR D  ++ V +  G F+ EH+DG+R T ++  ++  +   +    S+A+ S    + + +E   +  ++ +      +T  G+   + + + G  +    D + +     G           +I+F  A   S+ S    D P       YV        CE+ D++G+ F V  NG   V+ +   + P    +Q + +++D  K   L S +                AP                    + +LV SD D N +   C +  ++      H+ +      K W  +    T++P+ L  RD K+ P  E KT GP FG +VG G+ + + P   K   +P  +  +      ++FRQ   Y  +    R    + + +Y++ + ++ +    +   +  +E +K+A E LE
Sbjct:  484 EEHFDFIGYDVGDNLIHASGSLSTLFPCDGGQIRVDKTSYVQGPQNVRVSVYK-DGNIFVLHFLEPTEEILTIEEIEGAQEITEKPEETATDVASVDIKEEGIEKSETEGNEKKTKEEPKPKGPKPFSDFSSFVAQFSDGMTLTHSGYGPSG-RLHGK--VGKEPDSLAGPVPTDPSATTHGTPSPQPAKVGSPKARKKADEDAKRLEELQQQQQEEERARLVEEANQRAAEERQKKPFQN---------LYITCPDGLHLEYFNDGTYDSIGDRGGVGVRQRYPVRGGGKQHCDEARLKPAME---------EQSRTVLTDGTIIKLMTDGSVQVLFPDGALA-------------------KCPSLPIKTQEPVSKPNSASGPRPQEPQQPKKLIRPQGSQ-------------------------KSVEEPMPVISVPEKIIKWTATGNDGRRIM--TQPDGE------VEVVDPVLMSSVTCPESGQVLRTRED-NVVSVERPDGTFIVEHADGSRITTFYRHQQQQTQAPDNETGSQAQYSTVSGKFVQVECPGFSTLVFECKTGSCQTLFGNGVEMKTAADGETVIDRLDGSRLHLDAKGVMSFVPRELADKIVFPPAKTTSEPSDTPSDTPSDTPAGVYVMRTNRQNCCELQDTKGSRFCVISNGNVTVERDCA-ENPESRDAQTVTSEED--KPASLESTVVT--------------AP--------------------LTSLVPSDCDGNIYVNVCDDGFED------HSYVDECGISKIWLRQKDEDTIIPRALRERDFKSLPSHEDKTPGPKFGTNVGAGVSVGTVP---KQEAQPLITCPRA-----LEFRQLIQYRPLTLHDRQLIVKAIENYSEYVEKREKRLDSILPQDPREESEKLAAEQLE 1275          

HSP 2 Score: 107.071 bits (266), Expect = 7.533e-23
Identity = 52/123 (42.28%), Postives = 74/123 (60.16%), Query Frame = 2
Query: 6008 INLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIA 6376
            + LP  + + RP   PN     +EDPVRR+V+T S+ GG++ S       RG  + P +V  G LKEG  Y   + L N G +S  FK+KQP  STG+ V + PG +AAG+S KL++ I+A+A
Sbjct: 1582 VRLPTSILSSRPGALPNTQFMEIEDPVRRRVHTVSVAGGNQLSDGRMENLRGFELLPPKVSFGTLKEGCTYINTVLLKNVGIDSCRFKVKQPPPSTGLRVLYNPGLVAAGMSAKLDVEIFAVA 1704          

HSP 3 Score: 89.3521 bits (220), Expect = 1.677e-17
Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 2
Query: 2249 RNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQE 2518
            RN  +WCF E  + + LLQ++ ++ + LPY+D Y  +R    L+ LHNP   D + +  SWN  LHSNVGFRNYLD V   I  W +++E
Sbjct:  254 RNLDDWCFMEHLDHNTLLQVLKEAQFTLPYLDTYYHKRDHTLLLALHNPVGQDGR-SSSSWNSKLHSNVGFRNYLDHVVSSIDSWVQEKE 342          
BLAST of Sperm associated antigen 17 vs. Ensembl Nematostella
Match: EDO30653 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T054])

HSP 1 Score: 104.76 bits (260), Expect = 2.849e-23
Identity = 81/261 (31.03%), Postives = 132/261 (50.57%), Query Frame = 2
Query:    5 NRIISKMSK-KRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEA-------PLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGS-----QVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSS--RYFVISGLVDHLLLASLADIGCITTSIVKV 742
            ++I  KMSK +R KS + N  S  +WE  +  A  NED+W  S+     N   D   ++ ++  I+TGLRK F++IT + + +   ++G P++  GK         P   E+CE  K+ +D+ E +P   +AK +K+ +L  K +D     +  K      S  K      +    SG +  S     +     S  PPS K+++KL+KRGD +   + IDDEPD+  S   Y +I G++   +L  L+DIG    +I++V
Sbjct:   69 SQIQRKMSKSRRGKSASTNEIS--RWEQELLQAPFNEDSWKSSVVFTAPNSVDDNIFLDILSDVIATGLRKLFSVITYDGLIKDAREYGKPQTGGGKGKGAASSKPPPFHEVCEPVKALVDQGEPIPPALMAKLLKFKLLHIKQKDFDRREEERKAAKAAESGKKDEKGGKKSHSPSGKRSKSPGKVKKGKKGESDMPPSPKKESKLKKRGDVEDTFKTIDDEPDENGSPQHYVIIHGVLMAPVLQHLSDIGISVDAIIRV 327          
BLAST of Sperm associated antigen 17 vs. Ensembl Nematostella
Match: EDO27462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T968])

HSP 1 Score: 83.9593 bits (206), Expect = 3.259e-17
Identity = 40/90 (44.44%), Postives = 56/90 (62.22%), Query Frame = 2
Query: 2249 RNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQE 2518
            RN  +WCF E  + + LLQ++ ++ + LPY+D Y  +R    L+ LHNP   D + +  SWN  LHSNVGFRNYLD V   I  W +++E
Sbjct:  166 RNLDDWCFMEHLDHNTLLQVLKEAQFTLPYLDTYYHKRDHTLLLALHNPVGQDGRSS-SSWNSKLHSNVGFRNYLDHVVSSIDSWVQEKE 254          
BLAST of Sperm associated antigen 17 vs. Ensembl Nematostella
Match: EDO27342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9I3])

HSP 1 Score: 58.151 bits (139), Expect = 1.085e-8
Identity = 49/175 (28.00%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  113 DNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEA-------PLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGS-----QVPGKRSPEPPSVKQDNKLRKRGD 601
            D+W  S+     N   D   ++ ++  I+TGLRK F++IT + + +   ++G P++  GK         P   E+CE  K+ +D+ E +P   +AK +K+ +L  K +D     +  K      S  K      +    SG +  S     +     S  PPS K+++KL+KRGD
Sbjct:    1 DSWKSSVVFTAPNSVDDNIFLDILSDVIATGLRKLFSVITYDGLIKDAREYGKPQTGGGKGKGAASSKPPPFHEVCEPVKALVDQGEPIPPALMAKLLKFKLLHIKQKDFDRREEERKAAKAAESGKKDEKGGKKSHSPSGKRSKSPGKVKKGKKGESDMPPSPKKESKLKKRGD 175          
BLAST of Sperm associated antigen 17 vs. Ensembl Medaka
Match: ENSORLT00000034404.1 (sperm associated antigen 17 [Source:NCBI gene;Acc:101170055])

HSP 1 Score: 134.035 bits (336), Expect = 1.234e-30
Identity = 111/434 (25.58%), Postives = 214/434 (49.31%), Query Frame = 2
Query:   56 NIASGNK---WESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYE----MQIENLKSFWTNINPVLNDNKTLLNTPIITLVA-KHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNID--YYNFLLQDVPIESTSIYLQMSAMLDQVEIT 1327
            N+A+ +K    E+++  A+L+ED+W   +S+++E  P D + I  +   +    RK FTL+T   I   I++ GN K KK +   +  E+ +  +  LD  E +P   +AK +K  +L  K+ D        ++++ + +K     D +++ ++S   K ++ P K  P    +++  KL +RG+ +P   YIDDEPD G   Y ++ G    LL+A+L  IG    +++K+  D            E +++  + S+   + + + E    +Q   L  FW+ +  VL+    L ++ +  +V   +++     ++ + +++    +FE +A L+YD L  +R+ ++Y +K +L+ +P  +          P    +     SP NT   +     +  +D  YYN LL  +P E+ S+ L +  ML+QV I+
Sbjct:   12 NVATADKDTGEEASLLGAQLDEDSWRSCVSLVVEKSPADEDLIQALASAVQRPQRKLFTLLTRNSIVTKISELGNTKGKKPEYVTVFIELLQSARVWLDAGEDIPVDLMAKILKLQLLQVKSSDQHRR--EAEQIEAEKAKGDPPPDIADKTRAS--DKRAKTPSK--PVTSVMEKKTKLLRRGEVEPPT-YIDDEPDWGPQHYVLLVGFYQPLLIAALDGIGVHVANVIKLCCD-----RTQIRRKEQEQQSCDDSEPSQAASAISEAELAVQATKLDLFWSGMRAVLDSG--LPHSRLHDVVPLSYIVQDFHTQDPNDRMELGSRIFEGVANLIYDCLQWRREHQHYRNKLQLLHVPSISGSGYKPAEDAPTSPFQ-----SPINTKKPVCEESQRNQVDMCYYNSLLDLIPPEACSVPLMLHCMLEQVVIS 426          

HSP 2 Score: 68.9366 bits (167), Expect = 8.161e-11
Identity = 69/348 (19.83%), Postives = 142/348 (40.80%), Query Frame = 2
Query: 4376 ELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVN---SQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDV-KINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILH--SDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKK 5401
            +++++E +    V++       +        +  N+ G +    S    ++ + DG+ I+++      +Q +++  +   +Y  + T  V C I D +G  F V  +G+  V K++  +      +SQ    +++ G   +                K+  H PRLF ++ DGSG+E L    +   L  +  D      +E + N P     TIL     S    W        V P  L  R    FP  E ++ GP FG ++G  L +         + +P +S  +      ++ R+   +    K +R +   +L  + + +++  QL ++ ++ +   EE++
Sbjct: 1295 QVVMVEKEGQATVVMHPQRHTAQAFLADGTVVTGNNQGEYEVFPSSAGFLQIQRDGKCIYSSDHQVSPNQKAFILTNEAGTYTMSHTDTVACYITDDDGNHFQVMEDGQISVLKLSSAS------SSQEKFEEEEGGATSRF---------------KHKHHCPRLFLLHADGSGTEFLSSHCVEKWLDEAYSDPTVALLKEPLPNQPDAFGITILKPSPQSVWSQWLLGKQVPDVTPPNLKNRSWHDFPGMEKRSPGPSFGTNIGVSLTLREKKAGPGALLQPMRSCPK-----VLEMRELREHRAFTKPLRDAVDSRLKKFIESLMEGEQLSEERKVKDPRTEEEQ 1616          

HSP 3 Score: 64.6994 bits (156), Expect = 1.237e-9
Identity = 35/115 (30.43%), Postives = 61/115 (53.04%), Query Frame = 2
Query: 2180 FINNQNDEGFQEILLDY-LSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEA 2521
             +N ++ EG  ++ L   L   R+R+ ++  + E +   VL Q++  +  +   +D +     D   +  HNP +PD +     WN  LH++V FR YL+ V D ITDW R++E+
Sbjct:  637 LLNLKSKEGSSQLDLSSDLQRCRRRSLNDRHYTEHHSADVLQQVLLLASEEYCCLDAFGGTHNDTLYIFCHNPMNPDRQCQEF-WNVALHTDVKFRKYLEHVADTITDWTREEES 750          
BLAST of Sperm associated antigen 17 vs. Ensembl Medaka
Match: ENSORLT00000006642.2 (sperm associated antigen 17 [Source:NCBI gene;Acc:101170055])

HSP 1 Score: 82.8037 bits (203), Expect = 4.563e-15
Identity = 71/282 (25.18%), Postives = 135/282 (47.87%), Query Frame = 2
Query:  503 KSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYE----MQIENLKSFWTNINPVLNDNKTLLNTPIITLVA-KHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNID--YYNFLLQDVPIESTSIYLQMSAMLDQVEIT 1327
            K+    K ++ P K  P    +++  KL +RG+ +P   YIDDEPD G   Y ++ G    LL+A+L  IG    +++K+  D            E +++  + S+   + + + E    +Q   L  FW+ +  VL+    L ++ +  +V   +++     ++ + +++    +FE +A L+YD L  +R+ ++Y +K +L+ +P  +          P    +     SP NT   +     +  +D  YYN LL  +P E+ S+ L +  ML+QV I+
Sbjct:   41 KTRASDKRAKTPSK--PVTSVMEKKTKLLRRGEVEPPT-YIDDEPDWGPQHYVLLVGFYQPLLIAALDGIGVHVANVIKLCCD-----RTQIRRKEQEQQSCDDSEPSQAASAISEAELAVQATKLDLFWSGMRAVLDSG--LPHSRLHDVVPLSYIVQDFHTQDPNDRMELGSRIFEGVANLIYDCLQWRREHQHYRNKLQLLHVPSISGSGYKPAEDAPTSPFQ-----SPINTKKPVCEESQRNQVDMCYYNSLLDLIPPEACSVPLMLHCMLEQVVIS 307          

HSP 2 Score: 78.9518 bits (193), Expect = 6.193e-14
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 2
Query: 6002 SNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVM 6481
            S + LPN + + +    PN +   VE+PVRRK  T SL   ++   I+    RG  + P  VD G+++ G   T  + + N G ++  F +KQP  +TG+ V +   P+AAGL  +L + ++A+++ L +  S   + +  + I T TD   +P+   V+
Sbjct: 1728 SRVRLPNCIMSSKARRVPNQNFLTVEEPVRRKCRTASL---ADPRAII----RGFQLLPWSVDFGVVQAGTLSTAAVLMKNVGVDTCRFHVKQPPLATGLRVLYNSRPVAAGLQTELKVQLFAMSSLLAETESKKYISQDII-ILTETDIFYLPVTAIVV 1879          

HSP 3 Score: 68.9366 bits (167), Expect = 6.954e-11
Identity = 69/348 (19.83%), Postives = 142/348 (40.80%), Query Frame = 2
Query: 4376 ELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVN---SQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDV-KINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILH--SDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKK 5401
            +++++E +    V++       +        +  N+ G +    S    ++ + DG+ I+++      +Q +++  +   +Y  + T  V C I D +G  F V  +G+  V K++  +      +SQ    +++ G   +                K+  H PRLF ++ DGSG+E L    +   L  +  D      +E + N P     TIL     S    W        V P  L  R    FP  E ++ GP FG ++G  L +         + +P +S  +      ++ R+   +    K +R +   +L  + + +++  QL ++ ++ +   EE++
Sbjct: 1203 QVVMVEKEGQATVVMHPQRHTAQAFLADGTVVTGNNQGEYEVFPSSAGFLQIQRDGKCIYSSDHQVSPNQKAFILTNEAGTYTMSHTDTVACYITDDDGNHFQVMEDGQISVLKLSSAS------SSQEKFEEEEGGATSRF---------------KHKHHCPRLFLLHADGSGTEFLSSHCVEKWLDEAYSDPTVALLKEPLPNQPDAFGITILKPSPQSVWSQWLLGKQVPDVTPPNLKNRSWHDFPGMEKRSPGPSFGTNIGVSLTLREKKAGPGALLQPMRSCPK-----VLEMRELREHRAFTKPLRDAVDSRLKKFIESLMEGEQLSEERKVKDPRTEEEQ 1524          

HSP 4 Score: 64.6994 bits (156), Expect = 1.331e-9
Identity = 35/115 (30.43%), Postives = 61/115 (53.04%), Query Frame = 2
Query: 2180 FINNQNDEGFQEILLDY-LSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEA 2521
             +N ++ EG  ++ L   L   R+R+ ++  + E +   VL Q++  +  +   +D +     D   +  HNP +PD +     WN  LH++V FR YL+ V D ITDW R++E+
Sbjct:  545 LLNLKSKEGSSQLDLSSDLQRCRRRSLNDRHYTEHHSADVLQQVLLLASEEYCCLDAFGGTHNDTLYIFCHNPMNPDRQCQEF-WNVALHTDVKFRKYLEHVADTITDWTREEES 658          
BLAST of Sperm associated antigen 17 vs. Planmine SMEST
Match: SMESG000038878.1 (SMESG000038878.1)

HSP 1 Score: 4072.7 bits (10561), Expect = 0.000e+0
Identity = 2156/2168 (99.45%), Postives = 2161/2168 (99.68%), Query Frame = 2
Query:   23 MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNXXXXXXXXXXXXXTDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPXXXXXXXXXXXXRISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIYFPXXXXXXXXXXXXIPLDDDDENRNKDQNSPIHVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPYMILNDVAQSIIDEENKTLKXXXXXXXXXXXXXXXXXPALSFIKNENFTEGILKXXXXXXXXXXPENIKSRRKSSVHFLETERVESPTMSTETQMDIMAFINNQNDEGFQEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIKETEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQELSLIVPGSLKAQKLXXXXXXXXXXXXXXXXXXXRQLSAQKKTEKDLAKNVEKTKDSKRPXXXXXXXXXXXXXXFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDPTYSPDSQIDNFDQILEQFSHSKNICNYGASTCTFNDGITIAASNNGYSGSQLKNKSPIGAPNDEISSHRSNDLTVNGNKEEIFQNDTNETNEKIITQKNPFVNHMDYIDSPNIILTTPDGVQVSVGYESAENENQRNLLLFMCKFESSLKPSVPPELSSIQAPEIGRYITSDGRVVTIFKNELIKVLFPDGTVAXXXXXXXXXXXXDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLNTVLVEDSKPSCNYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSSSSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNPSHRKLDVILEQXXXXXXXXXXXRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKDKNEFLNETETSEVSLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELSNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENYQSIYPISKTD 6526
            MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNKKVDGKVSKAKKATDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPNENLNEEVENQERI NGSDKENSDNNLYEMQIENLKSFWTNINP+LNDNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIY PKESLLELKTSLKIPLDDDDENRNKDQN+PIHVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPYMILNDVAQSIIDEENKTLKDEAASSEKDSISIIESEPALSFIKNENFTEGILKSSRVSSRSQSPENIKSRRKSSVHFLETERVESPTMSTETQMDIMAFINNQNDEGFQEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIKETEVKGKSSKTNEKGKKPKPSKSRSRSTSRGSSAEETSTQELSLIVPGSLKAQKLEQEKINKAKAEEEMKKEQKRQLSAQKKTEKDLAKNVEKTKDSKRPSSKASNKSKTKKTAFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDPTYSPDSQIDNFDQILEQFSHSKNICNYGASTCTFNDGITIAASNNGYSGSQLKNKSPIGAPNDEISSHRSNDLTVNGNKEEIFQNDTNETNEKIITQKNPFVNHMDYIDSPNIILTTPDGVQVSVGYESAENEN RNLLLFMCKFESSLKPSVPPELSSIQAPEIGRYITSDGRVVTIFKNELIKVLFPDGTVALSQLSMQSSVSQDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLNTV VEDSKPS NYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSSSSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNV KYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEI+SNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQS+EEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTAL KNPSHRKLDVILEQEKINKEKEIENRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLK+KNEFLNETETSEVSLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELSNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENYQSIYPISKTD
Sbjct:    1 MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTETINYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICEIGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNKKVDGKVSKAKKATDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQYIDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPNENLNEEVENQERIPNGSDKENSDNNLYEMQIENLKSFWTNINPILNDNKTLLNTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWKNYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFDKFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDLPKDLNEDSIDVFKKITDNIYLPKESLLELKTSLKIPLDDDDENRNKDQNAPIHVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDDQISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVIRINNEDGYFQRNNYQVWDDPYMILNDVAQSIIDEENKTLKDEAASSEKDSISIIESEPALSFIKNENFTEGILKSSRVSSRSQSPENIKSRRKSSVHFLETERVESPTMSTETQMDIMAFINNQNDEGFQEILLDYLSNLRKRNFSEWCFEEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNHHSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETEIKETEVKGKSSKTNEKGKKPKPSKSRSRSTSRGSSAEETSTQELSLIVPGSLKAQKLEQEKINKAKAEEEMKKEQKRQLSAQKKTEKDLAKNVEKTKDSKRPSSKASNKSKTKKTAFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHLDNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTIHILDPTYSPDSQIDNFDQILEQFSHSKNICNYGASTCTFNDGITIAASNNGYSGSQLKNKSPIGAPNDEISSHRSNDLTVNGNKEEIFQNDTNETNEKIITQKNPFVNHMDYIDSPNIILTTPDGVQVSVGYESAENENHRNLLLFMCKFESSLKPSVPPELSSIQAPEIGRYITSDGRVVTIFKNELIKVLFPDGTVALSQLSMQSSVSQDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLNTVPVEDSKPSFNYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKLDDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVTRSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSSSSTYEPGEISRAKISELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTEIEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEFIVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSNDNVLKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREEIQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIKTDGPPFGMSVGKGLEIFSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHYPTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSEEEKKIADEILEKFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALHKNPSHRKLDVILEQEKINKEKEIENRASLKNHIVPKYFTSIYGKDFISKQAMDLQSLNKSMKLFPISREGTDVNDLKEKNEFLNETETSEVSLLSPKFQVDYLEQSPENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELSNINLPNYLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNVFPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPGPIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVGRVMTAENYQSIYPISKTD 2168          
The following BLAST results are available for this feature:
BLAST of Sperm associated antigen 17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SPAG178.490e-5927.13sperm associated antigen 17 [Source:HGNC Symbol;Ac... [more]
SPAG173.818e-4928.24sperm associated antigen 17 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-208b23.52.958e-4624.33si:dkey-208b23.5 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
si:dkey-208b23.56.734e-1924.61si:dkey-208b23.5 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mstn.18.289e-5025.67myostatin, gene 1 [Source:Xenbase;Acc:XB-GENE-4833... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Spag171.427e-3627.27sperm associated antigen 17 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Sperm associated antigen 17 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q6Q759|SPG17_HUMAN4.077e-5827.13Sperm-associated antigen 17 OS=Homo sapiens OX=960... [more]
sp|Q5S003|SPG17_MOUSE9.980e-3627.27Sperm-associated antigen 17 OS=Mus musculus OX=100... [more]
back to top
BLAST of Sperm associated antigen 17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157342001.581e-14926.85tr|R7TXJ7|R7TXJ7_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|238613526.958e-11326.90tr|V3ZPH0|V3ZPH0_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|214201777.716e-8825.91tr|A0A430QR50|A0A430QR50_SCHBO Uncharacterized pro... [more]
gnl|BL_ORD_ID|172293106.462e-8729.13tr|A0A433UDD6|A0A433UDD6_ELYCH Uncharacterized pro... [more]
gnl|BL_ORD_ID|227380741.635e-8325.60tr|A0A094ZYX3|A0A094ZYX3_SCHHA Sperm-associated an... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-208b23.54.269e-3326.19si:dkey-208b23.5 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009916.14.579e-5025.12pep scaffold:Pmarinus_7.0:GL476547:717219:757547:-... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO303015.325e-2620.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306532.849e-2331.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274623.259e-1744.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO273421.085e-828.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000034404.11.234e-3025.58sperm associated antigen 17 [Source:NCBI gene;Acc:... [more]
ENSORLT00000006642.24.563e-1525.18sperm associated antigen 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sperm associated antigen 17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000038878.10.000e+099.45SMESG000038878.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035047 ID=SMED30035047|Name=Sperm associated antigen 17|organism=Schmidtea mediterranea sexual|type=transcript|length=6693bp
ATAAAACCGAATTATTTCAAAAATGTCTAAAAAGAGAAATAAGAGTCCTG
CTGCAAATATTGCCAGTGGTAATAAATGGGAATCTAATATCACTGCAGCG
GAATTAAATGAAGATAATTGGTCATATTCATTATCCATGATTATCGAAAA
TATTCCTCAAGATACCGAAACAATTAATTATATTAATTTGGGTATTTCAA
CTGGTCTTAGAAAAAAATTCACATTGATTACATTGGAGAAAATAACTCAA
TTGATAAACGATTTTGGAAATCCAAAATCTAAAAAAGGCAAAGAGGCCCC
TTTGAATTTTGAGATCTGTGAAATTGGAAAGTCACACTTAGATAAAAATG
AAGCTTTACCAGCCCCATATTTAGCAAAATTTATAAAGTGGATTATGTTG
ACAAATAAAACCGAAGATATGAAAAATACTGGTGACACTAACAAGAAAGT
CGATGGAAAGGTTTCAAAGGCCAAAAAAGCAACTGATAAAAGTGAACGAG
CTAAATCATCAGGCGGTAAAAAAGGTTCTCAAGTTCCAGGAAAACGAAGC
CCGGAACCGCCGTCTGTTAAACAAGATAATAAATTAAGAAAACGAGGAGA
TCCGGACCCAGATATCCAATATATTGACGACGAGCCGGATGATGGAAGCT
CAAGGTATTTTGTCATTTCCGGATTGGTGGACCATCTGTTATTGGCAAGT
CTTGCTGATATCGGCTGCATAACAACCTCCATAGTCAAAGTTACACGAGA
TATTCACATTCCGAATGAAAATTTGAATGAAGAAGTGGAAAATCAAGAGA
GAATATCAAATGGGTCTGATAAAGAAAACAGTGATAACAATCTTTATGAA
ATGCAAATTGAAAATTTGAAATCGTTTTGGACAAACATTAATCCGGTTTT
GAATGATAATAAAACTCTTTTGAATACACCAATTATAACTTTGGTGGCGA
AGCATTTAATGTTTCCAGTTGAAAGGGAAAATGAAGATTTGAAGATCAAA
TGTGCAATGGAACTATTTGAATCTTTGGCAGTTCTCATGTATGACCTGTT
GGATTTAAAAAGACAATGGAAGAATTATTTGGATAAAAGTAAACTTATTG
CTTTGCCAGTAAAAACGTCTGTAGCACAGACACATGAAAATACCACCCCA
CGAGAATCAATAAAAGAAGGCGTTCAAGCCTCTCCCGATAACACTGATTC
ACATATGAATTTTACATTCGACAAGTTCAACATAGATTACTATAACTTTC
TTTTGCAAGACGTTCCGATCGAGTCTACAAGTATCTATTTGCAAATGAGT
GCAATGCTGGATCAGGTTGAAATTACTGCTGGAGAGAAAACTCCTATTTG
GGAACTCAATAAATCTGATTTGCCAAAGGATCTCAATGAAGATTCAATTG
ACGTGTTCAAAAAAATTACGGATAATATCTATTTTCCCAAAGAAAGTCTT
CTAGAATTAAAGACTTCATTAAAAATACCATTGGACGATGATGATGAAAA
TCGCAATAAAGACCAAAATTCTCCAATTCACGTGTTAGATTCTATTACTC
AAAGAGATCGAGAAATCAATACAAAAAATTTCGGTAAAAACGGAGCCCTT
GGTCATGAATTGCAGATGTTAGTCGCCAGTTTTAGGCATTTCGATTTGCT
AAAGTTTATCCCTACTGATGACCAAATATCAAGGAAGAGAGCTGCAAAGT
TACAGGAGTTGATAAATTATTTAAACAACACTGGGTTATCAGCTATTGAA
ATAAACTACGCCATCAAGCTCTTTATTCTTGAAAATTTAACACTGAGTGG
AGTTGATGAAAATGGGGTAATAAGGATTAATAACGAAGACGGATATTTCC
AAAGAAATAACTACCAAGTTTGGGATGATCCTTATATGATTCTTAATGAT
GTAGCCCAATCTATCATTGATGAAGAAAATAAAACATTGAAAGACGAAGC
AGCTAGCAGCGAAAAAGACAGTATATCAATTATTGAATCTGAACCTGCAC
TGTCGTTTATAAAAAATGAAAACTTTACCGAAGGGATTTTGAAAAGCAGT
CGCGTTTCAAGTCGGTCCCAATCACCGGAAAATATAAAATCTAGACGAAA
GTCGTCAGTTCATTTTTTAGAAACCGAACGAGTTGAATCTCCAACAATGT
CAACTGAAACACAAATGGATATAATGGCCTTTATTAACAATCAAAACGAT
GAAGGATTTCAAGAAATTCTGTTGGACTACCTGTCTAATTTAAGAAAAAG
AAATTTCAGTGAATGGTGCTTTGAGGAATTTTATGAACCTCATGTTCTTT
TACAGATAGTCCATCAATCAATTTACAAATTACCGTACATTGACATTTAC
GACCAGCGGCGGGTTGATGGCAAATTGGTAGTGCTCCACAACCCTTTCCA
TCCCGATACTAAGTACAACCATCATTCATGGAACAAATGGTTGCATTCAA
ATGTGGGATTTAGAAATTATTTGGATTTTGTTCATGACAAAATCACCGAC
TGGAACCGCGACCAAGAAGCGATTTATCAAGCCAATTTATTGAATCAAGA
ATTACAAATTGTTGAAACAGAAATAAAAGAAACTGAAGTAAAAGGCAAAT
CCTCCAAAACTAATGAAAAAGGTAAAAAACCAAAACCATCTAAAAGTCGA
AGCCGAAGTACATCAAGGGGTTCAAGTGCAGAAGAAACATCGACTCAAGA
ATTAAGTTTGATTGTACCTGGTTCTCTTAAAGCTCAAAAATTGGAGCAAG
AAAAAATTAACAAAGCCAAAGCAGAAGAGGAAATGAAAAAAGAACAAAAG
CGTCAGTTATCAGCACAAAAGAAAACTGAAAAAGACTTGGCGAAAAATGT
TGAAAAAACTAAAGACAGTAAAAGACCAAGTTCTAAAGCTTCGAATAAAT
CGAAAACAAAGAAAACGGCTTTTGAAGATTCTGGAGAAAATTTTGATAAA
GAAAACTATCAGGAAATTTATACTGATAGAATTGATGGAGAAGAATATTG
GCCTTTTATTAGCTACCATCTTGATAATGATTTGGCTCATTTTATGGGAA
TGGTGGCTCATCTCTTTCCTAGCGATGGATCCATTATTCGAGTTTTTAAA
ATGCAAAAGCTTCTTGATACGACATCTGTACGGGTTTCCGTCATTACTAC
GCAGTCCCATGTGTTCACGATTCATATTCTTGATCCAACTTATTCTCCAG
ACTCTCAAATTGATAATTTTGATCAAATTCTGGAACAGTTTTCCCATTCG
AAAAATATCTGTAATTACGGCGCGTCAACTTGTACATTTAATGATGGTAT
TACGATCGCCGCATCCAATAATGGCTATTCCGGTAGTCAATTGAAAAATA
AGTCTCCGATTGGAGCGCCGAACGATGAAATTTCAAGTCACCGAAGCAAT
GATCTTACTGTCAATGGAAATAAAGAAGAAATTTTTCAAAATGACACAAA
TGAGACGAATGAGAAAATAATTACGCAAAAGAATCCATTCGTAAATCACA
TGGACTATATAGATTCTCCTAATATTATCCTGACTACCCCAGATGGTGTT
CAAGTATCTGTAGGTTATGAGTCAGCAGAAAATGAAAATCAAAGAAATCT
GTTACTATTCATGTGCAAATTCGAATCATCACTAAAACCAAGTGTACCAC
CTGAACTATCTAGTATTCAGGCACCAGAAATTGGGCGATATATCACATCA
GATGGACGGGTCGTGACCATTTTCAAAAATGAACTTATAAAAGTTTTATT
TCCTGATGGAACAGTTGCCTTGTCGCAGTTATCAATGCAATCCTCAGTGA
GCCAAGATGACGAGGTTGAAGAGTTTAAAATAGAAAACATCAACGTGAAA
GAAAGTCCAAATTCAAAACGAAAAACGAAACAGTCGAAGTCAATATCTGT
AGAGCCACAAACCCCTTTGAACACGGTTCTAGTCGAAGATTCGAAACCTT
CATGTAATTACTCGAGAAAATGGACAATTACACTGTCAAATGGAGAAGTG
TTTGAAACAGTTGCAAATTTAAATTCGATATTTAATCCGAAACCTTTGAT
CGAAACGATTGAAACAAAATTGGATGACGAAGCAACTACTGATGAAAACA
ACGACATTTTAGAAGCGAATCAACCAACAGAAAAAGAACGCTCATTTAAG
TCTTTACAGACCAAAGAACGGTTATTGACTAGTTACGCAACTGATCCTTC
AACCGGTGAAACTCTTGTTACTCGATCCGATGGAACGTTGTTATTAGTGT
CTCAGGATGCGGGAATATTTCTATGTGAACATTCTGACGGGACTCGTTTT
ACAAAATATTTCAATGTAGAGAAGTCATCAAGTTCCACATATGAACCGGG
TGAGATTTCTAGAGCAAAAATAAGCGAGCTTTTGTTGATTGAAAGTAAAC
AATATCCCGCTGTCATCATTGATCTGACTAATGAAAAAATTGAAACCCGC
TGTGGCTCAATGGGAGCACTTTTATCTAATTCCTGTGGACATCATATATT
TAAACATTCGGACAATACGGAAATCGAGTATAGGCCTGACGGAGAAATTA
TTTTTACGGCTTCCGTCAATTCACAAATGTCTTATTTACAACCCGACGGC
CCTTTCAGTTACGTTTTCAATCCGACTTCAAATGTGATTTGTGAAATTAT
TGACAGTGAAGGGACGGAATTTATTGTCAATATTAATGGGGAATTCGATG
TGAAAATCAACAAGAAAAATGACAAGCCTTTTGAAGAGGCATCTCAAGTC
TTGGAAACTGACCAAGACCTTGGCAAGTTAAGAAAACTAAACAGTGTGAT
CAGTATGACCAATGATTCCAACGACAACGTCCAGAAATATGATCAACATG
CTCCAAGATTATTTACAATAAATCCTGACGGAAGTGGCTCGGAACTGTTG
CGCTATCGGGATATTGTTGACACGCTTGTCAATTCGGATATCGATGAAAA
TTATTTTCATTGTCGAGAGGAAATACAAAATTCACCAAAAATTATAGCTC
ACACAATTTTGCACTCGGATTCCAAAATCAAACCTTGGAAATATGAATAT
TCCAGGAAAACTGTTTTACCCAAAGGATTGACTTGTCGAGACATGAAAAC
ATTTCCTCCTAAAGAAATAAAAACCGACGGGCCACCTTTTGGAATGAGTG
TTGGAAAAGGTCTGGAGATATATTCGAATCCGATCATGGCGAAGAATGTA
CAAAAACCAAAGAAAAGTTTCCGACAAGATCATTGGTTGAATCCGATGCA
ATTTCGGCAGTTTTATCATTATCCAACAATCGGAAAGGATGTTCGTAGCA
GCTTTTCGGAAAAACTAATTGATTATAATAAAAAGATCTTGCAACAGCGT
CAATTGTATAAAGATTTGGAAATTGTTAATCAAAGTGATGAAGAAAAGAA
AATAGCCGATGAAATTTTAGAAAAATTCAAAGTTCTGAAATTCAGTAAAG
AAAGTATTGCCAATGCCATCGGCTCATTGGTAAACATCAATTCCACACAA
GGTGAAATGAGTTCTAAAGCTTTCGAAACAAATGCAAAAACGGCTCTTCC
TAAGAATCCTAGTCACCGAAAACTCGATGTCATTCTAGAACAAGAAAAAA
TAAATAAAGAGAAAGAAATAGAAAACCGGGCCTCTTTGAAAAATCACATT
GTTCCAAAATATTTTACATCGATTTATGGGAAAGATTTTATTTCAAAACA
AGCAATGGATTTACAATCACTTAACAAGTCTATGAAATTATTTCCTATAA
GTAGAGAAGGAACAGATGTCAATGATTTGAAAGACAAAAATGAGTTTTTA
AATGAGACTGAAACATCAGAGGTGTCACTTTTATCACCGAAATTCCAAGT
TGATTACCTAGAGCAATCTCCAGAAAATTCTACTAAAAACTCCAAAAACT
TACTGAAGCCAAAATTAATTATTCAAAAAAGGGCGACAAATTATTTATAT
TATGATTCAAATTTATTTATTCCCAATGAACCTAAACGTCTGCCAGAATT
ATCAAATATTAATTTACCAAATTATTTATATGCTGAAAGGCCATCTATAG
AACCTAACATTCATCAAGCATTGGTAGAAGATCCTGTCAGGCGAAAGGTT
TATACAACTAGTCTTATTGGTGGTTCAGAAACCAGCCAAATCTTACAACG
AAAAACTCGGGGACTTAATGTTTTTCCTGCGCGAGTTGACACTGGCCTAT
TGAAAGAAGGCCTGAATTATACGTTCAAAATTAAATTAATCAACACAGGT
CCTGAGAGTTCATGTTTCAAAATCAAGCAGCCTCATTCTTCGACCGGAAT
TTGGGTGGAATTTCTACCCGGCCCAATTGCTGCCGGACTGTCTCGGAAAT
TAAACATTCATATTTACGCAATTGCCAATAATCTTGAAAAAAATAGCTCA
AATGTTTCACTGTTGGAACATTTTCTACAGATTACTACTAACACGGACCA
ACTTATTATTCCAATAGTTGGCCGAGTGATGACCGCCGAGAACTACCAGT
CAATCTACCCGATATCCAAGACTGATAGCCGGTCTGAGATGTCCGAATTG
GAGTCACGTCTAAATATTGAAGAAAAATTTATTCCTAAAATAATAAAATG
AATAAACAGAATGTGTTAGAAGATTTTTTAAGATATTTCATTAGATCTTT
ATGAATAAATACATTTTTGTTTTGTATTTTGCGAGATCGGAAG
back to top

protein sequence of SMED30035047-orf-1

>SMED30035047-orf-1 ID=SMED30035047-orf-1|Name=SMED30035047-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2193bp
MSKKRNKSPAANIASGNKWESNITAAELNEDNWSYSLSMIIENIPQDTET
INYINLGISTGLRKKFTLITLEKITQLINDFGNPKSKKGKEAPLNFEICE
IGKSHLDKNEALPAPYLAKFIKWIMLTNKTEDMKNTGDTNKKVDGKVSKA
KKATDKSERAKSSGGKKGSQVPGKRSPEPPSVKQDNKLRKRGDPDPDIQY
IDDEPDDGSSRYFVISGLVDHLLLASLADIGCITTSIVKVTRDIHIPNEN
LNEEVENQERISNGSDKENSDNNLYEMQIENLKSFWTNINPVLNDNKTLL
NTPIITLVAKHLMFPVERENEDLKIKCAMELFESLAVLMYDLLDLKRQWK
NYLDKSKLIALPVKTSVAQTHENTTPRESIKEGVQASPDNTDSHMNFTFD
KFNIDYYNFLLQDVPIESTSIYLQMSAMLDQVEITAGEKTPIWELNKSDL
PKDLNEDSIDVFKKITDNIYFPKESLLELKTSLKIPLDDDDENRNKDQNS
PIHVLDSITQRDREINTKNFGKNGALGHELQMLVASFRHFDLLKFIPTDD
QISRKRAAKLQELINYLNNTGLSAIEINYAIKLFILENLTLSGVDENGVI
RINNEDGYFQRNNYQVWDDPYMILNDVAQSIIDEENKTLKDEAASSEKDS
ISIIESEPALSFIKNENFTEGILKSSRVSSRSQSPENIKSRRKSSVHFLE
TERVESPTMSTETQMDIMAFINNQNDEGFQEILLDYLSNLRKRNFSEWCF
EEFYEPHVLLQIVHQSIYKLPYIDIYDQRRVDGKLVVLHNPFHPDTKYNH
HSWNKWLHSNVGFRNYLDFVHDKITDWNRDQEAIYQANLLNQELQIVETE
IKETEVKGKSSKTNEKGKKPKPSKSRSRSTSRGSSAEETSTQELSLIVPG
SLKAQKLEQEKINKAKAEEEMKKEQKRQLSAQKKTEKDLAKNVEKTKDSK
RPSSKASNKSKTKKTAFEDSGENFDKENYQEIYTDRIDGEEYWPFISYHL
DNDLAHFMGMVAHLFPSDGSIIRVFKMQKLLDTTSVRVSVITTQSHVFTI
HILDPTYSPDSQIDNFDQILEQFSHSKNICNYGASTCTFNDGITIAASNN
GYSGSQLKNKSPIGAPNDEISSHRSNDLTVNGNKEEIFQNDTNETNEKII
TQKNPFVNHMDYIDSPNIILTTPDGVQVSVGYESAENENQRNLLLFMCKF
ESSLKPSVPPELSSIQAPEIGRYITSDGRVVTIFKNELIKVLFPDGTVAL
SQLSMQSSVSQDDEVEEFKIENINVKESPNSKRKTKQSKSISVEPQTPLN
TVLVEDSKPSCNYSRKWTITLSNGEVFETVANLNSIFNPKPLIETIETKL
DDEATTDENNDILEANQPTEKERSFKSLQTKERLLTSYATDPSTGETLVT
RSDGTLLLVSQDAGIFLCEHSDGTRFTKYFNVEKSSSSTYEPGEISRAKI
SELLLIESKQYPAVIIDLTNEKIETRCGSMGALLSNSCGHHIFKHSDNTE
IEYRPDGEIIFTASVNSQMSYLQPDGPFSYVFNPTSNVICEIIDSEGTEF
IVNINGEFDVKINKKNDKPFEEASQVLETDQDLGKLRKLNSVISMTNDSN
DNVQKYDQHAPRLFTINPDGSGSELLRYRDIVDTLVNSDIDENYFHCREE
IQNSPKIIAHTILHSDSKIKPWKYEYSRKTVLPKGLTCRDMKTFPPKEIK
TDGPPFGMSVGKGLEIYSNPIMAKNVQKPKKSFRQDHWLNPMQFRQFYHY
PTIGKDVRSSFSEKLIDYNKKILQQRQLYKDLEIVNQSDEEKKIADEILE
KFKVLKFSKESIANAIGSLVNINSTQGEMSSKAFETNAKTALPKNPSHRK
LDVILEQEKINKEKEIENRASLKNHIVPKYFTSIYGKDFISKQAMDLQSL
NKSMKLFPISREGTDVNDLKDKNEFLNETETSEVSLLSPKFQVDYLEQSP
ENSTKNSKNLLKPKLIIQKRATNYLYYDSNLFIPNEPKRLPELSNINLPN
YLYAERPSIEPNIHQALVEDPVRRKVYTTSLIGGSETSQILQRKTRGLNV
FPARVDTGLLKEGLNYTFKIKLINTGPESSCFKIKQPHSSTGIWVEFLPG
PIAAGLSRKLNIHIYAIANNLEKNSSNVSLLEHFLQITTNTDQLIIPIVG
RVMTAENYQSIYPISKTDSRSEMSELESRLNIEEKFIPKIIK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0031514motile cilium
GO:0042995cell projection
GO:1990716axonemal central apparatus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026173SPAG17
Vocabulary: biological process
TermDefinition
GO:0003351epithelial cilium movement
GO:0030030cell projection organization
GO:1904158axonemal central apparatus assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1855..1875
NoneNo IPR availableCOILSCoilCoilcoord: 904..946
NoneNo IPR availableCOILSCoilCoilcoord: 837..857
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 180..200
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 877..898
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 675..695
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 917..971
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 854..870
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 854..902
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 136..200
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 136..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1278..1298
IPR026173Sperm-associated antigen 17PANTHERPTHR21963PF6coord: 14..2155