Prefoldin subunit 3

Overview
NamePrefoldin subunit 3
Smed IDSMED30035045
Length (bp)1081
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prefoldin subunit 3 (SMED30035045) t-SNE clustered cells

Violin plots show distribution of expression levels for Prefoldin subunit 3 (SMED30035045) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prefoldin subunit 3 (SMED30035045) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prefoldin subunit 3 (SMED30035045) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035045

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30035045h1SMcG0017802 dd_Smed_v4_3319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035045h1SMcG0017802 dd_Smed_v4_3319_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prefoldin subunit 3 vs. Ensembl Human
Match: VBP1 (VHL binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12662])

HSP 1 Score: 144.436 bits (363), Expect = 4.814e-41
Identity = 80/175 (45.71%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            MAT    G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   13 MATG--NGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 185          
BLAST of Prefoldin subunit 3 vs. Ensembl Human
Match: VBP1 (VHL binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12662])

HSP 1 Score: 132.88 bits (333), Expect = 9.927e-37
Identity = 71/162 (43.83%), Postives = 101/162 (62.35%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
              P  +  ED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   19 STPSPEHQEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 180          
BLAST of Prefoldin subunit 3 vs. Ensembl Human
Match: VBP1 (VHL binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12662])

HSP 1 Score: 132.88 bits (333), Expect = 9.927e-37
Identity = 71/162 (43.83%), Postives = 101/162 (62.35%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
              P  +  ED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   19 STPSPEHQEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 180          
BLAST of Prefoldin subunit 3 vs. Ensembl Celegans
Match: pfd-3 (Probable prefoldin subunit 3 [Source:UniProtKB/Swiss-Prot;Acc:O18054])

HSP 1 Score: 117.472 bits (293), Expect = 1.770e-31
Identity = 59/161 (36.65%), Postives = 100/161 (62.11%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHF---ETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAV 599
            GIPK++ +ED E ++      +  EA   + E Y KYK++E + L +K+R+ ++IP+   +L ++        + E FETT+ +S  ++  A V+K +KV++WLGANVM+EY L+ A+++L KN  +  + +  L N L ++KDQ+TT EVN++   N  V
Sbjct:   12 GIPKSELIEDVESWLTKEKL-SIEEAEVVLREKYGKYKYVESSMLAQKVRMSEKIPEFENSLSIIDTLIAKRAADESFETTFLLSDDVYTKATVQKPEKVSIWLGANVMVEYDLENARKLLDKNRGSVQKVVDELTNELSYIKDQITTTEVNMSHIVNFGV 171          
BLAST of Prefoldin subunit 3 vs. Ensembl Fly
Match: mgr (gene:FBgn0264694 transcript:FBtr0082406)

HSP 1 Score: 110.923 bits (276), Expect = 9.279e-29
Identity = 60/162 (37.04%), Postives = 97/162 (59.88%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQ 611
            GIP+A F+E+ + ++      N  +  + ++E + KY+FM  N   ++ +L  QIPD+ ++L++V       E  ET + +S Q+     V     V LWLGA+VM+EY LDEA+ +L +N  +A   L ++E+  +FL+DQ+TT EVN+AR +N  VK  Q
Sbjct:   22 GIPEAVFLEEIDTFMSQPENENCEKVLQRLDEQHGKYRFMACNLEARRRKLKSQIPDLERSLEMVNVLRKEDEERETQFLLSDQVFIKTLVPPTKTVYLWLGASVMLEYPLDEAEALLNQNITSAVGNLKSVEHDQDFLRDQITTTEVNMARVYNWGVKKRQ 183          
BLAST of Prefoldin subunit 3 vs. Ensembl Fly
Match: CG15676 (gene:FBgn0034651 transcript:FBtr0342957)

HSP 1 Score: 55.8398 bits (133), Expect = 4.780e-9
Identity = 39/168 (23.21%), Postives = 87/168 (51.79%), Query Frame = 3
Query:  108 GDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEEL-YQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHF-ETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKN 605
            G ++   IP+A  V+D   Y+    +++ + A   M+ L Y +Y  +          ++ ++   +  L++V+ F +   +   +  +I+  +  +  +  V KV L +GA++ ME+ L EA+E + K+  +  +     E+ +++L+DQ+ T+E+N+A  +   V+N
Sbjct:   15 GRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPAALKMQRLFYVQYSELAAKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKEVHSLVQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITSLVKQQLQHEHDIDYLQDQVNTIEMNLAVLYKHEVEN 182          
BLAST of Prefoldin subunit 3 vs. Ensembl Fly
Match: CG15676 (gene:FBgn0034651 transcript:FBtr0071668)

HSP 1 Score: 55.8398 bits (133), Expect = 4.780e-9
Identity = 39/168 (23.21%), Postives = 87/168 (51.79%), Query Frame = 3
Query:  108 GDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEEL-YQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHF-ETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKN 605
            G ++   IP+A  V+D   Y+    +++ + A   M+ L Y +Y  +          ++ ++   +  L++V+ F +   +   +  +I+  +  +  +  V KV L +GA++ ME+ L EA+E + K+  +  +     E+ +++L+DQ+ T+E+N+A  +   V+N
Sbjct:   15 GRKSFMPIPEAKLVDDVVSYIAKPEFYSTVPAALKMQRLFYVQYSELAAKLETDLTAVLTRLEAAKNNLELVRRFIDNPDKEVHSLVQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITSLVKQQLQHEHDIDYLQDQVNTIEMNLAVLYKHEVEN 182          
BLAST of Prefoldin subunit 3 vs. Ensembl Zebrafish
Match: vbp1 (von Hippel-Lindau binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-050522-494])

HSP 1 Score: 144.05 bits (362), Expect = 3.729e-41
Identity = 77/181 (42.54%), Postives = 114/181 (62.98%), Query Frame = 3
Query:   87 MATAIKTGD------ENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFET---SQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            MAT I++G+      +   GIP+A FVED + ++K  G        + ++E YQKYK+ME N   KK+RL  QIP I++TL++++H +    + +P ET + ++  ++  A V   DKV LWLGANVM+EY +D A+ +L KN   A+  L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:    1 MATTIESGNAGAANKKKHLGIPEAIFVEDVDAFMKQPGNDTADAVLRKLDEQYQKYKYMELNLGQKKLRLKSQIPQIKQTLEILRHMQKKKDTTDPMETHFLLADNVYCKASVPPTDKVCLWLGANVMLEYDIDAAQALLEKNLATASRNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 181          
BLAST of Prefoldin subunit 3 vs. Ensembl Xenopus
Match: vbp1 (von Hippel-Lindau binding protein 1 [Source:NCBI gene;Acc:100145749])

HSP 1 Score: 145.976 bits (367), Expect = 7.738e-42
Identity = 77/174 (44.25%), Postives = 109/174 (62.64%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFET---SQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNA 638
            GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL++++H +    + EP +T + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT  L + E  L+FL+DQ TT EVN+AR +N  VK    +  ++  A
Sbjct:   19 GIPEAVFVEDVDAFMKKPGNETADAVLKKLDEQYQKYKFMELNLTQKKRRLKSQIPEIKQTLEILKHMQKKKDTTEPMKTRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATRNLDSTEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDPSKSKA 192          
BLAST of Prefoldin subunit 3 vs. Ensembl Mouse
Match: Vbp1 (von Hippel-Lindau binding protein 1 [Source:MGI Symbol;Acc:MGI:1333804])

HSP 1 Score: 145.591 bits (366), Expect = 9.159e-42
Identity = 79/175 (45.14%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            + TA   G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   10 LETAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 184          
BLAST of Prefoldin subunit 3 vs. Ensembl Mouse
Match: Vbp1 (von Hippel-Lindau binding protein 1 [Source:MGI Symbol;Acc:MGI:1333804])

HSP 1 Score: 86.2705 bits (212), Expect = 3.152e-20
Identity = 48/117 (41.03%), Postives = 68/117 (58.12%), Query Frame = 3
Query:   93 TAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQE---PFETTYEISSQLHGFAEVEKVDKVNLWLGA 434
            TA   G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGA
Sbjct:   12 TAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGA 128          
BLAST of Prefoldin subunit 3 vs. UniProt/SwissProt
Match: sp|P61759|PFD3_MOUSE (Prefoldin subunit 3 OS=Mus musculus OX=10090 GN=Vbp1 PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 6.407e-41
Identity = 79/175 (45.14%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            + TA   G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   10 LETAAGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 184          
BLAST of Prefoldin subunit 3 vs. UniProt/SwissProt
Match: sp|Q5RCG9|PFD3_PONAB (Prefoldin subunit 3 OS=Pongo abelii OX=9601 GN=VBP1 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.312e-40
Identity = 80/175 (45.71%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            MAT    G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   13 MATG--NGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 185          
BLAST of Prefoldin subunit 3 vs. UniProt/SwissProt
Match: sp|P61758|PFD3_HUMAN (Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP1 PE=1 SV=4)

HSP 1 Score: 144.436 bits (363), Expect = 2.312e-40
Identity = 80/175 (45.71%), Postives = 110/175 (62.86%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            MAT    G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   13 MATG--NGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 185          
BLAST of Prefoldin subunit 3 vs. UniProt/SwissProt
Match: sp|Q2TBX2|PFD3_BOVIN (Prefoldin subunit 3 OS=Bos taurus OX=9913 GN=VBP1 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 5.766e-39
Identity = 78/172 (45.35%), Postives = 108/172 (62.79%), Query Frame = 3
Query:   96 AIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEP---FETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            A   G     GIP+A FVED + ++K  G        K ++E YQKYKFME N   KK RL  QIP+I++TL+++++ +  +E     ET + ++  L+  A V   DKV LWLGANVM+EY +DEA+ +L KN   AT+ L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:   14 AAGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADIVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYKQKKKESTSSLETRFLLADNLYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLLTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVK 185          
BLAST of Prefoldin subunit 3 vs. UniProt/SwissProt
Match: sp|O18054|PFD3_CAEEL (Probable prefoldin subunit 3 OS=Caenorhabditis elegans OX=6239 GN=pfd-3 PE=3 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.252e-30
Identity = 59/161 (36.65%), Postives = 100/161 (62.11%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHF---ETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAV 599
            GIPK++ +ED E ++      +  EA   + E Y KYK++E + L +K+R+ ++IP+   +L ++        + E FETT+ +S  ++  A V+K +KV++WLGANVM+EY L+ A+++L KN  +  + +  L N L ++KDQ+TT EVN++   N  V
Sbjct:   12 GIPKSELIEDVESWLTKEKL-SIEEAEVVLREKYGKYKYVESSMLAQKVRMSEKIPEFENSLSIIDTLIAKRAADESFETTFLLSDDVYTKATVQKPEKVSIWLGANVMVEYDLENARKLLDKNRGSVQKVVDELTNELSYIKDQITTTEVNMSHIVNFGV 171          
BLAST of Prefoldin subunit 3 vs. TrEMBL
Match: A0A0R3W2P9 (Prefoldin subunit 3 OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4125 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.533e-57
Identity = 89/162 (54.94%), Postives = 123/162 (75.93%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQ 611
            GIPKA F+ED +DY+K +GY    +A +A++++YQKYK ME+ FL +K+RL+QQ+PDI KTLDVV+H E   E F+ T+E+S QL+  A ++K DKV LWLGANVM+EY+L EAK++L  N  +A   ++++E  L FLK+Q TTVEV++AR HNL VK NQ
Sbjct:   24 GIPKATFIEDVDDYLKTNGYATIRDAMQALDQIYQKYKLMEQAFLQRKLRLLQQMPDITKTLDVVKHLEKKNEDFDVTFEVSDQLYARAHIDKADKVGLWLGANVMLEYNLAEAKDILLANLTSAETSMADVEETLAFLKEQTTTVEVSLARLHNLNVKRNQ 185          
BLAST of Prefoldin subunit 3 vs. TrEMBL
Match: A0A0R3X1T9 (Prefoldin subunit 3 OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7187 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.820e-57
Identity = 89/162 (54.94%), Postives = 123/162 (75.93%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQ 611
            GIPKA F+ED +DY+K +GY    +A +A++++YQKYK ME+ FL +K+RL+QQ+PDI KTLDVV+H E   E F+ T+E+S QL+  A ++K DKV LWLGANVM+EY+L EAK++L  N  +A   ++++E  L FLK+Q TTVEV++AR HNL VK NQ
Sbjct:   24 GIPKATFIEDVDDYLKTNGYATIRDAMQALDQIYQKYKLMEQAFLQRKLRLLQQMPDITKTLDVVRHLEKKNEDFDVTFEVSDQLYARAHIDKADKVGLWLGANVMLEYNLAEAKDILLANLSSAETSMADVEETLAFLKEQTTTVEVSLARLHNLNVKRNQ 185          
BLAST of Prefoldin subunit 3 vs. TrEMBL
Match: A0A0R3UKM9 (Prefoldin subunit 3 OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8163 PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 2.631e-57
Identity = 89/162 (54.94%), Postives = 122/162 (75.31%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQ 611
            GIPKA F+ED ++Y++ +GY    +A +A+++LYQKYK ME+ FL +K+RL+QQ+PDI KTLDVV H ET  E F+ T+E++ QL+  A +++ DKV LWLGANVM+EY L EAKE+L  N  AA   ++++E  L FLK+Q TTVEV++AR HNL VK NQ
Sbjct:   22 GIPKATFIEDVDEYLRANGYATIRDAMQALDQLYQKYKLMEQAFLQRKLRLLQQMPDITKTLDVVNHLETKNENFDVTFEVADQLYARAHIDRADKVGLWLGANVMLEYDLKEAKEILLANLSAAETSMADVEETLSFLKEQTTTVEVSMARLHNLNVKRNQ 183          
BLAST of Prefoldin subunit 3 vs. TrEMBL
Match: A0A183PFU2 (Prefoldin subunit 3 OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS13228 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.461e-57
Identity = 91/179 (50.84%), Postives = 132/179 (73.74%), Query Frame = 3
Query:  102 KTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNA 638
            K  D ++ GIPKA+F+ED + Y+K + +   +EA ++ EELYQKYK +E+  L +K+RLMQQ+PDI+KTL VV+  +      + T+EIS+QL+  A + K D+V LWLGANVM+EY L+EA ++L +NE++A + L +++  LEFLK+Q TTVEVN+AR HNL+VK  + NQ +EVNA
Sbjct:   13 KHNDMDKKGIPKAEFIEDVDAYMKANNFSTLMEAGRSFEELYQKYKIIEQALLQRKIRLMQQLPDIQKTLAVVRQLQKQNTSLDVTFEISNQLYTRAHIPKADRVGLWLGANVMLEYDLEEADKILVENEQSAEQSLQDVDQTLEFLKNQTTTVEVNLARLHNLSVKRGRQNQSSEVNA 191          
BLAST of Prefoldin subunit 3 vs. TrEMBL
Match: A0A430Q003 (Prefoldin subunit 3 OS=Schistosoma bovis OX=6184 GN=DC041_0002909 PE=3 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.898e-57
Identity = 91/176 (51.70%), Postives = 131/176 (74.43%), Query Frame = 3
Query:  111 DENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNA 638
            D ++ GIPKA+F+ED + Y+K + +   +EA ++ EELYQKYK +E+  L +K+RLMQQ+PDI+KTL VV+  +      + T+EIS+QL+  A + K D+V LWLGANVM+EY L+EA ++L +NEK+A + L +++  LEFLK+Q TTVEVN+AR HNL+VK  + NQ +EVNA
Sbjct:   16 DMDKKGIPKAEFIEDVDAYMKANNFSTLMEAGRSFEELYQKYKIIEQALLQRKIRLMQQLPDIQKTLAVVRQLQKQNTNLDVTFEISNQLYTRAHIPKADRVGLWLGANVMLEYDLEEADKILVENEKSAEQSLQDVDQTLEFLKNQTTTVEVNLARLHNLSVKRGRQNQSSEVNA 191          
BLAST of Prefoldin subunit 3 vs. Ensembl Cavefish
Match: vbp1 (VHL binding protein 1 [Source:NCBI gene;Acc:103045644])

HSP 1 Score: 142.895 bits (359), Expect = 9.047e-41
Identity = 76/181 (41.99%), Postives = 113/181 (62.43%), Query Frame = 3
Query:   87 MATAIKTGD------ENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFET---SQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            MAT I++ +      +   GIP+A FVED + ++K  G        + ++E YQKYK+ME N   KK+RL  QIP I++TL++++H +    + +P  T + ++  ++  A V   DKV LWLGANVM+EY +DEA+ +L KN   A+  L +LE  L+FL+DQ TT EVN+AR +N  VK
Sbjct:    1 MATTIESSNAGAASKKKHLGIPEAIFVEDVDSFMKQPGNDTADAVLRKLDEQYQKYKYMELNLSQKKLRLKSQIPQIKQTLEILRHMQKKKDTTDPMATHFLLADNVYCKASVPPTDKVCLWLGANVMLEYDIDEAQSLLEKNLATASRNLESLEEDLDFLRDQFTTTEVNMARVYNWDVK 181          
BLAST of Prefoldin subunit 3 vs. Ensembl Cavefish
Match: vbp1 (VHL binding protein 1 [Source:NCBI gene;Acc:103045644])

HSP 1 Score: 132.88 bits (333), Expect = 7.605e-37
Identity = 71/172 (41.28%), Postives = 107/172 (62.21%), Query Frame = 3
Query:   87 MATAIKTGD------ENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFET---SQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNI 575
            MAT I++ +      +   GIP+A FVED + ++K  G        + ++E YQKYK+ME N   KK+RL  QIP I++TL++++H +    + +P  T + ++  ++  A V   DKV LWLGANVM+EY +DEA+ +L KN   A+  L +LE  L+FL+DQ TT EV+I
Sbjct:    1 MATTIESSNAGAASKKKHLGIPEAIFVEDVDSFMKQPGNDTADAVLRKLDEQYQKYKYMELNLSQKKLRLKSQIPQIKQTLEILRHMQKKKDTTDPMATHFLLADNVYCKASVPPTDKVCLWLGANVMLEYDIDEAQSLLEKNLATASRNLESLEEDLDFLRDQFTTTEVSI 172          
BLAST of Prefoldin subunit 3 vs. Ensembl Yeast
Match: PAC10 (Part of the heteromeric co-chaperone GimC/prefoldin complex; complex promotes efficient protein folding [Source:SGD;Acc:S000003310])

HSP 1 Score: 100.138 bits (248), Expect = 1.724e-25
Identity = 64/187 (34.22%), Postives = 103/187 (55.08%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHF-------ETSQEPFETTYEISSQLHGFAEVE----KVD-KVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQ 611
            M T   + ++N  GIP+A F+E+  + +K     +F       +E   KYKFM+++ L    +L  +IPD+  TL + Q         + S EP    Y+++  L+  A+V+    + D KV LWLGA+VM+EY +DEA E+L K    + + L+     +EFL++ +TT+EVN AR +N  V+  Q
Sbjct:    1 MDTLFNSTEKNARGIPQAPFIENVNEIIK--DPSDFELCFNKFQERLSKYKFMQESKLATIKQLKTRIPDLENTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQVDIPEDRADLKVGLWLGADVMLEYPIDEAIELLKKKLADSEQSLTVSTEDVEFLRENITTMEVNCARLYNWDVQRRQ 185          
BLAST of Prefoldin subunit 3 vs. Ensembl Nematostella
Match: EDO30383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y5])

HSP 1 Score: 137.502 bits (345), Expect = 3.108e-39
Identity = 73/177 (41.24%), Postives = 110/177 (62.15%), Query Frame = 3
Query:   90 ATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYE---ISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQ 611
            ++     D+   GIP+A F++D   ++      +     ++ +E  +KYKFME N L KK +L  Q+PD++ +L++V+  +  +E  E T+    IS QL+  A+V   +KV LWLGANVM+EYS+DEA+E+L KN K A + L  LE+ L FL+DQ TT EVN+AR +N  V+  Q
Sbjct:    8 SSTSSVSDKKHRGIPEAGFLDDVGKFMSTSSSDSAESVIRSFDEQLRKYKFMEINLLTKKKKLQGQVPDLKSSLEMVKLLQAKKEKGEETHSRFLISDQLYANAKVPPTEKVCLWLGANVMLEYSIDEAEELLQKNLKTAIKSLEELEDDLGFLRDQYTTTEVNMARVYNWDVRRRQ 184          
BLAST of Prefoldin subunit 3 vs. Ensembl Medaka
Match: vbp1 (VHL binding protein 1 [Source:NCBI gene;Acc:101157572])

HSP 1 Score: 140.969 bits (354), Expect = 5.292e-40
Identity = 73/162 (45.06%), Postives = 105/162 (64.81%), Query Frame = 3
Query:  126 GIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFET---SQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVK 602
            GIP+A F+ED + ++K  G        + ++E YQKYK+ME N   KK+RL  QIP I +TL++++H +    + EP ET + ++  ++  A V   DKV LWLGANVM+EY +DEA+ +L KN   A+  L  LE+ L+FL+DQ TT EVN+AR +N  VK
Sbjct:   20 GIPEAVFLEDVDFFMKQPGNETADTVLRRLDEQYQKYKYMELNLSQKKLRLKNQIPQITQTLEILRHMQKKKKTTEPMETHFLLADSVYCKASVPPTDKVCLWLGANVMLEYDIDEAQALLEKNLSTASRNLETLEDDLDFLRDQFTTTEVNMARVYNWDVK 181          
BLAST of Prefoldin subunit 3 vs. Planmine SMEST
Match: SMESG000063658.1 (SMESG000063658.1)

HSP 1 Score: 380.948 bits (977), Expect = 2.929e-134
Identity = 185/185 (100.00%), Postives = 185/185 (100.00%), Query Frame = 3
Query:   87 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNAH 641
            MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNAH
Sbjct:    1 MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKYKFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHGFAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLEFLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNAH 185          
The following BLAST results are available for this feature:
BLAST of Prefoldin subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
VBP14.814e-4145.71VHL binding protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
VBP19.927e-3743.83VHL binding protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
VBP19.927e-3743.83VHL binding protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pfd-31.770e-3136.65Probable prefoldin subunit 3 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mgr9.279e-2937.04gene:FBgn0264694 transcript:FBtr0082406[more]
CG156764.780e-923.21gene:FBgn0034651 transcript:FBtr0342957[more]
CG156764.780e-923.21gene:FBgn0034651 transcript:FBtr0071668[more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vbp13.729e-4142.54von Hippel-Lindau binding protein 1 [Source:ZFIN;A... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vbp17.738e-4244.25von Hippel-Lindau binding protein 1 [Source:NCBI g... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vbp19.159e-4245.14von Hippel-Lindau binding protein 1 [Source:MGI Sy... [more]
Vbp13.152e-2041.03von Hippel-Lindau binding protein 1 [Source:MGI Sy... [more]
back to top
BLAST of Prefoldin subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P61759|PFD3_MOUSE6.407e-4145.14Prefoldin subunit 3 OS=Mus musculus OX=10090 GN=Vb... [more]
sp|Q5RCG9|PFD3_PONAB2.312e-4045.71Prefoldin subunit 3 OS=Pongo abelii OX=9601 GN=VBP... [more]
sp|P61758|PFD3_HUMAN2.312e-4045.71Prefoldin subunit 3 OS=Homo sapiens OX=9606 GN=VBP... [more]
sp|Q2TBX2|PFD3_BOVIN5.766e-3945.35Prefoldin subunit 3 OS=Bos taurus OX=9913 GN=VBP1 ... [more]
sp|O18054|PFD3_CAEEL2.252e-3036.65Probable prefoldin subunit 3 OS=Caenorhabditis ele... [more]
back to top
BLAST of Prefoldin subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3W2P91.533e-5754.94Prefoldin subunit 3 OS=Taenia asiatica OX=60517 GN... [more]
A0A0R3X1T91.820e-5754.94Prefoldin subunit 3 OS=Hydatigena taeniaeformis OX... [more]
A0A0R3UKM92.631e-5754.94Prefoldin subunit 3 OS=Mesocestoides corti OX=5346... [more]
A0A183PFU23.461e-5750.84Prefoldin subunit 3 OS=Schistosoma mattheei OX=312... [more]
A0A430Q0033.898e-5751.70Prefoldin subunit 3 OS=Schistosoma bovis OX=6184 G... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vbp19.047e-4141.99VHL binding protein 1 [Source:NCBI gene;Acc:103045... [more]
vbp17.605e-3741.28VHL binding protein 1 [Source:NCBI gene;Acc:103045... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PAC101.724e-2534.22Part of the heteromeric co-chaperone GimC/prefoldi... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO303833.108e-3941.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vbp15.292e-4045.06VHL binding protein 1 [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of Prefoldin subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000063658.12.929e-134100.00SMESG000063658.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035045 ID=SMED30035045|Name=Prefoldin subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1081bp
GTCATCATGTTCAATTTGTATCTATGACTTAAATATTTTTGTTTACAGTT
TATACAATAATAATTTTATTCTTTTGAATATTATAGATGGCTACTGCAAT
TAAAACTGGTGATGAGAATGAATACGGGATACCAAAAGCTGATTTTGTTG
AAGATCCAGAAGACTATGTTAAAATTCATGGGTATCATAATTTTCTAGAA
GCTCGTAAAGCAATGGAAGAACTCTACCAAAAGTATAAATTTATGGAAAA
AAATTTTCTTCTCAAAAAGATGAGATTAATGCAGCAAATTCCAGATATTC
GTAAAACTCTTGATGTTGTTCAGCATTTTGAAACTTCTCAAGAGCCTTTT
GAAACCACATATGAAATAAGTTCTCAGCTTCACGGATTTGCAGAAGTAGA
AAAGGTTGACAAAGTAAACTTGTGGTTAGGAGCTAATGTTATGATGGAGT
ATTCTCTTGATGAAGCCAAAGAAGTTTTAACTAAAAATGAAAAAGCTGCA
ACAGAATATCTGTCTAATTTAGAAAATCATTTAGAATTTTTAAAGGATCA
GTTGACAACTGTTGAAGTCAACATTGCTAGGTTTCATAATTTAGCTGTTA
AAAATAATCAAATCAATCAGAAAGCCGAAGTTAATGCCCATTAAATAAAA
TAAGGGAATTATTGATGAAATTTTTTTATTTTTGGAATTAAAAATAATCA
CTTTAAAACCGAAGATTTTATTTGTTTATTGATTTGCTTGTTGATTGACT
GATGTTTTTAAATTCGTTGCGTATTGGATAACATTCAAAAGTAACACTAG
TAATAGAGTGGGAGATTTTTGTTATTTTTGTTTGTGTATTAGTTTTGAAA
GTGTATAAATTATTGGTTATTTGTAATGGAATTGTGGAAGAACTTTGTGG
ATAGTTTGTTTTTTTTAAATGTTAAATTGTAATTATTTGAAAATTTTAAT
CTTGTTTGCAATCTTAACAACTATTATTTAATTCAGTAATTTGAATGCCA
ATTATTTTATGTTTTGATTAGTTTCTATTACATAAAAGTGGATGAACCTT
AAATAATAAATTGAAAATGTATCTTATAGCC
back to top

protein sequence of SMED30035045-orf-1

>SMED30035045-orf-1 ID=SMED30035045-orf-1|Name=SMED30035045-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MATAIKTGDENEYGIPKADFVEDPEDYVKIHGYHNFLEARKAMEELYQKY
KFMEKNFLLKKMRLMQQIPDIRKTLDVVQHFETSQEPFETTYEISSQLHG
FAEVEKVDKVNLWLGANVMMEYSLDEAKEVLTKNEKAATEYLSNLENHLE
FLKDQLTTVEVNIARFHNLAVKNNQINQKAEVNAH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR016655PFD3
IPR004127Prefoldin_subunit_alpha
IPR009053Prefoldin
Vocabulary: cellular component
TermDefinition
GO:0016272prefoldin complex
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 135..162
NoneNo IPR availableCOILSCoilCoilcoord: 36..56
NoneNo IPR availableSUPERFAMILYSSF46579Prefoldincoord: 43..166
IPR004127Prefoldin alpha-likePFAMPF02996Prefoldincoord: 50..165
e-value: 1.9E-27
score: 95.5
IPR009053PrefoldinGENE3DG3DSA:1.10.287.370coord: 41..171
e-value: 3.4E-9
score: 38.2
IPR016655Prefoldin subunit 3PIRSFPIRSF016396Prefoldin_3coord: 2..184
e-value: 1.1E-56
score: 189.0
IPR016655Prefoldin subunit 3PANTHERPTHR12409PREFOLDIN SUBUNIT 3coord: 6..181