Pre-mRNA-splicing factor SPF27

Overview
NamePre-mRNA-splicing factor SPF27
Smed IDSMED30035041
Length (bp)721
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-splicing factor SPF27 (SMED30035041) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor SPF27 (SMED30035041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-splicing factor SPF27 (SMED30035041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-splicing factor SPF27 (SMED30035041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30035041h1SMcG0022407 SmedASXL_001724SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30035041h1SMcG0022407 dd_Smed_v4_4364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035041h1SMcG0022407 dd_Smed_v4_4364_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Human
Match: BCAS2 (BCAS2 pre-mRNA processing factor [Source:HGNC Symbol;Acc:HGNC:975])

HSP 1 Score: 168.318 bits (425), Expect = 1.686e-51
Identity = 88/184 (47.83%), Postives = 127/184 (69.02%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GY+  GV+E+A +LVE+E RRYRPTKNYL YL+ P     ETDIM+ EFER++ R P+E +SM+RY++PAP + + NDI AW + + N+ +Q+ +  ++ +N++L  Q+G NAWK+ +   +       +E QKL++  IQ+LNW RK  Q  AG KL+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKH-IQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Celegans
Match: bcas-2 (BCAS splicing factor homolog [Source:UniProtKB/TrEMBL;Acc:Q22417])

HSP 1 Score: 122.479 bits (306), Expect = 5.223e-34
Identity = 70/187 (37.43%), Postives = 111/187 (59.36%), Query Frame = 3
Query:   75 DHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            D  V +DALPY D  Y+EA  ++ A+ LVE E + +RPTKNYL +L +P      T  M  E +R+  +  M ++ M R ++PAP A K  D K W + L NA++Q  ++ ++  N++L  +Y A ++ +  NK +E  L   E+  +  ++ + E++ NRK  Q +AGEK+K  E+SWV +V  NY
Sbjct:   19 DDQVLVDALPYLDTEYNEAD-RQLAMKLVEHECKTFRPTKNYLTHLPVPDYDAFLTKCMLKEMDRMKKKEEMGKLDMSRCELPAPSAVKGVDRKLWAKVLRNAKAQNEHLLMRQINLELMDEYAAESY-LQRNKVMEDLLTHAEKELRKTKEAVMEVHANRKMAQLKAGEKVKQLEQSWVSMVTNNY 203          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Celegans
Match: bcas-2 (BCAS splicing factor homolog [Source:UniProtKB/TrEMBL;Acc:Q22417])

HSP 1 Score: 122.479 bits (306), Expect = 5.223e-34
Identity = 70/187 (37.43%), Postives = 111/187 (59.36%), Query Frame = 3
Query:   75 DHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            D  V +DALPY D  Y+EA  ++ A+ LVE E + +RPTKNYL +L +P      T  M  E +R+  +  M ++ M R ++PAP A K  D K W + L NA++Q  ++ ++  N++L  +Y A ++ +  NK +E  L   E+  +  ++ + E++ NRK  Q +AGEK+K  E+SWV +V  NY
Sbjct:   19 DDQVLVDALPYLDTEYNEAD-RQLAMKLVEHECKTFRPTKNYLTHLPVPDYDAFLTKCMLKEMDRMKKKEEMGKLDMSRCELPAPSAVKGVDRKLWAKVLRNAKAQNEHLLMRQINLELMDEYAAESY-LQRNKVMEDLLTHAEKELRKTKEAVMEVHANRKMAQLKAGEKVKQLEQSWVSMVTNNY 203          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Fly
Match: BCAS2 (gene:FBgn0039558 transcript:FBtr0085269)

HSP 1 Score: 186.422 bits (472), Expect = 2.703e-58
Identity = 89/184 (48.37%), Postives = 133/184 (72.28%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D GYD+ GV+ESAL++VE+E RRYRPTKNYL++L LP+  P ET +M  EFERI NR+PME +SM+RY++P PP+ K++++ AW +A+EN+ +Q+ +  +++ N++L L YG  AWK S  +         + + +  +++IQ++NW RK+ QT+AGE+L+  E  WV LV KNY
Sbjct:    5 VIVDALPYIDHGYDDVGVRESALAMVEEECRRYRPTKNYLDHLPLPASSPFETPLMANEFERIQNRLPMETLSMKRYELPPPPSGKLSEVSAWQEAIENSMAQLEHQWVRSLNLELMLDYGTEAWK-SYLEVFTAMQAKAQLQLQQLKKDIQDVNWQRKQAQTQAGERLRSLEAHWVLLVSKNY 187          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Zebrafish
Match: bcas2 (BCAS2 pre-mRNA processing factor [Source:NCBI gene;Acc:493614])

HSP 1 Score: 169.859 bits (429), Expect = 2.431e-52
Identity = 88/184 (47.83%), Postives = 127/184 (69.02%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL  P     ET+IM+ EFER++ R PME +SM+RY++PAP + + ND+ AW   + N+ +Q+ +  ++ +N++L  QYG NAWK+S N  L   ++  ++  +  ++EIQ+LNW RK +Q   G KL+  E +WV LV KNY
Sbjct:   11 VFVDALPYFDQGYDATGVREAAAALVEEETRRYRPTKNYLSYLPTPDFSAFETEIMRNEFERLAARQPMELLSMKRYELPAPSSGQKNDMTAWQDCVNNSMAQLEHQAVRIENLELMAQYGTNAWKMS-NDNLALMIENSQKELQNVRKEIQDLNWQRKNDQLAGGAKLRELESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Xenopus
Match: tmod1 (tropomodulin 1 [Source:Xenbase;Acc:XB-GENE-954354])

HSP 1 Score: 146.362 bits (368), Expect = 3.147e-43
Identity = 79/184 (42.93%), Postives = 119/184 (64.67%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL  P     ET+IM+ EFER+S+R P+E +SM+RY++PAP + + NDI AW + + N+ +Q+ +  ++ +N++                 L + + C ++  +  +++IQ+LNW RK  Q  AG +L+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYDAQGVREAAAALVEEETRRYRPTKNYLSYLPTPDYSAFETEIMRNEFERLSSRQPLELLSMKRYELPAPLSGQRNDITAWQECVNNSMAQLEHQAVRIENLE----------------NLLHMIDCAQKDLQKLRKKIQDLNWQRKNSQLTAGARLREMESTWVSLVSKNY 178          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Mouse
Match: Bcas2 (breast carcinoma amplified sequence 2 [Source:MGI Symbol;Acc:MGI:1915433])

HSP 1 Score: 168.318 bits (425), Expect = 1.157e-51
Identity = 88/184 (47.83%), Postives = 127/184 (69.02%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GY+  GV+E+A +LVE+E RRYRPTKNYL YL+ P     ETDIM+ EFER++ R P+E +SM+RY++PAP + + NDI AW + + N+ +Q+ +  ++ +N++L  Q+G NAWK+ +   +       +E QKL++  IQ+LNW RK  Q  AG KL+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKH-IQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Mouse
Match: Bcas2 (breast carcinoma amplified sequence 2 [Source:MGI Symbol;Acc:MGI:1915433])

HSP 1 Score: 56.6102 bits (135), Expect = 1.692e-10
Identity = 30/46 (65.22%), Postives = 38/46 (82.61%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLP 221
            V +DALPY D+GY+  GV+E+A +LVE+E RRYRPTKNYL YL+ P
Sbjct:   11 VVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAP 56          
BLAST of Pre-mRNA-splicing factor SPF27 vs. UniProt/SwissProt
Match: sp|Q6PBE2|SPF27_XENTR (Pre-mRNA-splicing factor SPF27 OS=Xenopus tropicalis OX=8364 GN=bcas2 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.050e-51
Identity = 87/184 (47.28%), Postives = 130/184 (70.65%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL  P     ET+IM+ EFER+S+R P+E +SM+RY++PAP + + NDI AW + + N+ +Q+ +  ++ +N++L  Q+G NAWK+  N+ L + + C ++  +  +++IQ+LNW RK  Q  AG +L+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYDAQGVREAAAALVEEETRRYRPTKNYLSYLPTPDYSAFETEIMRNEFERLSSRQPLELLSMKRYELPAPLSGQRNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVY-NENLLHMIDCAQKDLQKLRKKIQDLNWQRKNSQLTAGARLREMESTWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. UniProt/SwissProt
Match: sp|Q5RKQ0|SPF27_DANRE (Pre-mRNA-splicing factor SPF27 OS=Danio rerio OX=7955 GN=bcas2 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.835e-51
Identity = 88/184 (47.83%), Postives = 127/184 (69.02%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL  P     ET+IM+ EFER++ R PME +SM+RY++PAP + + ND+ AW   + N+ +Q+ +  ++ +N++L  QYG NAWK+S N  L   ++  ++  +  ++EIQ+LNW RK +Q   G KL+  E +WV LV KNY
Sbjct:   11 VFVDALPYFDQGYDATGVREAAAALVEEETRRYRPTKNYLSYLPTPDFSAFETEIMRNEFERLAARQPMELLSMKRYELPAPSSGQKNDMTAWQDCVNNSMAQLEHQAVRIENLELMAQYGTNAWKMS-NDNLALMIENSQKELQNVRKEIQDLNWQRKNDQLAGGAKLRELESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. UniProt/SwissProt
Match: sp|Q9D287|SPF27_MOUSE (Pre-mRNA-splicing factor SPF27 OS=Mus musculus OX=10090 GN=Bcas2 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 8.095e-51
Identity = 88/184 (47.83%), Postives = 127/184 (69.02%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GY+  GV+E+A +LVE+E RRYRPTKNYL YL+ P     ETDIM+ EFER++ R P+E +SM+RY++PAP + + NDI AW + + N+ +Q+ +  ++ +N++L  Q+G NAWK+ +   +       +E QKL++  IQ+LNW RK  Q  AG KL+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKH-IQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. UniProt/SwissProt
Match: sp|O75934|SPF27_HUMAN (Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=9606 GN=BCAS2 PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 8.095e-51
Identity = 88/184 (47.83%), Postives = 127/184 (69.02%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GY+  GV+E+A +LVE+E RRYRPTKNYL YL+ P     ETDIM+ EFER++ R P+E +SM+RY++PAP + + NDI AW + + N+ +Q+ +  ++ +N++L  Q+G NAWK+ +   +       +E QKL++  IQ+LNW RK  Q  AG KL+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKH-IQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. UniProt/SwissProt
Match: sp|Q5RAX7|SPF27_PONAB (Pre-mRNA-splicing factor SPF27 OS=Pongo abelii OX=9601 GN=BCAS2 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.129e-50
Identity = 90/185 (48.65%), Postives = 128/185 (69.19%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPA-TKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GY+  GV+E+A +LVE+E RRYRPTKNYL YL+ P     ETDIM+ EFER++ R P+E +SM+RY++PAPP+  K NDI AW + + N+ +Q+ +  ++ +N++L  Q+G NAWK+ +   +       +E QKL++  IQ+LNW RK  Q  AG KL+  E +WV LV KNY
Sbjct:   11 VVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPPSGQKKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKH-IQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNY 194          
BLAST of Pre-mRNA-splicing factor SPF27 vs. TrEMBL
Match: A0A3P6P5L5 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS362 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 2.495e-63
Identity = 104/187 (55.61%), Postives = 138/187 (73.80%), Query Frame = 3
Query:   90 IDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP------ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            +DALPY DKGYDE+G++E+A  LVE+E+RRYRPTKNYLE+L  PSL        ET++M+TEF+R+SNR+PME +SM+RYDVP PPA K+ D++AW +A+ENA  Q+ +   +  N+DL  +YG NAWK + N+ LE  L   E+     ++++QE+NW RKKEQT AGE L   EE WVGLVGKNY
Sbjct:    8 VDALPYFDKGYDESGIQEAAALLVEEEMRRYRPTKNYLEHL--PSLSGPVQLKFETEVMRTEFDRMSNRLPMELLSMKRYDVPPPPAGKMGDLRAWQEAIENAHVQLAHQITRINNLDLMSEYGCNAWK-NFNEVLERMLHHHEKDLIEMRRKVQEINWQRKKEQTMAGEVLTQLEEEWVGLVGKNY 191          
BLAST of Pre-mRNA-splicing factor SPF27 vs. TrEMBL
Match: A0A504YQH5 (Pre-mRNA-splicing factor SPF27 OS=Fasciola gigantica OX=46835 GN=FGIG_01315 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 4.557e-63
Identity = 103/193 (53.37%), Postives = 142/193 (73.58%), Query Frame = 3
Query:   72 LDHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP------ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            +++   +DALPY DKGYD+ G++E+A  LVE+E++RYRPTKNYLE+L  PSL        ET+IMK EF+R+SNR+PME +SM+RY++P PPA K+ D+KAW  A+ENA++Q+ +   + +N++L  QYG NAWK   N  LE  L+  E+R    ++ IQE+NW RK+EQT AG+KL   EE+WVGLVGKNY
Sbjct:    1 MEYTAVVDALPYFDKGYDDPGIREAAALLVEEEMKRYRPTKNYLEHL--PSLTGPFVPKFETEIMKAEFDRLSNRLPMELLSMKRYELPPPPAGKMTDVKAWQDAMENAEAQLEHQATRIKNLELMAQYGCNAWK-QYNSVLEKDLQLHEKRLLEIRRRIQEINWRRKQEQTTAGKKLAELEETWVGLVGKNY 190          
BLAST of Pre-mRNA-splicing factor SPF27 vs. TrEMBL
Match: A0A4E0R6Z5 (Pre-mRNA-splicing factor SPF27 OS=Fasciola hepatica OX=6192 GN=D915_007404 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 7.982e-63
Identity = 103/193 (53.37%), Postives = 142/193 (73.58%), Query Frame = 3
Query:   72 LDHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP------ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            +++   +DALPY DKGYD+ G++E+A  LVE+E++RYRPTKNYLE+L  PSL        ET+IMK EF+R+SNR+PME +SM+RY++P PPA K+ D+KAW  A+ENA++Q+ +   + +N++L  QYG NAWK   N  LE  L+  E+R    ++ IQE+NW RK+EQT AG+KL   EE+WVGLVGKNY
Sbjct:   17 MEYTAVVDALPYFDKGYDDPGIREAAALLVEEEMKRYRPTKNYLEHL--PSLTGPFVPKFETEIMKAEFDRLSNRLPMELLSMKRYELPPPPAGKMTDVKAWQDAMENAEAQLEHQATRIKNLELMAQYGCNAWK-QYNSVLEKDLQLHEKRLLEIRRRIQEINWRRKQEQTTAGKKLAELEETWVGLVGKNY 206          
BLAST of Pre-mRNA-splicing factor SPF27 vs. TrEMBL
Match: A0A183TLX6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS17474 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.085e-62
Identity = 103/187 (55.08%), Postives = 137/187 (73.26%), Query Frame = 3
Query:   90 IDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP------ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            +DALPY DKGYDE+G++E+A  LVE+E+RRYRPTKNYLE+L  PSL        ET+IM+TEF+R+SNR+PME +SM+RYDVP PPA K+ D++AW +A+ENA  Q+ +   +  N++L  +YG NAWK + N+ LE  L   E+     ++++QE+NW RKKEQT AGE L   EE WV LVGKNY
Sbjct:    8 VDALPYFDKGYDESGIQEAAALLVEEEMRRYRPTKNYLEHL--PSLSGPVQLKFETEIMRTEFDRMSNRLPMELLSMKRYDVPPPPAGKMGDLRAWQEAIENAHVQLAHQTTRINNLELMSEYGCNAWK-NFNEVLERMLHHHEKELIEMRRKVQEINWQRKKEQTMAGELLTQLEEEWVALVGKNY 191          
BLAST of Pre-mRNA-splicing factor SPF27 vs. TrEMBL
Match: K1RKI7 (Pre-mRNA-splicing factor SPF27 OS=Crassostrea gigas OX=29159 GN=CGI_10024625 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 2.526e-62
Identity = 101/184 (54.89%), Postives = 135/184 (73.37%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYDE GV+E+ALSLVE+E RRYRPTKNYLEYL  PS +  ET+IMK EFER+  R+PME +SM+RY++P P A K+ DI AWT+ ++N+Q+Q+ +  ++  N++L    G+NAWK  +   ++      +  Q L++Q IQE+NW RK EQTEAG KLK  E+SWVGLV KNY
Sbjct:    5 VVVDALPYFDRGYDEPGVREAALSLVEEETRRYRPTKNYLEYLPAPSYNAFETEIMKNEFERMQARLPMEMLSMKRYELPQPSAGKMTDISAWTECVDNSQAQLEHQALRILNLELMADNGSNAWKQYNTILVQMMENAQKHLQDLRKQ-IQEINWRRKSEQTEAGNKLKELEDSWVGLVSKNY 187          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Cavefish
Match: bcas2 (BCAS2 pre-mRNA processing factor [Source:NCBI gene;Acc:493614])

HSP 1 Score: 171.4 bits (433), Expect = 1.903e-52
Identity = 88/184 (47.83%), Postives = 126/184 (68.48%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL  P     ET+IM+ EFER+  R PME +SM+RY++PAP + + NDI AW   + N+ +Q+ +  ++ +N+DL  +YG NAWK S N  L + ++  ++  +  +++IQ+LNW RK +Q   G KL+  E +WV LV KNY
Sbjct:   47 VFVDALPYFDQGYDAPGVREAAAALVEEETRRYRPTKNYLSYLPTPDFSAFETEIMRNEFERLGARQPMELLSMKRYELPAPSSGQKNDITAWQDCVNNSMAQLEHQAVRIENLDLMAEYGTNAWKFS-NDNLAFMIENAQKELQKVRKQIQDLNWQRKNDQLTGGAKLRELESNWVSLVSKNY 229          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Nematostella
Match: EDO39517 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA14])

HSP 1 Score: 166.007 bits (419), Expect = 8.771e-52
Identity = 86/189 (45.50%), Postives = 133/189 (70.37%), Query Frame = 3
Query:   78 HGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQ---QQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            H V+ DALPY D+GY+E GV+E    LVE+E RRYRPTKNYL++L  P+     T ++K EF+RIS + PM+ +SM+RY++P P +++ +DI AWT+A++N+ +Q+ +   +  N+++  +YG + W+ + N  L   L   E++QKL    ++++QE+NW RK EQ++AG +LK  E+SWVGLV KNY
Sbjct:    5 HEVAPDALPYYDQGYEEPGVREMVNQLVEEETRRYRPTKNYLDFLPTPNYDVFVTPVLKNEFDRISRKQPMDLLSMKRYELPQPASSQKHDITAWTEAVDNSMAQLEHQAERIINLEILSKYGPSGWR-THNDLLTRML---EQQQKLLMNIRKQVQEINWKRKSEQSQAGVQLKQLEQSWVGLVTKNY 189          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Nematostella
Match: EDO39609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N3])

HSP 1 Score: 166.007 bits (419), Expect = 1.728e-51
Identity = 86/189 (45.50%), Postives = 133/189 (70.37%), Query Frame = 3
Query:   78 HGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQ---QQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            H V+ DALPY D+GY+E GV+E    LVE+E RRYRPTKNYL++L  P+     T ++K EF+RIS + PM+ +SM+RY++P P +++ +DI AWT+A++N+ +Q+ +   +  N+++  +YG + W+ + N  L   L   E++QKL    ++++QE+NW RK EQ++AG +LK  E+SWVGLV KNY
Sbjct:    5 HEVAPDALPYYDQGYEEPGVREMVNQLVEEETRRYRPTKNYLDFLPTPNYDVFVTPVLKNEFDRISRKQPMDLLSMKRYELPQPASSQKHDITAWTEAVDNSMAQLEHQAERIINLEILSKYGPSGWR-THNDLLTRML---EQQQKLLMNIRKQVQEINWKRKSEQSQAGVQLKQLEQSWVGLVTKNY 189          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Medaka
Match: bcas2 (BCAS2 pre-mRNA processing factor [Source:NCBI gene;Acc:101170757])

HSP 1 Score: 172.94 bits (437), Expect = 1.378e-53
Identity = 88/184 (47.83%), Postives = 129/184 (70.11%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL +P   P ET+IM+ EFER++ R PM+ +SM+RY++PAP + + NDI AW + + N+ +Q+ +  I+ +N++L   YG NAWK+  N  L + ++  ++     +++IQ+LNW RK +Q  AG KL+  E +WV LV KNY
Sbjct:   11 VFVDALPYFDQGYDAPGVREAAAALVEEETRRYRPTKNYLSYLPMPEFSPFETEIMRNEFERLAARQPMDLLSMKRYELPAPTSGQKNDITAWQECVNNSMAQLEHQAIRIENLELMSHYGTNAWKVY-NDNLAFLIELAQKELHKFRKKIQDLNWQRKNDQLAAGAKLRELESNWVSLVSKNY 193          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Medaka
Match: bcas2 (BCAS2 pre-mRNA processing factor [Source:NCBI gene;Acc:101170757])

HSP 1 Score: 150.599 bits (379), Expect = 5.519e-45
Identity = 84/184 (45.65%), Postives = 121/184 (65.76%), Query Frame = 3
Query:   84 VSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHP-ETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNY 632
            V +DALPY D+GYD  GV+E+A +LVE+E RRYRPTKNYL YL +P   P ET+IM+ EFER++ R PM+ +SM+RY++PAP + + NDI AW + + N+ +Q+ +  I+ +N++L   YG NAWK+  N  L + +   E  Q+L    I EL W+  +    +G    + +E WV LV KNY
Sbjct:   11 VFVDALPYFDQGYDAPGVREAAAALVEEETRRYRPTKNYLSYLPMPEFSPFETEIMRNEFERLAARQPMDLLSMKRYELPAPTSGQKNDITAWQECVNNSMAQLEHQAIRIENLELMSHYGTNAWKVY-NDNLAFLI---ELIQRLPWLHISELIWSPSRFFLSSG---VLVDEGWVSLVSKNY 187          
BLAST of Pre-mRNA-splicing factor SPF27 vs. Planmine SMEST
Match: SMESG000023301.1 (SMESG000023301.1)

HSP 1 Score: 402.905 bits (1034), Expect = 1.694e-144
Identity = 213/215 (99.07%), Postives = 214/215 (99.53%), Query Frame = 3
Query:   63 MAFLDHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHPETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNYXXXXXXXXXXXXXXXXNKNKNESLN 707
            MAFLDHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHPETDIMKTEFERISNRIPMERISMRRYDVPAPPATK+NDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWK SDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNYEIEQAILELEQEVEILNKNKNESLN
Sbjct:    1 MAFLDHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYLSLPSLHPETDIMKTEFERISNRIPMERISMRRYDVPAPPATKINDIKAWTQALENAQSQIMNIEIKTQNIDLQLQYGANAWKNSDNKTLEYYLKCGEERQKLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNYEIEQAILELEQEVEILNKNKNESLN 215          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BCAS21.686e-5147.83BCAS2 pre-mRNA processing factor [Source:HGNC Symb... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bcas-25.223e-3437.43BCAS splicing factor homolog [Source:UniProtKB/Tr... [more]
bcas-25.223e-3437.43BCAS splicing factor homolog [Source:UniProtKB/Tr... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
BCAS22.703e-5848.37gene:FBgn0039558 transcript:FBtr0085269[more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bcas22.431e-5247.83BCAS2 pre-mRNA processing factor [Source:NCBI gene... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmod13.147e-4342.93tropomodulin 1 [Source:Xenbase;Acc:XB-GENE-954354][more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Bcas21.157e-5147.83breast carcinoma amplified sequence 2 [Source:MGI ... [more]
Bcas21.692e-1065.22breast carcinoma amplified sequence 2 [Source:MGI ... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PBE2|SPF27_XENTR1.050e-5147.28Pre-mRNA-splicing factor SPF27 OS=Xenopus tropical... [more]
sp|Q5RKQ0|SPF27_DANRE1.835e-5147.83Pre-mRNA-splicing factor SPF27 OS=Danio rerio OX=7... [more]
sp|Q9D287|SPF27_MOUSE8.095e-5147.83Pre-mRNA-splicing factor SPF27 OS=Mus musculus OX=... [more]
sp|O75934|SPF27_HUMAN8.095e-5147.83Pre-mRNA-splicing factor SPF27 OS=Homo sapiens OX=... [more]
sp|Q5RAX7|SPF27_PONAB1.129e-5048.65Pre-mRNA-splicing factor SPF27 OS=Pongo abelii OX=... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P6P5L52.495e-6355.61Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A504YQH54.557e-6353.37Pre-mRNA-splicing factor SPF27 OS=Fasciola giganti... [more]
A0A4E0R6Z57.982e-6353.37Pre-mRNA-splicing factor SPF27 OS=Fasciola hepatic... [more]
A0A183TLX62.085e-6255.08Uncharacterized protein OS=Schistocephalus solidus... [more]
K1RKI72.526e-6254.89Pre-mRNA-splicing factor SPF27 OS=Crassostrea giga... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bcas21.903e-5247.83BCAS2 pre-mRNA processing factor [Source:NCBI gene... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO395178.771e-5245.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396091.728e-5145.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bcas21.378e-5347.83BCAS2 pre-mRNA processing factor [Source:NCBI gene... [more]
bcas25.519e-4545.65BCAS2 pre-mRNA processing factor [Source:NCBI gene... [more]
back to top
BLAST of Pre-mRNA-splicing factor SPF27 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023301.11.694e-14499.07SMESG000023301.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035041 ID=SMED30035041|Name=Pre-mRNA-splicing factor SPF27|organism=Schmidtea mediterranea sexual|type=transcript|length=721bp
GATTGTTTAAATAATACTAATTTATTAAATTTTTTTTGAAATTTGTATAA
ATTATTTTTTTAATGGCTTTTCTAGACCATGGAGTTTCTATAGATGCTCT
TCCATATACTGACAAGGGTTACGATGAAGCCGGAGTTAAGGAATCGGCAT
TAAGTCTGGTTGAAGATGAAGTTAGGCGTTATAGACCAACTAAAAATTAT
TTAGAATATTTATCCTTACCTTCACTTCATCCAGAAACGGACATAATGAA
AACAGAATTTGAAAGAATTTCAAACCGAATCCCAATGGAAAGAATAAGCA
TGCGTCGTTATGATGTTCCTGCTCCTCCTGCTACTAAAGTCAATGATATT
AAAGCTTGGACGCAAGCCTTAGAAAATGCACAATCTCAAATCATGAATAT
AGAAATTAAAACCCAAAATATAGATTTGCAGCTTCAATATGGCGCTAATG
CCTGGAAAATTTCTGACAATAAAACATTGGAGTATTATCTAAAATGTGGT
GAAGAACGTCAAAAATTACAACAGCAAGAAATTCAAGAATTGAATTGGAA
TCGTAAAAAAGAACAAACCGAAGCTGGAGAAAAATTGAAAATTCATGAAG
AAAGTTGGGTTGGTTTAGTGGGTAAAAACTATGAAATCGAACAAGCAATT
TTGGAACTTGAACAAGAAGTTGAAATTCTTAATAAAAATAAAAATGAAAG
TTTAAATTGAATAAATGTTTA
back to top

protein sequence of SMED30035041-orf-1

>SMED30035041-orf-1 ID=SMED30035041-orf-1|Name=SMED30035041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MAFLDHGVSIDALPYTDKGYDEAGVKESALSLVEDEVRRYRPTKNYLEYL
SLPSLHPETDIMKTEFERISNRIPMERISMRRYDVPAPPATKVNDIKAWT
QALENAQSQIMNIEIKTQNIDLQLQYGANAWKISDNKTLEYYLKCGEERQ
KLQQQEIQELNWNRKKEQTEAGEKLKIHEESWVGLVGKNYEIEQAILELE
QEVEILNKNKNESLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008409SPF27
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 189..215
NoneNo IPR availableCOILSCoilCoilcoord: 96..116
NoneNo IPR availablePANTHERPTHR13296:SF0PRE-MRNA-SPLICING FACTOR SPF27coord: 7..212
IPR008409Pre-mRNA-splicing factor SPF27PFAMPF05700BCAS2coord: 9..212
e-value: 7.1E-57
score: 192.4
IPR008409Pre-mRNA-splicing factor SPF27PANTHERPTHR13296BCAS2 PROTEINcoord: 7..212