SMED30035039

Overview
NameSMED30035039
Smed IDSMED30035039
Length (bp)1273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30035039 (SMED30035039) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30035039 (SMED30035039) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30035039 (SMED30035039) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30035039 (SMED30035039) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035039

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30035039SMESG000057944.1 SmedASXL_002700SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30035039SMESG000057944.1 dd_Smed_v4_1019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30035039SMESG000057944.1 dd_Smed_v4_1019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30035039SMESG000057944.1 dd_Smed_v4_1019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30035039SMESG000057944.1 dd_Smed_v4_1019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035039SMESG000057944.1 dd_Smed_v6_1019_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30035039 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002358:34734..36046 +6249
Homology
BLAST of SMED30035039 vs. Ensembl Human
Match: SYNJ1 (synaptojanin 1 [Source:HGNC Symbol;Acc:HGNC:11503])

HSP 1 Score: 50.0618 bits (118), Expect = 7.512e-6
Identity = 75/324 (23.15%), Postives = 124/324 (38.27%), Query Frame = 3
Query:  153 KVSGIQISFITWNVKDNKRFSTYT------KDIVLKLLNL------QNTKNMP-DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGT-TFMLILIKSPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIY----WP 1040
            K   I++   TWNV   K+F +         D +L    L      Q+ ++ P DI+AI F+E            + L   N++ + T T  +  ++   +  +       L++  + G   F+ I  +    + ++  +T+ +G      NK  G   + +  +   LCF   H   G   +K R + F EI  KL           D  F+ GDFN R +  +  V         Q   + +   D+L               I QK   Q    F +   +F PTY  +     DD+    E  R P+WTDR+++    WP
Sbjct:  524 KPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDWLLDAPKLAGIQEFQDKRSKPTDIFAIGFEE-----------MVELNAGNIVSAST-TNQKLWAVELQKTISRDNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNK--GAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDFIEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELI----RQQNWDSLIAGDQL---------------INQKNAGQVFRGFLEGKVTFAPTYKYD--LFSDDYDTS-EKCRTPAWTDRVLWRRRKWP 811          
BLAST of SMED30035039 vs. Ensembl Xenopus
Match: stmn3 (stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431])

HSP 1 Score: 52.373 bits (124), Expect = 1.169e-6
Identity = 77/322 (23.91%), Postives = 128/322 (39.75%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRF-------STYTKDI-----VLKLLNLQNTKNMP-DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIK---SPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIY----WP 1040
            I+I   TWNV   K+F       ST T  +     +  +   Q+ ++ P DI+AI F+E            + L   N++ + T    + L  +  ++T   +  Y L          + I I+   +P  + ++  +T+ +G      NK  G   + +  +   LCF   H   G   +K R + + EI  KL           D  F+ GDFN R +  +  V       +NQ + + + + D+L               I QK   Q    F +   +F PTY  +     DD+    E  R P+WTDR+++    WP
Sbjct:  521 IRICVGTWNVNGGKQFRSIAYKNSTLTDWLLDAPRIAGIQEFQDRRSKPVDIFAIGFEE-----------MVELNAGNIVNASTAN--QKLWATELQKTVSRDHKYVLLASEQLVGVCLYIFIRPQHAPF-IRDVAVDTVKTGMGGATGNK--GAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDYNEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKEMI---RNQNW-DSLILGDQL---------------INQKNSGQVFRGFQEGKINFAPTYKYD--LFSDDYDTS-EKCRTPAWTDRVLWRRRKWP 804          
BLAST of SMED30035039 vs. Ensembl Xenopus
Match: stmn3 (stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431])

HSP 1 Score: 52.373 bits (124), Expect = 1.182e-6
Identity = 77/322 (23.91%), Postives = 128/322 (39.75%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRF-------STYTKDI-----VLKLLNLQNTKNMP-DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIK---SPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIY----WP 1040
            I+I   TWNV   K+F       ST T  +     +  +   Q+ ++ P DI+AI F+E            + L   N++ + T    + L  +  ++T   +  Y L          + I I+   +P  + ++  +T+ +G      NK  G   + +  +   LCF   H   G   +K R + + EI  KL           D  F+ GDFN R +  +  V       +NQ + + + + D+L               I QK   Q    F +   +F PTY  +     DD+    E  R P+WTDR+++    WP
Sbjct:  537 IRICVGTWNVNGGKQFRSIAYKNSTLTDWLLDAPRIAGIQEFQDRRSKPVDIFAIGFEE-----------MVELNAGNIVNASTAN--QKLWATELQKTVSRDHKYVLLASEQLVGVCLYIFIRPQHAPF-IRDVAVDTVKTGMGGATGNK--GAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDYNEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKEMI---RNQNW-DSLILGDQL---------------INQKNSGQVFRGFQEGKINFAPTYKYD--LFSDDYDTS-EKCRTPAWTDRVLWRRRKWP 820          
BLAST of SMED30035039 vs. Ensembl Xenopus
Match: stmn3 (stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431])

HSP 1 Score: 51.2174 bits (121), Expect = 2.879e-6
Identity = 77/322 (23.91%), Postives = 128/322 (39.75%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRF-------STYTKDI-----VLKLLNLQNTKNMP-DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIK---SPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIY----WP 1040
            I+I   TWNV   K+F       ST T  +     +  +   Q+ ++ P DI+AI F+E            + L   N++ + T    + L  +  ++T   +  Y L          + I I+   +P  + ++  +T+ +G      NK  G   + +  +   LCF   H   G   +K R + + EI  KL           D  F+ GDFN R +  +  V       +NQ + + + + D+L               I QK   Q    F +   +F PTY  +     DD+    E  R P+WTDR+++    WP
Sbjct:  537 IRICVGTWNVNGGKQFRSIAYKNSTLTDWLLDAPRIAGIQEFQDRRSKPVDIFAIGFEE-----------MVELNAGNIVNASTAN--QKLWATELQKTVSRDHKYVLLASEQLVGVCLYIFIRPQHAPF-IRDVAVDTVKTGMGGATGNK--GAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDYNEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKEMI---RNQNW-DSLILGDQL---------------INQKNSGQVFRGFQEGKINFAPTYKYD--LFSDDYDTS-EKCRTPAWTDRVLWRRRKWP 820          
BLAST of SMED30035039 vs. Ensembl Xenopus
Match: stmn3 (stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431])

HSP 1 Score: 50.447 bits (119), Expect = 5.337e-6
Identity = 78/326 (23.93%), Postives = 129/326 (39.57%), Query Frame = 3
Query:  153 KVSGIQISFITWNVKDNKRF-------STYTKDI-----VLKLLNLQNTKNMP-DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIK---SPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIY----WP 1040
            K   I+I   TWNV   K+F       ST T  +     +  +   Q+ ++ P DI+AI F+E            + L   N++ + T    + L  +  ++T   +  Y L          + I I+   +P  + ++  +T+ +G      NK  G   + +  +   LCF   H   G   +K R + + EI  KL           D  F+ GDFN R +  +  V       +NQ + + + + D+L               I QK   Q    F +   +F PTY  +     DD+    E  R P+WTDR+++    WP
Sbjct:  524 KPRKIRICVGTWNVNGGKQFRSIAYKNSTLTDWLLDAPRIAGIQEFQDRRSKPVDIFAIGFEE-----------MVELNAGNIVNASTAN--QKLWATELQKTVSRDHKYVLLASEQLVGVCLYIFIRPQHAPF-IRDVAVDTVKTGMGGATGNK--GAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDYNEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKEMI---RNQNW-DSLILGDQL---------------INQKNSGQVFRGFQEGKINFAPTYKYD--LFSDDYDTS-EKCRTPAWTDRVLWRRRKWP 811          
BLAST of SMED30035039 vs. Ensembl Xenopus
Match: stmn3 (stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431])

HSP 1 Score: 50.447 bits (119), Expect = 5.637e-6
Identity = 78/326 (23.93%), Postives = 129/326 (39.57%), Query Frame = 3
Query:  153 KVSGIQISFITWNVKDNKRF-------STYTKDI-----VLKLLNLQNTKNMP-DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIK---SPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIY----WP 1040
            K   I+I   TWNV   K+F       ST T  +     +  +   Q+ ++ P DI+AI F+E            + L   N++ + T    + L  +  ++T   +  Y L          + I I+   +P  + ++  +T+ +G      NK  G   + +  +   LCF   H   G   +K R + + EI  KL           D  F+ GDFN R +  +  V       +NQ + + + + D+L               I QK   Q    F +   +F PTY  +     DD+    E  R P+WTDR+++    WP
Sbjct:  551 KPRKIRICVGTWNVNGGKQFRSIAYKNSTLTDWLLDAPRIAGIQEFQDRRSKPVDIFAIGFEE-----------MVELNAGNIVNASTAN--QKLWATELQKTVSRDHKYVLLASEQLVGVCLYIFIRPQHAPF-IRDVAVDTVKTGMGGATGNK--GAVAIRMLFHTTSLCFVCSHFAAGQSQVKERNEDYNEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKEMI---RNQNW-DSLILGDQL---------------INQKNSGQVFRGFQEGKINFAPTYKYD--LFSDDYDTS-EKCRTPAWTDRVLWRRRKWP 838          
BLAST of SMED30035039 vs. Ensembl Mouse
Match: Synj2 (synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671])

HSP 1 Score: 50.447 bits (119), Expect = 3.145e-6
Identity = 72/318 (22.64%), Postives = 127/318 (39.94%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRFSTY---TKDIVLKLLNL---------QNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQV---SNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIE---SSFDCDDFPVCYEPDRFPSWTDRIIYW 1037
            IQI+  TWNV   K+F +    T ++   LL+          Q+  +  D++AI F+E            + L   N++ + T T  +       +  +       L++  + G    + +   P  V    ++  +T+ +G      NK  G   +   +++   CF   HL  G   +K R + + EI +KL           D  F+ GDFN R +     V  +    K Q +   M+  D+L               + +  GK F +    + +F PTY  +   +++D  D   C    R P+WTDR+++W
Sbjct:  290 IQIAVGTWNVNGGKQFRSNLLGTAELTDWLLDAPQLSGAVDSQDDGSPADVFAIGFEE-----------MVELSAGNIVNAST-TNRKMWGEQLQKAISRSHRYILLTSAQLVGVCLYIFV--RPYHVPFIRDVAIDTVKTGMGGKAGNK--GAVGIRFQLHSTSFCFVCSHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEVFYFV---KRQDWKKLMEF-DQLQ--------------LQKSSGKIFKDFHEGAVNFGPTYKYDVGSAAYDTSD--KC----RTPAWTDRVLWW 567          
BLAST of SMED30035039 vs. Ensembl Mouse
Match: Synj2 (synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671])

HSP 1 Score: 50.447 bits (119), Expect = 3.719e-6
Identity = 76/318 (23.90%), Postives = 128/318 (40.25%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRFSTY---TKDIVLKLLNL---------QNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQV---SNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIE---SSFDCDDFPVCYEPDRFPSWTDRIIYW 1037
            IQI+  TWNV   K+F +    T ++   LL+          Q+  +  D++AI F+E         +E  +   +N   +      E L  + +R        Y L T +      + I ++ P  V    ++  +T+ +G      NK  G   +   +++   CF   HL  G   +K R + + EI +KL           D  F+ GDFN R +     V  YF   ++   L E    D+L               + +  GK F +    + +F PTY  +   +++D  D   C    R P+WTDR+++W
Sbjct:  445 IQIAVGTWNVNGGKQFRSNLLGTAELTDWLLDAPQLSGAVDSQDDGSPADVFAIGFEE--------MVELSAGNIVNASTTNRKMWGEQLQKAISRSHR-----YILLTSAQLVGVCLYIFVR-PYHVPFIRDVAIDTVKTGMGGKAGNK--GAVGIRFQLHSTSFCFVCSHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEV-FYFVKRQDWKKLMEF---DQLQ--------------LQKSSGKIFKDFHEGAVNFGPTYKYDVGSAAYDTSD--KC----RTPAWTDRVLWW 722          
BLAST of SMED30035039 vs. Ensembl Mouse
Match: Synj2 (synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671])

HSP 1 Score: 50.0618 bits (118), Expect = 4.564e-6
Identity = 76/318 (23.90%), Postives = 128/318 (40.25%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRFSTY---TKDIVLKLLNL---------QNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQV---SNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIE---SSFDCDDFPVCYEPDRFPSWTDRIIYW 1037
            IQI+  TWNV   K+F +    T ++   LL+          Q+  +  D++AI F+E         +E  +   +N   +      E L  + +R        Y L T +      + I ++ P  V    ++  +T+ +G      NK  G   +   +++   CF   HL  G   +K R + + EI +KL           D  F+ GDFN R +     V  YF   ++   L E    D+L               + +  GK F +    + +F PTY  +   +++D  D   C    R P+WTDR+++W
Sbjct:    8 IQIAVGTWNVNGGKQFRSNLLGTAELTDWLLDAPQLSGAVDSQDDGSPADVFAIGFEE--------MVELSAGNIVNASTTNRKMWGEQLQKAISRSHR-----YILLTSAQLVGVCLYIFVR-PYHVPFIRDVAIDTVKTGMGGKAGNK--GAVGIRFQLHSTSFCFVCSHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEV-FYFVKRQDWKKLMEF---DQLQ--------------LQKSSGKIFKDFHEGAVNFGPTYKYDVGSAAYDTSD--KC----RTPAWTDRVLWW 285          
BLAST of SMED30035039 vs. Ensembl Mouse
Match: Synj2 (synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671])

HSP 1 Score: 50.0618 bits (118), Expect = 4.781e-6
Identity = 76/318 (23.90%), Postives = 128/318 (40.25%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRFSTY---TKDIVLKLLNL---------QNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQV---SNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIE---SSFDCDDFPVCYEPDRFPSWTDRIIYW 1037
            IQI+  TWNV   K+F +    T ++   LL+          Q+  +  D++AI F+E         +E  +   +N   +      E L  + +R        Y L T +      + I ++ P  V    ++  +T+ +G      NK  G   +   +++   CF   HL  G   +K R + + EI +KL           D  F+ GDFN R +     V  YF   ++   L E    D+L               + +  GK F +    + +F PTY  +   +++D  D   C    R P+WTDR+++W
Sbjct:  530 IQIAVGTWNVNGGKQFRSNLLGTAELTDWLLDAPQLSGAVDSQDDGSPADVFAIGFEE--------MVELSAGNIVNASTTNRKMWGEQLQKAISRSHR-----YILLTSAQLVGVCLYIFVR-PYHVPFIRDVAIDTVKTGMGGKAGNK--GAVGIRFQLHSTSFCFVCSHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEV-FYFVKRQDWKKLMEF---DQLQ--------------LQKSSGKIFKDFHEGAVNFGPTYKYDVGSAAYDTSD--KC----RTPAWTDRVLWW 807          
BLAST of SMED30035039 vs. Ensembl Mouse
Match: Synj2 (synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671])

HSP 1 Score: 50.0618 bits (118), Expect = 4.802e-6
Identity = 76/318 (23.90%), Postives = 128/318 (40.25%), Query Frame = 3
Query:  165 IQISFITWNVKDNKRFSTY---TKDIVLKLLNL---------QNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQV---SNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIE---SSFDCDDFPVCYEPDRFPSWTDRIIYW 1037
            IQI+  TWNV   K+F +    T ++   LL+          Q+  +  D++AI F+E         +E  +   +N   +      E L  + +R        Y L T +      + I ++ P  V    ++  +T+ +G      NK  G   +   +++   CF   HL  G   +K R + + EI +KL           D  F+ GDFN R +     V  YF   ++   L E    D+L               + +  GK F +    + +F PTY  +   +++D  D   C    R P+WTDR+++W
Sbjct:  530 IQIAVGTWNVNGGKQFRSNLLGTAELTDWLLDAPQLSGAVDSQDDGSPADVFAIGFEE--------MVELSAGNIVNASTTNRKMWGEQLQKAISRSHR-----YILLTSAQLVGVCLYIFVR-PYHVPFIRDVAIDTVKTGMGGKAGNK--GAVGIRFQLHSTSFCFVCSHLTAGQSQVKERNEDYREITHKLSFPSGRNIFSHDYVFWCGDFNYRIDLTYEEV-FYFVKRQDWKKLMEF---DQLQ--------------LQKSSGKIFKDFHEGAVNFGPTYKYDVGSAAYDTSD--KC----RTPAWTDRVLWW 807          
BLAST of SMED30035039 vs. TrEMBL
Match: A0A3S3NZN9 (Inositol polyphosphate 5-phosphatase K-like protein (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_06530 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.207e-10
Identity = 87/307 (28.34%), Postives = 126/307 (41.04%), Query Frame = 3
Query:  243 LLNLQNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSP-LQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGN--IKYRQKAFYEILNKL-----DSK----CDVTFFGGDFNTRPNGKS-HPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASK--VQCSEYSIVPSLAVLSDHIPVYA 1118
            LLNL+ + N P IYAI FQE                 +N + S + T     +IS    T        L+  S+HG+  ++ + KS    V  +   ++ +G    F N  KG   +        LCF G H   G+  +K R   + EI NK+     D+K     D+ F+ GD N R +  S   +            + ++   D+L  S               K G  F + F   P+F+PTY  +  F  DD    Y  +R P++TDRI+Y   S   VQ   Y    S  + SDH PVYA
Sbjct:    4 LLNLEASSNRPTIYAIGFQE-----------------VNPILSSSDTNENLWTISLI-NTFEKYDYELLAKKSIHGSFVIIFIAKSESSNVQLVEGRSVRTGFFGIFGN--KGGNAIRFNFKGTSLCFVGAHFHAGDEELKKRIVDYREINNKVVFDNPDTKRIINHDLVFWFGDLNFRIDDYSAEEINDIVKTESTSVTVGKLMQKDQLKKS--------------MKEGLVFDDYFEGRPNFRPTYKFK--FGTDD----YNLERKPAFTDRILYRARSSIIVQQLNYDSNESFKI-SDHKPVYA 269          
BLAST of SMED30035039 vs. TrEMBL
Match: A0A0K8TNT2 (Putative inositol-145-triphosphate 5-phosphatase synaptojanin inp51/inp52/inp53 family (Fragment) OS=Tabanus bromius OX=304241 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.239e-8
Identity = 83/334 (24.85%), Postives = 136/334 (40.72%), Query Frame = 3
Query:  183 TWNVKDNKRFSTYTKDIVLKLLNLQNTKNMPDIYAITFQE-----NCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQ--VSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHL--DVGNIKYRQKAFYEILNKLD----------SKCDVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLN--EMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPVYA 1118
            TWNV           D +L+   L  +   PDIYAI FQE       I   E+R + +   +I  +     T   +  + + R   M                 + I+++  L+  V+  + +T+ +G+ +   N  KG   V + +N   +CF   HL   V  ++ R + F EI+ +L            + D  F+ GD N R     H +P     G+   Y N  E+   D+L                 +++  +  E + +    F+PTY  +   D  D     E +R P+W DRI+ W   +++   Y+ V S+  LSDH PVYA
Sbjct:  208 TWNVNGQP-----CNDTILRAW-LDTSDKPPDIYAIAFQELDLSPKAITFNETRPDPI---WIRKIMDNLPTTANYEELVSVRLVGM----------------MLTIIVRKELRPNVTRCWTQTVGTGALNIMGN--KGGVGVSMTLNEANICFINSHLAAHVSEVERRNEDFAEIVRRLQFGDGFTKYTIDRHDHIFWIGDLNYR----IHEMP-----GRVLDYENFPELLKNDQLH---------------MERLKNRVFEGYTEGEIKFRPTYKYDPGTDNWD---SSEKNRAPAWCDRIL-WKGERIKQLTYNSVMSIR-LSDHKPVYA 485          
BLAST of SMED30035039 vs. TrEMBL
Match: A0A507C213 (SAC domain-containing protein OS=Synchytrium microbalum OX=1806994 GN=SmJEL517_g03470 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 7.992e-8
Identity = 70/289 (24.22%), Postives = 124/289 (42.91%), Query Frame = 3
Query:  273 PDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVG--NIKYRQKAFYEILNKLDSKC------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPV 1112
            PD+Y +  QE  I+   +++  ++     + +    T+ + ++ ++     +  S++ ++ G      F+ +  +   ++ N+      +G      NK  G   V L  N+  +CF   HL  G  N+  R + +  I + LD +       D+ F+ GDFN R N  +  V  Y     N+  L+ + + D+L              +  +K G  F E F++ P  FKPTY  ++  D  D     E  R P+WTDR++ W    +   EY      +  SDH PV
Sbjct:  536 PDMYVLGIQE-MIELTANQM--ITADTAALRQRWDATLLDAINKTSRVPYVLLRSLHLVALG-----IFIFVRPEHAERIRNVEVSMKRTGMGGMAGNK--GGVSVSLNFNDTSMCFVSAHLAAGEKNVDERNRDYRTITDGLDFRGKLVKDHDLVFWLGDFNYRINLTNEEVRDYV----NRNQLDHLYLYDQL--------------HEMRKDGAAF-EGFHEGPIRFKPTYKYDNGTDTYD---SGEKARAPAWTDRVL-WRGRGINLLEYDRAELYS--SDHRPV 789          
BLAST of SMED30035039 vs. TrEMBL
Match: T1EM86 (SAC domain-containing protein OS=Helobdella robusta OX=6412 GN=20197686 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.188e-7
Identity = 87/361 (24.10%), Postives = 144/361 (39.89%), Query Frame = 3
Query:  156 VSGIQISFITWNVKDNKRFST------YTKDIVLKLLNLQNTKNM------------PDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESM-YCLSTGSMHGTTFMLILIKSPLQ--VSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVG--NIKYRQKAFYEILNKLDSKC-------DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPS-FKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVL---------SDHIPVYA 1118
            ++ ++IS  TWNV   K F +         D +L L  L N  N              DI+AI F+E  +D              N++ + T    ++   +   + N+   M Y + T +      + + I+  L   + N+   T+ +G      NK  G   +   I+N  +CF   H   G  N++ R   F ++ +K+           D  F+ GDFN R +     V ++    KN + L   + +D+L+                Q+   Q  + FN+ P+ F PTY  +    CDD+    E  R P+WTDR++ W +      E + V S  ++         SDH PV A
Sbjct:  536 LASVRISVGTWNVNGGKHFRSIAFKHELVTDWLLDLPTLTNQNNPGMLQADVDYSKPSDIFAIGFEE-IVDLNAG----------NIVNASTQNQKDW---ALYLQNNLSRDMKYIILTSAQLVGVCLFVFIRPSLAPYIKNLSVSTVKTGLGGAAGNK--GAVGIRFQIHNSSVCFVCSHFAAGQSNVRERNSDFQDVCSKISFPMGRHVWNHDHIFWCGDFNYRIDLMKDEVKNHV-AQKNWSLL---QASDQLN---------------VQRSAGQVFKGFNEGPTNFAPTYKYD--LFCDDYDTS-EKCRVPAWTDRVM-WASRNYPGKEGTHVASSRLILYNRSELKTSDHRPVMA 857          
BLAST of SMED30035039 vs. TrEMBL
Match: A0A1V6PB60 (IPPc domain-containing protein OS=Penicillium decumbens OX=69771 GN=PENDEC_c011G05253 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.355e-7
Identity = 89/358 (24.86%), Postives = 136/358 (37.99%), Query Frame = 3
Query:  153 KVSGIQISFITWNVKDNKRFSTYTKDIVLKLLNLQNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETG------TVYEFLSISATRETNMC----ESMYCLSTGSMHGT-TFMLILIKSPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGNIK--YRQKAFYEIL--------NKLDSKCD---------------VTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPVYA 1118
            K   I+ + +TWN   +   S  T D +   +  +N    PDI    FQE  +D    ++   SL  +   K E G        Y   +   TR  + C    ES   L T +M G  T + +  K    + +I    +  G      NK  G  V    +++  +CF   HL  G  +  +R      IL        N L ++ D               + F  GD N R +  S P     D  + Q  L+++   D+L  S+  + G  L ++I   +            +F PTY  +   D  D     +  R P+W DR++Y  A +V+  EY      A  SDH PV A
Sbjct:  804 KFREIRTAVVTWNAGASTPGSLRTSDFIRDAVQPENP---PDIVVFGFQE-LVDLENKKITAKSL-LLGSKKKENGEKEHMSRQYRVWADHLTRSLHECMPLEESYVLLHTANMVGLFTCIFVKHKERHNIKSIHASEVKRGMGGLHGNK--GALVFRFVLDDSSMCFVNCHLAAGQTQTAHRNNDIAAILEADILPPENSLVARTDQYASGGDGSMIMDHEICFLNGDLNYRID--SIPRNVIIDAVR-QNNLSKLLDRDQLLASRRKNPGFRLRSFIEAPI------------TFAPTYKYDVGTDQYD---SSDKKRSPAWCDRVLYRGAGRVKQLEYRRHEVRA--SDHRPVSA 1134          
BLAST of SMED30035039 vs. Ensembl Yeast
Match: INP52 (Polyphosphatidylinositol phosphatase; dephosphorylates a number of phosphatidylinositol phosphates (PtdInsPs, PIPs) to PI; involved in endocytosis; hyperosmotic stress causes translocation to actin patches; synaptojanin-like protein with a Sac1 domain; INP52 has a paralog, INP53, that arose from the whole genome duplication [Source:SGD;Acc:S000005050])

HSP 1 Score: 50.447 bits (119), Expect = 4.550e-7
Identity = 59/210 (28.10%), Postives = 85/210 (40.48%), Query Frame = 3
Query:  573 KGITVVGLYINNEKLCFGGLHLDVG--NIKYRQKAFYEIL-------NKLDSKCDVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPVYANCQTV*MRFFSSNMRMNLI 1175
            KG   +         CF   HL  G  NI  R+  +  I        +K     D  F+ GD N R    +  V       K+  Y++ +   D+L+  Q  + GV         + + F EP   +  F+PTY  +   D  D     E  R PSWTDRIIY     +    YS  P    +SDH PVYA  +   ++F     ++NL+
Sbjct:  710 KGAVAIRFDYGATSFCFVNTHLSAGASNIDERRNDYNNIYRNITFPRSKTIPHHDSLFWLGDLNYRITLTNDEVRRELRAQKD-GYIDRLLQYDQLT--QEINEGV---------VFQGFKEP---TLQFRPTYKYDYGTDNYD---TSEKARTPSWTDRIIY-KGENLHPLAYSDAP--LKISDHKPVYAAYRAN-VKFVDEKEKLNLV 897          
BLAST of SMED30035039 vs. Ensembl Yeast
Match: INP53 (Polyphosphatidylinositol phosphatase; dephosphorylates multiple phosphatidylinositol phosphates; involved in trans Golgi network-to-early endosome pathway; hyperosmotic stress causes translocation to actin patches; contains Sac1 and 5-ptase domains; INP53 has a paralog, INP52, that arose from the whole genome duplication [Source:SGD;Acc:S000005635])

HSP 1 Score: 50.0618 bits (118), Expect = 4.573e-7
Identity = 58/209 (27.75%), Postives = 86/209 (41.15%), Query Frame = 3
Query:  573 KGITVVGLYINNEKLCFGGLHLDVG--NIKYRQKAFYEILN-------KLDSKCDVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPVYANCQTV*MRFFSSNMRMNL 1172
            KG   +         CF   HL  G  N++ R+  +  I+        K+    D  F+ GD N R N  +  V       + +    E    D+L      + G+N     +  + + F EP  K   F+PTY  +      D     E +R PSWTDRIIY   + +  S YS  P   ++SDH PVYA  +   + F     R++L
Sbjct:  685 KGAVSIRFEYGATSFCFVNSHLAAGATNVEERRSDYESIVRGITFTRTKMIPHHDSIFWLGDMNYRINLPNEDV-------RRELLNQEEGYIDKLLHFDQLTLGIN-----SGSVFEGFKEPTLK---FRPTYKYDPGTGTYD---SSEKERTPSWTDRIIYKGENLLPLS-YSDAP--IMISDHRPVYAAYRAK-ITFVDDKERLSL 871          
BLAST of SMED30035039 vs. Ensembl Nematostella
Match: EDO32085 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW33])

HSP 1 Score: 64.3142 bits (155), Expect = 3.919e-11
Identity = 65/227 (28.63%), Postives = 97/227 (42.73%), Query Frame = 3
Query:  477 FMLILIKSPL--QVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGNIKY--RQKAFYEILNKLD----------SKCDVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSP-SFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPV 1112
            F+L+  K+     + ++  E + +G      NK  G   + +  +N  LCF   HL     +Y  R + + +IL+KL+             DVTF+ GD N R N +        D G+    L E+   D+L               I QK  K+    F++ P +F+PTY  +   D  D     E  R P+W DR++Y     V+   Y   PSL V SDH PV
Sbjct:  103 FLLVYTKTLHMPHIKDVAAEYVATGIMGMMGNK--GGVAIRMSFHNSTLCFVNSHLAAHQEEYERRNQDYRDILSKLNFTRVSEVLTILDHDVTFWLGDLNYRVNMECELSKGLIDQGR----LEELLKCDQL---------------IKQKEVKKCFSGFHEPPITFRPTYKYDPGTDNWD---SSEKGRAPAWCDRVLY-RGHGVKQIAYRSHPSLKV-SDHKPV 303          
BLAST of SMED30035039 vs. Planmine SMEST
Match: SMESG000057944.1 (SMESG000057944.1)

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 338/342 (98.83%), Postives = 342/342 (100.00%), Query Frame = 3
Query:  108 MNQLLIAVLIGNLILKVSGIQISFITWNVKDNKRFSTYTKDIVLKLLNLQNTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGNIKYRQKAFYEILNKLDSKCDVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPVYANCQTV 1133
            MNQLLIAVLIGNLILKVSGIQISFITWNVKDNKRFSTYTKDIVLKLLNLQNTKNMPD+YAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGNIKYRQKAFYEILNKLDSKCDVTFFGGDFNTRPNGKSHPVPSYF+GGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSF+CDDFPVCYEPDRFPSWTDRIIYWPASKV+CSEYSIVPSLAVLSDHIPVYANCQTV
Sbjct:    1 MNQLLIAVLIGNLILKVSGIQISFITWNVKDNKRFSTYTKDIVLKLLNLQNTKNMPDLYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQVSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVGNIKYRQKAFYEILNKLDSKCDVTFFGGDFNTRPNGKSHPVPSYFEGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFNCDDFPVCYEPDRFPSWTDRIIYWPASKVKCSEYSIVPSLAVLSDHIPVYANCQTV 342          
BLAST of SMED30035039 vs. Planmine SMEST
Match: SMESG000043682.1 (SMESG000043682.1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.403e-7
Identity = 76/300 (25.33%), Postives = 122/300 (40.67%), Query Frame = 3
Query:  276 DIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSISATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQ--VSNIFQETINSGSNSFFSNKEKGITVVGLYINNEKLCFGGLHLDVG--NIKYRQKAFYEILNKL------DSKC-DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSGGVNLLTYIAQKMGKQFIEPFNK-SPSFKPTYSIESSFDCDDFPVCYEPDRFPSWTDRIIYWPASKVQCSEY-----SIVPSLAVL--SDHIPVYA 1118
            DIYAI FQE  ID   S          N++ +++G   ++ +      + + + +  LS+  + G   + + IK+ L   ++ +   ++ +G      NK  G   V   + N   C+   H   G  N+K R   + +I+ +L         C D  F+ GDFN R +           G  +  YL   +   +L  +   +          QK        FN+    F PTY  +    CDD+    E  R P+WTDRI+ W  +    SEY      ++ + A L  SDH PV A
Sbjct:  592 DIYAIGFQE-IIDLTAS----------NIVNAKSGNQQQWAAFLLENISRLADYV-LLSSIQLVGIC-LFVFIKASLAPFITEVSTSSVKTGFKGTAGNK--GAVGVRFQLFNSSFCYVCSHFAAGQSNVKERNDDYEDIVRQLKFSRDRSIDCHDFIFWCGDFNYRIDL----------GNADVKYLIANREWGQLEQADQLA---------VQKRNGHVFRGFNEGQKRFAPTYKYD--LFCDDYDTS-EKCRVPAWTDRIL-WKVNMPTNSEYGPLCQQLIYNRAELKTSDHRPVAA 853          
The following BLAST results are available for this feature:
BLAST of SMED30035039 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SYNJ17.512e-623.15synaptojanin 1 [Source:HGNC Symbol;Acc:HGNC:11503][more]
back to top
BLAST of SMED30035039 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stmn31.169e-623.91stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431][more]
stmn31.182e-623.91stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431][more]
stmn32.879e-623.91stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431][more]
stmn35.337e-623.93stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431][more]
stmn35.637e-623.93stathmin 3 [Source:Xenbase;Acc:XB-GENE-5918431][more]
back to top
BLAST of SMED30035039 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Synj23.145e-622.64synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671][more]
Synj23.719e-623.90synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671][more]
Synj24.564e-623.90synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671][more]
Synj24.781e-623.90synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671][more]
Synj24.802e-623.90synaptojanin 2 [Source:MGI Symbol;Acc:MGI:1201671][more]
back to top
BLAST of SMED30035039 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S3NZN91.207e-1028.34Inositol polyphosphate 5-phosphatase K-like protei... [more]
A0A0K8TNT23.239e-824.85Putative inositol-145-triphosphate 5-phosphatase s... [more]
A0A507C2137.992e-824.22SAC domain-containing protein OS=Synchytrium micro... [more]
T1EM861.188e-724.10SAC domain-containing protein OS=Helobdella robust... [more]
A0A1V6PB601.355e-724.86IPPc domain-containing protein OS=Penicillium decu... [more]
back to top
BLAST of SMED30035039 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
INP524.550e-728.10Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
INP534.573e-727.75Polyphosphatidylinositol phosphatase; dephosphoryl... [more]
back to top
BLAST of SMED30035039 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO320853.919e-1128.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30035039 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30035039 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000057944.10.000e+098.83SMESG000057944.1[more]
SMESG000043682.13.403e-725.33SMESG000043682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035039 ID=SMED30035039|Name=SMED30035039|organism=Schmidtea mediterranea sexual|type=transcript|length=1273bp
CAATATTTACATGTATAATTATCGACTAATTGAAATGTATAATGGACATT
TGTTTACTAATCTTCGTCATTTAATGGTGTGTTAAAAATAAATTTATCAA
ATTAAACATGAATCAATTGTTGATTGCGGTACTAATAGGAAATTTAATTT
TAAAAGTTAGCGGAATTCAAATTTCGTTTATTACTTGGAATGTGAAAGAT
AACAAAAGATTTTCTACTTATACTAAAGACATTGTATTGAAGTTGTTGAA
TTTACAGAATACAAAGAACATGCCGGATATATATGCAATAACGTTCCAAG
AAAATTGCATAGATTGTGGAGAAAGTCGCCTAGAAAGATTATCGTTGCCA
TTTATTAATGTATTGAAATCTGAAACTGGTACTGTTTATGAGTTTTTATC
AATATCTGCTACTAGGGAAACCAATATGTGTGAATCTATGTATTGTCTAT
CTACTGGCAGTATGCATGGCACCACATTTATGTTGATCCTCATCAAATCC
CCGTTACAAGTATCAAATATATTCCAGGAAACTATTAACAGTGGTTCCAA
TTCATTTTTTTCGAACAAAGAGAAAGGAATAACTGTTGTTGGATTGTATA
TAAATAACGAAAAGCTCTGTTTTGGTGGATTACATTTGGATGTTGGCAAT
ATTAAATATCGACAAAAGGCTTTCTATGAAATTCTAAACAAGTTAGACTC
GAAATGCGATGTTACATTTTTTGGTGGGGATTTCAATACTCGCCCAAATG
GCAAGTCTCATCCTGTGCCAAGCTATTTTGATGGGGGTAAAAATCAAACT
TATCTCAATGAAATGAAAGTGACAGATGAATTATCCGGATCTCAACCGTT
CAGTGGCGGAGTGAATTTATTGACATATATCGCTCAGAAAATGGGAAAAC
AATTTATTGAGCCTTTCAATAAATCTCCCAGCTTTAAGCCGACATATTCA
ATCGAGTCTTCTTTTGATTGTGATGATTTTCCAGTTTGTTACGAACCAGA
TAGATTTCCTTCGTGGACCGATAGAATAATTTATTGGCCAGCTTCCAAAG
TCCAATGCAGTGAATATTCAATCGTTCCATCGCTGGCTGTGCTGAGTGAT
CACATTCCAGTCTACGCTAATTGTCAGACGGTTTAGATGAGGTTTTTTTC
CAGTAATATGCGAATGAATTTAATCAATATTGTCATTTTGTAATTTCCAC
GTCCCTCGATAAAAAGTTAAGATAGAATAAATTTTCAACAGTAAAAAAAA
GTTATTTGTAAATTAAAACCGAC
back to top

protein sequence of SMED30035039-orf-1

>SMED30035039-orf-1 ID=SMED30035039-orf-1|Name=SMED30035039-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MNQLLIAVLIGNLILKVSGIQISFITWNVKDNKRFSTYTKDIVLKLLNLQ
NTKNMPDIYAITFQENCIDCGESRLERLSLPFINVLKSETGTVYEFLSIS
ATRETNMCESMYCLSTGSMHGTTFMLILIKSPLQVSNIFQETINSGSNSF
FSNKEKGITVVGLYINNEKLCFGGLHLDVGNIKYRQKAFYEILNKLDSKC
DVTFFGGDFNTRPNGKSHPVPSYFDGGKNQTYLNEMKVTDELSGSQPFSG
GVNLLTYIAQKMGKQFIEPFNKSPSFKPTYSIESSFDCDDFPVCYEPDRF
PSWTDRIIYWPASKVQCSEYSIVPSLAVLSDHIPVYANCQTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036691Endo/exonu/phosph_ase_sf
IPR000300IPPc
IPR005135Endo/exonuclease/phosphatase
Vocabulary: biological process
TermDefinition
GO:0046856phosphatidylinositol dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004439phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000300Inositol polyphosphate-related phosphataseSMARTSM00128i5p_5coord: 18..338
e-value: 1.1E-4
score: -56.9
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 2..342
e-value: 2.5E-29
score: 104.2
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 17..338
NoneNo IPR availablePANTHERPTHR11200INOSITOL 5-PHOSPHATASEcoord: 20..338
NoneNo IPR availablePANTHERPTHR11200:SF185EG:86E4.5 PROTEINcoord: 20..338
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.778
NoneNo IPR availableTMHMMTMhelixcoord: 5..27