Protein FAM92A1

Overview
NameProtein FAM92A1
Smed IDSMED30035040
Length (bp)1328
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein FAM92A1 (SMED30035040) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein FAM92A1 (SMED30035040) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein FAM92A1 (SMED30035040) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein FAM92A1 (SMED30035040) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035040

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30035040h1SMcG0009034 SmedASXL_007082SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30035040h1SMcG0009034 dd_Smed_v6_5894_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30035040h1SMcG0009034 dd_Smed_v4_5894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein FAM92A1 vs. Ensembl Human
Match: FAM92A (family with sequence similarity 92 member A [Source:HGNC Symbol;Acc:HGNC:30452])

HSP 1 Score: 102.064 bits (253), Expect = 5.855e-24
Identity = 61/214 (28.50%), Postives = 115/214 (53.74%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            K L+  V+N+EK    L + F  Y R+TA+LR+  D + N +  Y  T+         L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +     ++A    Q A ++A++ S  L +T+ +FE+ K+  +  +   F+ IEML+H +ALE  T AY+++  +D   D   F +S+
Sbjct:   14 KQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATE--TPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSL 225          
BLAST of Protein FAM92A1 vs. Ensembl Human
Match: FAM92A (family with sequence similarity 92 member A [Source:HGNC Symbol;Acc:HGNC:30452])

HSP 1 Score: 102.064 bits (253), Expect = 7.908e-24
Identity = 61/214 (28.50%), Postives = 115/214 (53.74%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            K L+  V+N+EK    L + F  Y R+TA+LR+  D + N +  Y  T+         L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +     ++A    Q A ++A++ S  L +T+ +FE+ K+  +  +   F+ IEML+H +ALE  T AY+++  +D   D   F +S+
Sbjct:   14 KQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATE--TPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSL 225          
BLAST of Protein FAM92A1 vs. Ensembl Human
Match: FAM92A (family with sequence similarity 92 member A [Source:HGNC Symbol;Acc:HGNC:30452])

HSP 1 Score: 99.7525 bits (247), Expect = 3.168e-23
Identity = 59/206 (28.64%), Postives = 111/206 (53.88%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLND 783
            K L+  V+N+EK    L + F  Y R+TA+LR+  D + N +  Y  T+         L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +     ++A    Q A ++A++ S  L +T+ +FE+ K+  +  +   F+ IEML+H +ALE  T AY+++  +D   D
Sbjct:   14 KQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATE--TPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPSDRHVISQAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDED 217          
BLAST of Protein FAM92A1 vs. Ensembl Human
Match: FAM92A (family with sequence similarity 92 member A [Source:HGNC Symbol;Acc:HGNC:30452])

HSP 1 Score: 97.4413 bits (241), Expect = 3.246e-22
Identity = 61/214 (28.50%), Postives = 114/214 (53.27%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            K L+  V+N+EK    L + F  Y R+TA+LR+  D + N +  Y  T+         L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +  +    A    Q A ++A++ S  L +T+ +FE+ K+  +  +   F+ IEML+H +ALE  T AY+++  +D   D   F +S+
Sbjct:   14 KQLQTAVSNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINAYAATE--TPHLKLGLMNFADEFAKLQDYRQAEVERLEAKVVEPLKTYGTIVKMKRDDLKATLTARNREAKQLTQLERTRQRNPS-DRHVLLAETELQRAAMDASRTSRHLEETINNFERQKMKDIKTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSL 224          
BLAST of Protein FAM92A1 vs. Ensembl Human
Match: FAM92B (family with sequence similarity 92 member B [Source:HGNC Symbol;Acc:HGNC:24781])

HSP 1 Score: 95.1301 bits (235), Expect = 3.378e-21
Identity = 60/206 (29.13%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLND 783
            + +E  V N EK           Y R+TA+LR+  D++   L ++  ++  N     ++  F+  L+ V+D+R  +++R++  V+ PL     Q+K  + EIKK    +  EI    KLEK +Q   +  Q  ++A    Q A +++++ + QL +TV  F++ KL  L      FV IEM++H +A+E  + A+++L   D   D
Sbjct:   12 RVMENTVANTEKYFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANSE--NPELRATMRGFAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNHEIKQLEKLEKLRQKSPSDQQMISQAETRVQRAAVDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFHAKAVEVYSSAFQTLEKYDLERD 215          
BLAST of Protein FAM92A1 vs. Ensembl Fly
Match: CG6405 (gene:FBgn0032428 transcript:FBtr0080366)

HSP 1 Score: 79.7221 bits (195), Expect = 7.041e-16
Identity = 60/246 (24.39%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQL--ATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNLAGRRSQSMTNLK 897
            K + +R+   E+ +  +   F    R+ AK R++ DE++  +++Y   +E N++    L  F+N ++++ D+ +  + R++  ++  L +     K+ +  ++    AR KE+     L + Q L      S   +  +S+L  A +E  + ++++   + +FE+ KL  L  ++  F+ I M  H +ALE L+ +Y  +    T+++++ FI+       KE L     +L   G RSQSM +L+
Sbjct:   18 KIINERINITERHLMEMCSSFALVTRKMAKYRDSFDELAKSVKSYADDEEINESLCQGLKSFTNAVTIMGDYMDINVHRLEHKIVNELAQFEQLCKSTRDNLRLAVIARDKEV-----LRQRQMLELKSKFSANNSAADSELFKAKMEVQRTNKEIDDIIGNFEQRKLRDLKQIISDFILIAMKQHTKALEILSASYYDIG---TIDERDDFIEFQKLMKTKEELASRKTALK-KGLRSQSMDSLE 254          
BLAST of Protein FAM92A1 vs. Ensembl Zebrafish
Match: fam92a1 (family with sequence similarity 92 member A1 [Source:NCBI gene;Acc:445210])

HSP 1 Score: 114.39 bits (285), Expect = 2.419e-28
Identity = 78/255 (30.59%), Postives = 137/255 (53.73%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN----QSTNSLNLAGRRSQSMTNLKTTNSSSQ 918
            K +++ +T++EK    L + F  Y R+TA+LR+  D +   +  Y  T+  N      L  F++ L+ V+D+R  E++R++V VI+PL    N +K  ++++K+  +AR +E     +LE+ +Q   +  Q  ++A    Q AT++AT+ + QL +T+  FEK K+  +  VL  FV +EM +H +ALE  T AY+ +  +D   D   F +S++   ++  L      S  SLN  G        +++  SS Q
Sbjct:   16 KQIQENITSVEKHFGDLCQLFAAYVRKTARLRDKADLLVKEINVYADTETPNLKCG--LKNFADQLAKVQDYRQAEVERLEVKVIEPLKAYGNIVKTKREDLKQTQSARNREAKQMQQLERMRQRNPSDRQIISQAESELQRATMDATRTTRQLEETIDDFEKQKIRDIKKVLGEFVTVEMAFHAKALEIYTTAYQHIQNVDEEGDLEVFRNSLHPPDYQSRLEIVRANSKLSLNRTGTSMSKSGTMQSRTSSRQ 268          
BLAST of Protein FAM92A1 vs. Ensembl Zebrafish
Match: fam92a1 (family with sequence similarity 92 member A1 [Source:NCBI gene;Acc:445210])

HSP 1 Score: 111.309 bits (277), Expect = 3.450e-27
Identity = 79/256 (30.86%), Postives = 136/256 (53.12%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQS-EAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN----QSTNSLNLAGRRSQSMTNLKTTNSSSQ 918
            K +++ +T++EK    L + F  Y R+TA+LR+  D +   +  Y  T+  N      L  F++ L+ V+D+R  E++R++V VI+PL    N +K  ++++K+  +AR +E     +LE+ +Q   +  Q    KA    Q AT++AT+ + QL +T+  FEK K+  +  VL  FV +EM +H +ALE  T AY+ +  +D   D   F +S++   ++  L      S  SLN  G        +++  SS Q
Sbjct:   16 KQIQENITSVEKHFGDLCQLFAAYVRKTARLRDKADLLVKEINVYADTETPNLKCG--LKNFADQLAKVQDYRQAEVERLEVKVIEPLKAYGNIVKTKREDLKQTQSARNREAKQMQQLERMRQRNPSDRQIISRKAESELQRATMDATRTTRQLEETIDDFEKQKIRDIKKVLGEFVTVEMAFHAKALEIYTTAYQHIQNVDEEGDLEVFRNSLHPPDYQSRLEIVRANSKLSLNRTGTSMSKSGTMQSRTSSRQ 269          
BLAST of Protein FAM92A1 vs. Ensembl Xenopus
Match: FAM92B (family with sequence similarity 92 member B [Source:NCBI gene;Acc:100486626])

HSP 1 Score: 93.2041 bits (230), Expect = 7.103e-21
Identity = 61/210 (29.05%), Postives = 111/210 (52.86%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            K +E  V N EK           Y R+TAKLR+  DE+   L ++  T+  N     +L   ++ L+ ++D+R+ +++R++  V+ PL    + +K+ + EIKK  + R +EI    KLEK +    +     A+A  N Q A+++A + + QL + + +F+  K+  +  +   F+ +EM++H R+LE  T A+++L   D   D   F
Sbjct:   12 KIMETTVGNAEKYFGQFCSVLASYTRKTAKLRDKADELVKNLIDFANTE--NPELRTALKNMADELAKIQDYRHAQVERLETKVVNPLKLYGSLIKDKRTEIKKFNSVRNREIKELEKLEKLRHRAPSDRHVIAEA--NVQKASVDAARTTHQLEEVIDNFQLQKVKDIQKIFSDFLTVEMIFHARSLEVFTNAFQNLQECDLEKDMEDF 217          
BLAST of Protein FAM92A1 vs. Ensembl Xenopus
Match: flrt1 (fibronectin leucine rich transmembrane protein 1 [Source:Xenbase;Acc:XB-GENE-495403])

HSP 1 Score: 63.929 bits (154), Expect = 9.004e-12
Identity = 36/122 (29.51%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  172 LEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQ 537
            +++ V N+EK    L + F GY R+TA+LR+  D +   +  Y  T+    T    L  F++ L+ ++D+R  E++R++  V++PL      +K  ++++K    AR +E     +LEK++Q
Sbjct:   17 IQESVNNVEKHFGELCQIFAGYVRKTARLRDKADLLVREVNTYADTE--TPTLKHGLKNFADELAKLQDYRQAEVERLESRVVEPLKSYGGIIKLKREDLKVTLTARNREAKQMAQLEKTRQ 136          
BLAST of Protein FAM92A1 vs. Ensembl Xenopus
Match: flrt1 (fibronectin leucine rich transmembrane protein 1 [Source:Xenbase;Acc:XB-GENE-495403])

HSP 1 Score: 63.929 bits (154), Expect = 1.216e-11
Identity = 36/122 (29.51%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  172 LEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQ 537
            +++ V N+EK    L + F GY R+TA+LR+  D +   +  Y  T+    T    L  F++ L+ ++D+R  E++R++  V++PL      +K  ++++K    AR +E     +LEK++Q
Sbjct:   17 IQESVNNVEKHFGELCQIFAGYVRKTARLRDKADLLVREVNTYADTE--TPTLKHGLKNFADELAKLQDYRQAEVERLESRVVEPLKSYGGIIKLKREDLKVTLTARNREAKQMAQLEKTRQ 136          
BLAST of Protein FAM92A1 vs. Ensembl Mouse
Match: Fam92a (family with sequence similarity 92, member A [Source:MGI Symbol;Acc:MGI:1915349])

HSP 1 Score: 120.168 bits (300), Expect = 6.043e-30
Identity = 80/265 (30.19%), Postives = 140/265 (52.83%), Query Frame = 1
Query:  142 IKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNL--AGRRSQSMTNLKTTNSSSQGDLS 930
            + E +   K L+  VTN+EK    L + F  Y R+TA+LR+  D + N +  Y  T+  N      L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +     +KA    Q AT++AT+ S  L +T+ +FEK K+  + N+L  F+ IEML+H +ALE  T AY+++  +D   D   F +S+       YL+   + L++  A  +S    +L T  +S  G +S
Sbjct:   75 LDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPN--LKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHVISKAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSL-------YLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQIS 330          
BLAST of Protein FAM92A1 vs. Ensembl Mouse
Match: Fam92a (family with sequence similarity 92, member A [Source:MGI Symbol;Acc:MGI:1915349])

HSP 1 Score: 118.627 bits (296), Expect = 2.037e-29
Identity = 79/265 (29.81%), Postives = 140/265 (52.83%), Query Frame = 1
Query:  142 IKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNL--AGRRSQSMTNLKTTNSSSQGDLS 930
            + E +   K L+  VTN+EK    L + F  Y R+TA+LR+  D + N +  Y  T+  N      L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +     ++A    Q AT++AT+ S  L +T+ +FEK K+  + N+L  F+ IEML+H +ALE  T AY+++  +D   D   F +S+       YL+   + L++  A  +S    +L T  +S  G +S
Sbjct:   75 LDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPN--LKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHVISQAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSL-------YLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQIS 330          
BLAST of Protein FAM92A1 vs. Ensembl Mouse
Match: Fam92a (family with sequence similarity 92, member A [Source:MGI Symbol;Acc:MGI:1915349])

HSP 1 Score: 117.857 bits (294), Expect = 4.134e-29
Identity = 80/265 (30.19%), Postives = 139/265 (52.45%), Query Frame = 1
Query:  142 IKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNL--AGRRSQSMTNLKTTNSSSQGDLS 930
            + E +   K L+  VTN+EK    L + F  Y R+TA+LR+  D + N +  Y  T+  N      L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q       S+  A    Q AT++AT+ S  L +T+ +FEK K+  + N+L  F+ IEML+H +ALE  T AY+++  +D   D   F +S+       YL+   + L++  A  +S    +L T  +S  G +S
Sbjct:   75 LDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPN--LKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQ----RNPSDRHAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSL-------YLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQIS 326          
BLAST of Protein FAM92A1 vs. Ensembl Mouse
Match: Fam92b (family with sequence similarity 92, member B [Source:MGI Symbol;Acc:MGI:3588213])

HSP 1 Score: 99.7525 bits (247), Expect = 4.238e-23
Identity = 62/210 (29.52%), Postives = 111/210 (52.86%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            + +E  VTN E+           Y R+TA+LR+  D++   L ++  T+  N     ++  F+  L+ V+D+R  E++R++  VI PL     Q+K  + +IKK    +  EI    KLEK +Q   +  Q  ++A  ++Q A+++  + +  L +TV +F++ KL  L  +   FV IEM++H +A+E  + A+++L   D   D   F
Sbjct:   12 RAMENTVTNAERYFGQFCSLLASYTRKTARLRDKADQLVKQLIDFANTE--NPELRATIRDFAEDLAKVQDYRQAEVERLEAKVISPLKLYGAQIKQTRADIKKCKRVQNNEIKQLEKLEKLRQKSPSDRQMISQAETSAQRASVDTNRSTLHLVETVDAFQEQKLKDLRRIFSDFVTIEMVFHAKAVEVYSSAFQTLENYDLERDLQDF 219          
BLAST of Protein FAM92A1 vs. Ensembl Mouse
Match: Fam92a (family with sequence similarity 92, member A [Source:MGI Symbol;Acc:MGI:1915349])

HSP 1 Score: 94.3597 bits (233), Expect = 6.704e-22
Identity = 62/205 (30.24%), Postives = 109/205 (53.17%), Query Frame = 1
Query:  214 LTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTEL-------DRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            L + F  Y R+TA+LR+  D + N +  Y  T+  N      L  F++  + ++D+R  E+       +R++  V++PL      +K  + ++K    AR +E     +LE+++Q       S+  A    Q AT++AT+ S  L +T+ +FEK K+  + N+L  F+ IEML+H +ALE  T AY+++  +D   D   F +S+
Sbjct:    5 LCQIFAAYVRKTARLRDKADLLVNEINLYASTETPN--LKQGLKDFADEFAKLQDYRQAEMLMNMAKVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNP----SDRHAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSL 203          
BLAST of Protein FAM92A1 vs. UniProt/SwissProt
Match: sp|Q2VR06|F92AA_XENLA (Protein FAM92A-A OS=Xenopus laevis OX=8355 GN=fam92a-a PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.476e-29
Identity = 69/224 (30.80%), Postives = 128/224 (57.14%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN 837
            + +++ V N+EK    L + F GY R+TA+LR+  D +   +  Y  T+    T    L  F++ L+ ++D+R  E++R++  V++PL    + +K  ++++K    AR +E     +LEK++Q   +  Q  ++A    Q AT++A++ S+QL +T+ +FEK K+  +  +   FV IEM++H +ALE LT AY+ +  +D   D   F +S++   F+  L+
Sbjct:   15 RQIQESVNNVEKHFGELCQIFAGYVRKTARLRDKADLLVREVNTYADTE--TPTVKLGLKNFADELAKLQDYRQAEVERLESRVVEPLKSYGSIIKLKREDLKVTLTARNREAKQMAQLEKTRQRNPSDRQIISQAETELQRATMDASRISQQLEETIDNFEKQKMKDIKKLFTEFVSIEMVFHGKALEVLTAAYQHIQDIDEEEDLEVFRNSLHPPDFQSRLD 236          
BLAST of Protein FAM92A1 vs. UniProt/SwissProt
Match: sp|Q6GN09|F92AB_XENLA (Protein FAM92A-B OS=Xenopus laevis OX=8355 GN=fam92a-b PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.318e-28
Identity = 68/224 (30.36%), Postives = 126/224 (56.25%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN 837
            + +++ V N+EK    L + F GY R+TA+LR+  D +   +  Y  T+    T    L  F++  + ++D+R  E++R++  V++PL      +K  ++++K   +AR +E     +LEK++Q   +  Q  ++A    Q AT++A + S+QL +T+ +FEK K+  +  +   FV IEM++H +ALE LT AY+ +  +D   D   F +S++   F+  L+
Sbjct:   15 RQIQESVNNVEKHFGELCQIFAGYVRKTARLRDKADLLVREVNTYADTE--TPTLKHGLKNFADEFAKLQDYRQAEVERLESRVVEPLKSYGGIIKLKREDLKVTLSARNREAKQMAQLEKTRQRNPSDRQIISQAETELQRATMDAARISQQLEETIDNFEKQKIKDIKKLFAEFVTIEMVFHGKALEVLTAAYQHIQDIDEEEDLEVFRNSLHPPDFQSRLD 236          
BLAST of Protein FAM92A1 vs. UniProt/SwissProt
Match: sp|Q8BP22|FA92A_MOUSE (Protein FAM92A OS=Mus musculus OX=10090 GN=Fam92a PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.425e-28
Identity = 79/265 (29.81%), Postives = 140/265 (52.83%), Query Frame = 1
Query:  142 IKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNL--AGRRSQSMTNLKTTNSSSQGDLS 930
            + E +   K L+  VTN+EK    L + F  Y R+TA+LR+  D + N +  Y  T+  N      L  F++  + ++D+R  E++R++  V++PL      +K  + ++K    AR +E     +LE+++Q   +     ++A    Q AT++AT+ S  L +T+ +FEK K+  + N+L  F+ IEML+H +ALE  T AY+++  +D   D   F +S+       YL+   + L++  A  +S    +L T  +S  G +S
Sbjct:   75 LDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPN--LKQGLKDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSDRHVISQAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQNIDEDEDLEVFRNSL-------YLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQIS 330          
BLAST of Protein FAM92A1 vs. UniProt/SwissProt
Match: sp|Q1RMK1|FA92B_BOVIN (Protein FAM92B OS=Bos taurus OX=9913 GN=FAM92B PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 4.941e-28
Identity = 70/210 (33.33%), Postives = 116/210 (55.24%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            + +E  VTN EKS          Y R+TA+LR+  D++   L ++  T+  N     +L  F+  L+ V+D+R  E++R++  VI PL     Q+K  + EIKK  + R  EI    KLEK +Q   +  Q+ ++A  + Q A+++A++ S QL +TV +F+K KL  +  +   FV IEM++H +A+E  + A+++L   D   D   F
Sbjct:   12 RVMEDTVTNAEKSFGQFCSLLAAYTRKTARLRDKADQLVKQLIDFANTE--NPEMRATLRNFAEDLAKVQDYRQAEVERLETKVINPLKLYGVQIKQTRAEIKKFKSVRNNEIKQLEKLEKLRQKSPSDRQTISQAETSVQRASVDASRTSHQLEETVDTFQKQKLKDIQKIFSDFVTIEMVFHAKAVEVYSSAFQTLESYDLEKDLEDF 219          
BLAST of Protein FAM92A1 vs. UniProt/SwissProt
Match: sp|Q1LU86|FA92A_DANRE (Protein FAM92A OS=Danio rerio OX=7955 GN=fam92a PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.826e-27
Identity = 78/255 (30.59%), Postives = 137/255 (53.73%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN----QSTNSLNLAGRRSQSMTNLKTTNSSSQ 918
            K +++ +T++EK    L + F  Y R+TA+LR+  D +   +  Y  T+  N      L  F++ L+ V+D+R  E++R++V VI+PL    N +K  ++++K+  +AR +E     +LE+ +Q   +  Q  ++A    Q AT++AT+ + QL +T+  FEK K+  +  VL  FV +EM +H +ALE  T AY+ +  +D   D   F +S++   ++  L      S  SLN  G        +++  SS Q
Sbjct:   16 KQIQENITSVEKHFGDLCQLFAAYVRKTARLRDKADLLVKEINVYADTETPNLKCG--LKNFADQLAKVQDYRQAEVERLEVKVIEPLKAYGNIVKTKREDLKQTQSARNREAKQMQQLERMRQRNPSDRQIISQAESELQRATMDATRTTRQLEETIDDFEKQKIRDIKKVLGEFVTVEMAFHAKALEIYTTAYQHIQNVDEEGDLEVFRNSLHPPDYQSRLEIVRANSKLSLNRTGTSMSKSGTMQSRTSSRQ 268          
BLAST of Protein FAM92A1 vs. TrEMBL
Match: A0A5K3F1V6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 5.968e-46
Identity = 95/225 (42.22%), Postives = 135/225 (60.00%), Query Frame = 1
Query:  121 TLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            +L    EIKE+E   K+  +RVT IE     L  EF+ Y RRTAKLRNNGDE+S IL NY++ ++ N TS  +L +F+ +LS +ED+R+ E+DR+   VI PL     ++K V+  I+ + AARKKE++   +L +    G       A+ R+N  +AT  AT+ ++ L + V  FE  KL  L ++L  FVHIEMLWH +ALE LTEA+  +  M    D   F
Sbjct:    9 SLHRTTEIKETEAQSKFFNERVTQIETYFGDLCAEFINYTRRTAKLRNNGDELSKILLNYSINEKINRTSARTLRRFAELLSTIEDYRHAEVDRLFAKVITPLSTYGEEVKRVRTNIRVETAARKKEVSQLKRLGREPLRG-------AEERLN--IATRCATRSADALERQVIQFEAKKLKGLKDILTDFVHIEMLWHAKALETLTEAFNVVQSMQEEVDLADF 224          
BLAST of Protein FAM92A1 vs. TrEMBL
Match: A0A5K3F1D3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 4.034e-45
Identity = 95/229 (41.48%), Postives = 138/229 (60.26%), Query Frame = 1
Query:  121 TLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            +L    EIKE+E   K+  +RVT IE     L  EF+ Y RRTAKLRNNGDE+S IL NY++ ++ N TS  +L +F+ +LS +ED+R+ E+DR+   VI PL     ++K V+  I+ + AARKKE++   +L +    G       A+ R+N  +AT  AT+ ++ L + V  FE  KL  L ++L  FVHIEMLWH +ALE LTEA+  +  M    D   F +++
Sbjct:    9 SLHRTTEIKETEAQSKFFNERVTQIETYFGDLCAEFINYTRRTAKLRNNGDELSKILLNYSINEKINRTSARTLRRFAELLSTIEDYRHAEVDRLFAKVITPLSTYGEEVKRVRTNIRVETAARKKEVSQLKRLGREPLRG-------AEERLN--IATRCATRSADALERQVIQFEAKKLKGLKDILTDFVHIEMLWHAKALETLTEAFNVVQSMQEEVDLADFRNTL 228          
BLAST of Protein FAM92A1 vs. TrEMBL
Match: A0A0X3P0A6 (Protein FAM92A1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=F92A1 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 7.136e-45
Identity = 91/225 (40.44%), Postives = 137/225 (60.89%), Query Frame = 1
Query:  121 TLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            +L    E+KESE   K++ +RV  IE     L  EFV Y RRTAKLRNNGDE+S IL NY++ ++ N TS+ +L KF+ ++S +ED+R+ E+DR+   VI PL    +++K ++  +K +  ARKKE+A      + ++LG     S A A     +AT++AT+ ++ L + V  FE  KL  L ++L  FVHIEMLWH +ALE  +EA+  +  +   +D   F
Sbjct:    9 SLNRTTELKESEAQSKFVNERVNQIEAYFGDLCSEFVSYTRRTAKLRNNGDELSKILLNYSVNEKINRTSSQTLKKFAELISNIEDYRHAEVDRLFAKVITPLSRYGDEVKKIRANLKAELTARKKEVA------QLKRLGQNTAPSRA-AEEQLHMATMDATRIADSLEREVIQFEAKKLKGLKDILTDFVHIEMLWHAKALETFSEAFNVVQSLQEESDLADF 226          
BLAST of Protein FAM92A1 vs. TrEMBL
Match: A0A0X3P7Q2 (Protein FAM92A1 OS=Schistocephalus solidus OX=70667 GN=F92A1 PE=4 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 9.831e-45
Identity = 91/225 (40.44%), Postives = 137/225 (60.89%), Query Frame = 1
Query:  121 TLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            +L    E+KESE   K++ +RV  IE     L  EFV Y RRTAKLRNNGDE+S IL NY++ ++ N TS+ +L KF+ ++S +ED+R+ E+DR+   VI PL    +++K ++  +K +  ARKKE+A      + ++LG     S A A     +AT++AT+ ++ L + V  FE  KL  L ++L  FVHIEMLWH +ALE  +EA+  +  +   +D   F
Sbjct:    9 SLNRTTELKESEAQSKFVNERVNQIEAYFGDLCSEFVSYTRRTAKLRNNGDELSKILLNYSVNEKINRTSSQTLKKFAELISNIEDYRHAEVDRLFAKVITPLSRYGDEVKKIRANLKAELTARKKEVA------QLKRLGQNTAPSRA-AEEQLHMATMDATRIADSLEREVIQFEAKKLKGLKDILTDFVHIEMLWHAKALETFSEAFNVVQSLQEESDLADF 226          
BLAST of Protein FAM92A1 vs. TrEMBL
Match: A0A087VX55 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000044800 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.711e-43
Identity = 91/219 (41.55%), Postives = 134/219 (61.19%), Query Frame = 1
Query:  139 EIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            EIKE+E   K+  +RV+ IE     L  EF+ Y RRTAKLRNNGDE+S IL +Y++ ++ N T+  +L KF+ +LS +ED+R+ E+DR+   VI PL    +++K +K  IK + AARKKE++   +L +    G       A+ R++  +AT +A + ++ L + V  FE  KL  L N+L  FVHIEMLWH +ALE LT+A+  +  M    D   F
Sbjct:   14 EIKETEAQSKFFNERVSQIETYFGDLCTEFISYTRRTAKLRNNGDELSKILLSYSVNEKINRTTARTLRKFAELLSTLEDYRHAEVDRLFAKVITPLSTYGDEVKRIKTNIKVETAARKKEVSQLKRLGREPLRG-------AEERIS--IATRDALRSADALERHVIQFEAKKLKGLKNILTDFVHIEMLWHAKALETLTDAFNVVQSMQEEVDLADF 223          
BLAST of Protein FAM92A1 vs. Ensembl Cavefish
Match: FAM92B (family with sequence similarity 92 member B [Source:HGNC Symbol;Acc:HGNC:24781])

HSP 1 Score: 110.923 bits (276), Expect = 8.101e-27
Identity = 65/214 (30.37%), Postives = 115/214 (53.74%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            K +E  + N EK +         Y+R+TAKLR+  D ++  L ++  T+  +   +  L  FS  LS+V+D+R  E++R+   V+ PL    + +K  + ++KK    R KE+    +LEK +       Q   +A VN Q A+  A++ ++Q+ +T+  F++ KL+ +  +   F+ +EML+H +ALE  T  +K++  MDT  D   F + I
Sbjct:   12 KAMEATIDNAEKYMGQFCTLLAAYSRKTAKLRDKADMLTRQLHDFACTE--DPEMSICLKNFSEDLSMVQDYRQAEVERLDARVVTPLKAYGDIVKTKRADLKKFSTDRNKELKEVQRLEKLRLKNPADRQGITQAEVNVQRASSNASRSTKQMEETIIEFQRQKLEDVKRIFTEFIMVEMLFHAKALEVYTHTFKNMETMDTDKDLEMFRNRI 223          
BLAST of Protein FAM92A1 vs. Ensembl Cavefish
Match: fam92a1 (family with sequence similarity 92 member A1 [Source:NCBI gene;Acc:445210])

HSP 1 Score: 107.071 bits (266), Expect = 6.229e-26
Identity = 69/238 (28.99%), Postives = 129/238 (54.20%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN----QSTNSLNLAG 867
            K +++ +T++EK    L + F GY R+TA+LR+  D +   +  Y  T+  N      L  F++ L+ ++D+R  E++R++  V++PL    + +K  + ++K    AR +E     +LE+ +Q   +  Q  A++ +  Q AT++AT+ + QL +T+  FE+ K+  +  +   FV +EM++H +ALE  T AY+ +  +D   D   F  S++   ++  L+     S  SLN  G
Sbjct:   13 KQIQESITHVEKHFGDLCQLFAGYVRKTARLRDKADLLVKEVSQYADTETPN--LKHGLKNFADQLAKIQDYRQAEVERLEAKVVEPLKTYGSVVKMKRADLKLTQTARNREAKQMQQLERMRQRNPSDRQIIAESEL--QRATMDATRTTRQLEETIDVFERQKIQDIKKIFMDFVSVEMIFHAKALELYTTAYQHIQNVDEEGDLEVFRTSLHPPDYQSRLDIVRANSRTSLNRTG 246          
BLAST of Protein FAM92A1 vs. Ensembl Cavefish
Match: ENSAMXT00000010804.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001052.1:67914:69361:1 gene:ENSAMXG00000010516.2 transcript:ENSAMXT00000010804.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 8.462e-26
Identity = 74/264 (28.03%), Postives = 136/264 (51.52%), Query Frame = 1
Query:  142 IKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN----QSTNSLNLAGRRSQSMTNLKTTNSSSQG 921
            I+  +   K +++ +T++EK    L + F GY R+TA+LR+  D +   +  Y  T+  N      L  F++ L+ ++D R  E++R++  V++PL    + +K  + ++K    A+ +E     +LE+ +Q   +  Q  ++A    Q AT++AT+ + QL +T+  FE+ K+  +  +   FV  EM++H +ALE  T AY+ +  +D   D   F  S++   ++  L+     S  SLN  G        L++ N  SQG
Sbjct:    2 IRRKDTQTKQIQESITHVEKHFGDLCQLFAGYVRKTARLRDKADLLVKEVSQYADTETPN--LKHGLKNFADQLAKIQDCRQAEVERLEAKVVEPLKTYGSVVKLKRTDLKLTQTAQNREAKQMRQLERMRQRHPSDRQIISQAESELQRATMDATRTTRQLEETIDVFERQKIQDIKKIFMDFVSAEMIFHAKALELYTTAYQQIQNVDEEGDLEVFRTSLHLPDYQSRLDIVHANSRTSLNRTGTSMSKSGTLQSRNPVSQG 263          
BLAST of Protein FAM92A1 vs. Ensembl Cavefish
Match: FAM92B (family with sequence similarity 92 member B [Source:HGNC Symbol;Acc:HGNC:24781])

HSP 1 Score: 91.2781 bits (225), Expect = 3.843e-20
Identity = 61/214 (28.50%), Postives = 103/214 (48.13%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSI 807
            K +E  + N EK +         Y+R+TAKLR+  D ++  L ++  T+  +   +  L  FS  LS+V+D+R  E D                       +KK    R KE+    +LEK +       Q   +A VN Q A+  A++ ++Q+ +T+  F++ KL+ +  +   F+ +EML+H +ALE  T  +K++  MDT  D   F + I
Sbjct:   12 KAMEATIDNAEKYMGQFCTLLAAYSRKTAKLRDKADMLTRQLHDFACTE--DPEMSICLKNFSEDLSMVQDYRQAEAD-----------------------LKKFSTDRNKELKEVQRLEKLRLKNPADRQGITQAEVNVQRASSNASRSTKQMEETIIEFQRQKLEDVKRIFTEFIMVEMLFHAKALEVYTHTFKNMETMDTDKDLEMFRNRI 200          
BLAST of Protein FAM92A1 vs. Ensembl Cavefish
Match: FAM92B (family with sequence similarity 92 member B [Source:HGNC Symbol;Acc:HGNC:24781])

HSP 1 Score: 78.1814 bits (191), Expect = 9.108e-16
Identity = 49/167 (29.34%), Postives = 89/167 (53.29%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLD 666
            K +E  + N EK +         Y+R+TAKLR+  D ++  L ++  T+  +   +  L  FS  LS+V+D+R  E++R+   V+ PL    + +K  + ++KK    R KE+    +LEK +       Q   +A VN Q A+  A++ ++Q+ +T+  F++ KL+
Sbjct:   12 KAMEATIDNAEKYMGQFCTLLAAYSRKTAKLRDKADMLTRQLHDFACTE--DPEMSICLKNFSEDLSMVQDYRQAEVERLDARVVTPLKAYGDIVKTKRADLKKFSTDRNKELKEVQRLEKLRLKNPADRQGITQAEVNVQRASSNASRSTKQMEETIIEFQRQKLE 176          
BLAST of Protein FAM92A1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010489.1 (pep scaffold:Pmarinus_7.0:GL481611:5524:14838:-1 gene:ENSPMAG00000009499.1 transcript:ENSPMAT00000010489.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.145 bits (261), Expect = 7.071e-26
Identity = 61/218 (27.98%), Postives = 121/218 (55.50%), Query Frame = 1
Query:  184 VTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN 837
            VT +EK    L +   GYAR+TA+LR+  D +   L  Y+ T+    +    L  F+  LS V+D+R  +++R++  V++PL      +K  ++++K    ++ +E     +LEK +Q   +   + ++A    Q AT++A + S QL +T+  FE+ K+  +  +L  FV +EM++H +ALE  ++AY  ++ ++  +D   F++++    ++  L+
Sbjct:   22 VTTVEKHFGELCQLSAGYARKTARLRDKSDLLVRELMAYSETE--RPSLKMGLRAFAEELSKVQDYRQAQVERLEAKVVEPLKSYGATIKIKREDLKAVLTSQTREAKQMQQLEKMRQRNPSDRHNISQAETELQRATVDAARSSRQLEETINEFERQKIKDIKKILCDFVTVEMVFHAKALEVYSQAYHHMHAVNEESDLEAFLNTLRPSDYQARLD 237          
BLAST of Protein FAM92A1 vs. Ensembl Nematostella
Match: EDO41617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3Y1])

HSP 1 Score: 79.337 bits (194), Expect = 5.099e-17
Identity = 57/218 (26.15%), Postives = 106/218 (48.62%), Query Frame = 1
Query:  142 IKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQF 795
            +K +E   K +++ +  +E     +      YA  TAKLR+ GDE+   +  Y   +    +  + L+  +  L+ V+D+R+ E+ RI+ +++Q L     + K  + ++K   +   KE+ +   LEK Q      ++  A+A+   Q A+ EA +    L + +  FE  K+  +  +   F+  EM    R+LE  T A++S+NG+    D N F
Sbjct:    3 LKATEHQTKVVDQNIATVEGHFPKIVSSLQRYAYGTAKLRDKGDELYKSIAAYAENEA--PSMKEGLHVLAECLAAVQDYRDAEVHRIEENMVQKLSIYDTKCKQARNDVKNSSSLCSKEVKSFNSLEKIQTKSSDRSRI-ARAQAEFQKASGEANRSLRVLREQMNEFEMQKMKDIKTIFTDFIRCEMEVSARSLELYTRAFRSINGISVDEDINSF 217          
BLAST of Protein FAM92A1 vs. Ensembl Nematostella
Match: EDO47361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMK4])

HSP 1 Score: 54.6842 bits (130), Expect = 2.455e-8
Identity = 68/313 (21.73%), Postives = 134/313 (42.81%), Query Frame = 1
Query:  124 LRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQ-------------QLGGTMTQSEAKARVNS---------------------QLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLN----QSTNSLNLAGRRSQ---SMTNLKTTNSS--SQGDLSN 933
            LR+   +++ E+  K +  R+  +EK   +  K+ V Y      LR+   + S  +  Y   +         L   +  ++ V+D+ ++++D +   V QPL   T   K+ +  +K    +R KEIA    L+K +              L  +  +   K +++                      Q + ++A +  + + + +T+FEK K++ +  +  ++ H +M++H +ALE  T A+++L  +D   D   F  +++       L+     S NSL   G +     S  +L  TN S  SQG L++
Sbjct:   12 LRAEARVRDHEL--KVITDRIALVEKHFALFHKDMVAYCASLEGLRDKSTKFSAAVEAYAEEE--FPAVRGGLQAVAENVATVQDYLSSQIDFLLNKVAQPLSLYTTDCKHARDYMKGTMVSRNKEIAKLKALDKVRAKDPNNKKIVSFIDLFYSFPKVTGKYQIDEGITKFIIVLAKPFAAELEQELQKSAVDANRSRQTMIEQMTAFEKKKIEDIKTIFGNYFHGQMMYHAKALEINTLAFQNLMKIDEEQDLEAFQTALHPSSMPSRLDVVKYGSQNSLQRFGSQGSLEGSQLSLNRTNQSFQSQGTLND 320          
BLAST of Protein FAM92A1 vs. Ensembl Medaka
Match: fam92a1 (family with sequence similarity 92 member A [Source:NCBI gene;Acc:101160330])

HSP 1 Score: 87.8113 bits (216), Expect = 4.226e-19
Identity = 67/251 (26.69%), Postives = 132/251 (52.59%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNLAGRRSQSMTNLKTTNSSSQ 918
            K ++  +T +EK    + + F  Y R+TA+LR+ GD +   +  +  T E  D     + +F++ L+ ++D+R+ ++ R++  V++PL      +   ++++K   +A  KE     +LEK++    +  Q  A++ +  Q AT++A + ++QL +T+  FE+ K+  +  +   FV +E+ +  +ALE  T AY+S+  +D   D   F  S++   +   L + TNS     R S   T + T+ +S Q
Sbjct:   11 KKIQDNITRVEKHFGEMCQLFAAYTRKTARLRDKGDLLVQQIAVHADT-ETPDLKR-GMKEFADHLAKIQDYRHAQVKRLEAKVVEPLKTYGAVVIRKREDVKMTQSAIDKEAKQEAQLEKTRLKNPSDRQIIAESEL--QKATMDAARTTKQLEETIDEFERQKIRDIKKIFSEFVTVELCFLGKALELYTSAYQSIQSVDEEADLEVFRSSLHPLDYNSRLGR-TNS-----RTSLDRTFMSTSGTSKQ 251          
BLAST of Protein FAM92A1 vs. Ensembl Medaka
Match: fam92a1 (family with sequence similarity 92 member A [Source:NCBI gene;Acc:101160330])

HSP 1 Score: 86.6557 bits (213), Expect = 9.347e-19
Identity = 59/232 (25.43%), Postives = 124/232 (53.45%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNL 861
            K ++  +T +EK    + + F  Y R+TA+LR+ GD +   +  +  T E  D     + +F++ L+ ++D+R+ ++ R++  V++PL      +   ++++K   +A  KE     +LEK++    +  Q  A++ +  Q AT++A + ++QL +T+  FE+ K+  +  +   FV +E+ +  +ALE  T AY+S+  +D   D   F  S++   +   L ++ +  +L
Sbjct:   13 KKIQDNITRVEKHFGEMCQLFAAYTRKTARLRDKGDLLVQQIAVHADT-ETPDLKR-GMKEFADHLAKIQDYRHAQVKRLEAKVVEPLKTYGAVVIRKREDVKMTQSAIDKEAKQEAQLEKTRLKNPSDRQIIAESEL--QKATMDAARTTKQLEETIDEFERQKIRDIKKIFSEFVTVELCFLGKALELYTSAYQSIQSVDEEADLEVFRSSLHPLDYNSRLGRTNSRTSL 240          
BLAST of Protein FAM92A1 vs. Ensembl Medaka
Match: fam92a1 (family with sequence similarity 92 member A [Source:NCBI gene;Acc:101160330])

HSP 1 Score: 86.2705 bits (212), Expect = 1.389e-18
Identity = 59/232 (25.43%), Postives = 124/232 (53.45%), Query Frame = 1
Query:  166 KYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNL 861
            K ++  +T +EK    + + F  Y R+TA+LR+ GD +   +  +  T E  D     + +F++ L+ ++D+R+ ++ R++  V++PL      +   ++++K   +A  KE     +LEK++    +  Q  A++ +  Q AT++A + ++QL +T+  FE+ K+  +  +   FV +E+ +  +ALE  T AY+S+  +D   D   F  S++   +   L ++ +  +L
Sbjct:   10 KKIQDNITRVEKHFGEMCQLFAAYTRKTARLRDKGDLLVQQIAVHADT-ETPDLKR-GMKEFADHLAKIQDYRHAQVKRLEAKVVEPLKTYGAVVIRKREDVKMTQSAIDKEAKQEAQLEKTRLKNPSDRQIIAESEL--QKATMDAARTTKQLEETIDEFERQKIRDIKKIFSEFVTVELCFLGKALELYTSAYQSIQSVDEEADLEVFRSSLHPLDYNSRLGRTNSRTSL 237          
BLAST of Protein FAM92A1 vs. Planmine SMEST
Match: SMESG000072750.1 (SMESG000072750.1)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 384/385 (99.74%), Postives = 385/385 (100.00%), Query Frame = 1
Query:  100 MNDSRILTLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNLAGRRSQSMTNLKTTNSSSQGDLSNKNELRNSVTFEDQFSRSKSFQNAPSNQSGGSIMRQGTSQPNVNQSKPPVANGGTVHSNRPXXXXXXXXXXXXXXXXXXXXXNPTSQTXXXXXXXXXXXHPVPSKRTK 1254
            MNDSRILTLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNLAGRRSQSMTNLKTTNSSSQGDLSNKNELRNSVTFEDQFSRSKSFQNAPSNQSGGSIMRQGTSQPNVNQSKPPVANGGTVHSNRPG+SEDGDDDEYTDDSSYTDDENPTSQTASARSANRNANHPVPSKRTK
Sbjct:    1 MNDSRILTLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRTAKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELDRIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGTMTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVHIEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTNSLNLAGRRSQSMTNLKTTNSSSQGDLSNKNELRNSVTFEDQFSRSKSFQNAPSNQSGGSIMRQGTSQPNVNQSKPPVANGGTVHSNRPGESEDGDDDEYTDDSSYTDDENPTSQTASARSANRNANHPVPSKRTK 385          
The following BLAST results are available for this feature:
BLAST of Protein FAM92A1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM92A5.855e-2428.50family with sequence similarity 92 member A [Sourc... [more]
FAM92A7.908e-2428.50family with sequence similarity 92 member A [Sourc... [more]
FAM92A3.168e-2328.64family with sequence similarity 92 member A [Sourc... [more]
FAM92A3.246e-2228.50family with sequence similarity 92 member A [Sourc... [more]
FAM92B3.378e-2129.13family with sequence similarity 92 member B [Sourc... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM92A1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG64057.041e-1624.39gene:FBgn0032428 transcript:FBtr0080366[more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam92a12.419e-2830.59family with sequence similarity 92 member A1 [Sour... [more]
fam92a13.450e-2730.86family with sequence similarity 92 member A1 [Sour... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FAM92B7.103e-2129.05family with sequence similarity 92 member B [Sourc... [more]
flrt19.004e-1229.51fibronectin leucine rich transmembrane protein 1 [... [more]
flrt11.216e-1129.51fibronectin leucine rich transmembrane protein 1 [... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam92a6.043e-3030.19family with sequence similarity 92, member A [Sour... [more]
Fam92a2.037e-2929.81family with sequence similarity 92, member A [Sour... [more]
Fam92a4.134e-2930.19family with sequence similarity 92, member A [Sour... [more]
Fam92b4.238e-2329.52family with sequence similarity 92, member B [Sour... [more]
Fam92a6.704e-2230.24family with sequence similarity 92, member A [Sour... [more]
back to top
BLAST of Protein FAM92A1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2VR06|F92AA_XENLA5.476e-2930.80Protein FAM92A-A OS=Xenopus laevis OX=8355 GN=fam9... [more]
sp|Q6GN09|F92AB_XENLA1.318e-2830.36Protein FAM92A-B OS=Xenopus laevis OX=8355 GN=fam9... [more]
sp|Q8BP22|FA92A_MOUSE1.425e-2829.81Protein FAM92A OS=Mus musculus OX=10090 GN=Fam92a ... [more]
sp|Q1RMK1|FA92B_BOVIN4.941e-2833.33Protein FAM92B OS=Bos taurus OX=9913 GN=FAM92B PE=... [more]
sp|Q1LU86|FA92A_DANRE1.826e-2730.59Protein FAM92A OS=Danio rerio OX=7955 GN=fam92a PE... [more]
back to top
BLAST of Protein FAM92A1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3F1V65.968e-4642.22Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F1D34.034e-4541.48Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3P0A67.136e-4540.44Protein FAM92A1 (Fragment) OS=Schistocephalus soli... [more]
A0A0X3P7Q29.831e-4540.44Protein FAM92A1 OS=Schistocephalus solidus OX=7066... [more]
A0A087VX551.711e-4341.55Uncharacterized protein OS=Echinococcus multilocul... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM92B8.101e-2730.37family with sequence similarity 92 member B [Sourc... [more]
fam92a16.229e-2628.99family with sequence similarity 92 member A1 [Sour... [more]
ENSAMXT00000010804.28.462e-2628.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
FAM92B3.843e-2028.50family with sequence similarity 92 member B [Sourc... [more]
FAM92B9.108e-1629.34family with sequence similarity 92 member B [Sourc... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010489.17.071e-2627.98pep scaffold:Pmarinus_7.0:GL481611:5524:14838:-1 g... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM92A1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO416175.099e-1726.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473612.455e-821.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein FAM92A1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fam92a14.226e-1926.69family with sequence similarity 92 member A [Sourc... [more]
fam92a19.347e-1925.43family with sequence similarity 92 member A [Sourc... [more]
fam92a11.389e-1825.43family with sequence similarity 92 member A [Sourc... [more]
back to top
BLAST of Protein FAM92A1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000072750.10.000e+099.74SMESG000072750.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035040 ID=SMED30035040|Name=Protein FAM92A1|organism=Schmidtea mediterranea sexual|type=transcript|length=1328bp
CAAATAATTAAGCTGAATTGCCGATTGTTTTAATAAATCACCTTGTTTAT
TTGACGGTAGCTCCTATCATCGAGTATACAAACACAATTTAAATATCTAA
TGAATGATTCAAGAATATTAACCCTTAGAAGTCCAGTTGAAATTAAAGAA
AGTGAAATACTTGACAAATATTTAGAGAAACGTGTAACAAATATAGAGAA
ATCAATTAATGTTTTGACAAAGGAATTTGTCGGTTATGCTCGTAGGACAG
CAAAGTTACGAAATAATGGAGATGAAGTGTCAAACATACTGCGCAATTAC
ACATTAACTCAGGAATTCAATGATACATCTAATGACTCTCTCAATAAGTT
TTCTAATATTTTATCGGTTGTGGAAGATTTCCGAAACACAGAACTAGACA
GAATCAAAGTCCATGTGATCCAGCCGTTGATCGAATGTACGAATCAGCTG
AAAAATGTCAAAAAAGAGATCAAAAAGGATTTTGCAGCAAGGAAAAAGGA
AATCGCAGCTCATGGGAAATTGGAAAAGAGCCAGCAGCTCGGTGGAACAA
TGACTCAGTCTGAGGCAAAGGCTCGCGTCAACTCACAACTGGCAACTCTG
GAAGCAACCAAGCAATCAGAACAACTTGGTAAAACTGTGACATCGTTTGA
GAAATTGAAATTAGATACTTTACACAATGTCCTTCGCTCTTTCGTCCACA
TTGAGATGCTGTGGCACATGCGGGCGTTGGAGCGGCTTACAGAGGCATAT
AAGTCCCTCAACGGTATGGACACGCTGAACGATCAGAACCAATTTATAGA
CTCGATCAATAAATATCATTTCAAGGAATATCTCAATCAATCGACTAACA
GTTTGAATCTCGCCGGACGGCGATCTCAATCAATGACAAACCTCAAGACG
ACAAACTCGTCCAGCCAAGGCGATCTGAGCAACAAGAACGAACTGAGGAA
CTCAGTTACATTCGAGGATCAGTTTTCTCGATCCAAAAGCTTCCAGAACG
CGCCATCGAATCAATCAGGCGGATCAATCATGCGCCAGGGCACCTCACAG
CCCAATGTCAACCAAAGCAAGCCTCCTGTTGCTAATGGTGGCACTGTGCA
TAGCAACCGCCCTGGAGATAGCGAGGATGGCGATGATGATGAGTACACAG
ATGACTCCTCCTACACCGATGACGAGAATCCCACCTCGCAAACGGCATCA
GCGAGGAGCGCTAACCGTAACGCAAACCATCCGGTTCCCAGCAAGCGTAC
AAAATAGAGTCAAAATCAATTATTTTTTACACTTATCGTTATATAGTTGA
TCAAATATATTATTATATTATATTGAAA
back to top

protein sequence of SMED30035040-orf-1

>SMED30035040-orf-1 ID=SMED30035040-orf-1|Name=SMED30035040-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=386bp
MNDSRILTLRSPVEIKESEILDKYLEKRVTNIEKSINVLTKEFVGYARRT
AKLRNNGDEVSNILRNYTLTQEFNDTSNDSLNKFSNILSVVEDFRNTELD
RIKVHVIQPLIECTNQLKNVKKEIKKDFAARKKEIAAHGKLEKSQQLGGT
MTQSEAKARVNSQLATLEATKQSEQLGKTVTSFEKLKLDTLHNVLRSFVH
IEMLWHMRALERLTEAYKSLNGMDTLNDQNQFIDSINKYHFKEYLNQSTN
SLNLAGRRSQSMTNLKTTNSSSQGDLSNKNELRNSVTFEDQFSRSKSFQN
APSNQSGGSIMRQGTSQPNVNQSKPPVANGGTVHSNRPGDSEDGDDDEYT
DDSSYTDDENPTSQTASARSANRNANHPVPSKRTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR009602FAM92
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005814centriole
GO:0036064ciliary basal body
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009602FAM92 proteinPFAMPF06730FAM92coord: 23..228
e-value: 1.5E-29
score: 103.0
IPR009602FAM92 proteinPANTHERPTHR21223UNCHARACTERIZEDcoord: 22..356
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 23..225
e-value: 1.3E-12
score: 49.8
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 24..220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..385
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..336
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 356..379
NoneNo IPR availablePANTHERPTHR21223:SF2coord: 22..356