Ubiquitin-like domain-containing protein

Overview
NameUbiquitin-like domain-containing protein
Smed IDSMED30035037
Length (bp)499
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-like domain-containing protein (SMED30035037) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-like domain-containing protein (SMED30035037) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: RPS27A (ribosomal protein S27a [Source:HGNC Symbol;Acc:HGNC:10417])

HSP 1 Score: 86.6557 bits (213), Expect = 1.499e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: RPS27A (ribosomal protein S27a [Source:HGNC Symbol;Acc:HGNC:10417])

HSP 1 Score: 86.6557 bits (213), Expect = 1.499e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: RPS27A (ribosomal protein S27a [Source:HGNC Symbol;Acc:HGNC:10417])

HSP 1 Score: 86.6557 bits (213), Expect = 1.499e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: AL136454.1 (novel protein similar to ribosomal protein S27a RPS27A)

HSP 1 Score: 81.2629 bits (199), Expect = 1.797e-19
Identity = 63/147 (42.86%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFT--VELSQ-LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T  VELS  + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTP+K  H  K   LA+LK Y +D++G ++ L  ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLMGKTITLEVELSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPRKNKHKRKKVKLALLKYYKVDENGKISCLHRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Match: AL136454.1 (novel protein similar to ribosomal protein S27a RPS27A)

HSP 1 Score: 81.2629 bits (199), Expect = 1.797e-19
Identity = 63/147 (42.86%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFT--VELSQ-LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T  VELS  + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTP+K  H  K   LA+LK Y +D++G ++ L  ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLMGKTITLEVELSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPRKNKHKRKKVKLALLKYYKVDENGKISCLHRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Celegans
Match: ubl-1 (Ubiquitin-like protein 1-40S ribosomal protein S27a Ubiquitin-like protein 1 40S ribosomal protein S27a [Source:UniProtKB/Swiss-Prot;Acc:P37165])

HSP 1 Score: 81.6481 bits (200), Expect = 6.669e-20
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:   31 IFVKYLDKIFTVELS---QLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREEC--PECGPGIFLAEHADRRHCGKCSFTVFKD 459
            +FVK L +   +E++    + +I + IE+   +  +EQ++ Y GR + D        I +E TI V   L GG  KRKKK +TTPKK     K   LA+LK Y ID++G +T+LR+EC  P CG G+F+A+HA+R +CG+C  T+  D
Sbjct:    2 VFVKTLHRTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAGRQLEDSDC----GIDSEATIYVNLELLGGAKKRKKKVYTTPKKNKRKPKKVKLAVLKYYKIDENGKITRLRKECQQPSCGGGVFMAQHANRHYCGRCHDTLVVD 145          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Celegans
Match: ubl-1 (Ubiquitin-like protein 1-40S ribosomal protein S27a Ubiquitin-like protein 1 40S ribosomal protein S27a [Source:UniProtKB/Swiss-Prot;Acc:P37165])

HSP 1 Score: 81.6481 bits (200), Expect = 6.669e-20
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:   31 IFVKYLDKIFTVELS---QLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREEC--PECGPGIFLAEHADRRHCGKCSFTVFKD 459
            +FVK L +   +E++    + +I + IE+   +  +EQ++ Y GR + D        I +E TI V   L GG  KRKKK +TTPKK     K   LA+LK Y ID++G +T+LR+EC  P CG G+F+A+HA+R +CG+C  T+  D
Sbjct:    2 VFVKTLHRTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAGRQLEDSDC----GIDSEATIYVNLELLGGAKKRKKKVYTTPKKNKRKPKKVKLAVLKYYKIDENGKITRLRKECQQPSCGGGVFMAQHANRHYCGRCHDTLVVD 145          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Celegans
Match: ubl-1 (Ubiquitin-like protein 1-40S ribosomal protein S27a Ubiquitin-like protein 1 40S ribosomal protein S27a [Source:UniProtKB/Swiss-Prot;Acc:P37165])

HSP 1 Score: 81.6481 bits (200), Expect = 6.669e-20
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:   31 IFVKYLDKIFTVELS---QLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREEC--PECGPGIFLAEHADRRHCGKCSFTVFKD 459
            +FVK L +   +E++    + +I + IE+   +  +EQ++ Y GR + D        I +E TI V   L GG  KRKKK +TTPKK     K   LA+LK Y ID++G +T+LR+EC  P CG G+F+A+HA+R +CG+C  T+  D
Sbjct:    2 VFVKTLHRTLFLEVAANEDVLSIKQKIEAAEGIPAEEQRLCYAGRQLEDSDC----GIDSEATIYVNLELLGGAKKRKKKVYTTPKKNKRKPKKVKLAVLKYYKIDENGKITRLRKECQQPSCGGGVFMAQHANRHYCGRCHDTLVVD 145          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Fly
Match: RpS27A (gene:FBgn0003942 transcript:FBtr0080016)

HSP 1 Score: 85.5001 bits (210), Expect = 2.213e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKKN++TPKKI H  K   LA+LK Y +D++G + +LR ECP   CG G+F+A H DR +CGKC+ T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRECPGENCGAGVFMAAHEDRHYCGKCNLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Zebrafish
Match: rps27a (ribosomal protein S27a [Source:ZFIN;Acc:ZDB-GENE-030131-10018])

HSP 1 Score: 85.5001 bits (210), Expect = 3.134e-21
Identity = 62/147 (42.18%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G + +LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Zebrafish
Match: rps27a (ribosomal protein S27a [Source:ZFIN;Acc:ZDB-GENE-030131-10018])

HSP 1 Score: 85.5001 bits (210), Expect = 3.134e-21
Identity = 62/147 (42.18%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G + +LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Zebrafish
Match: rps27a (ribosomal protein S27a [Source:ZFIN;Acc:ZDB-GENE-030131-10018])

HSP 1 Score: 85.5001 bits (210), Expect = 3.134e-21
Identity = 62/147 (42.18%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G + +LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:548926])

HSP 1 Score: 86.6557 bits (213), Expect = 1.358e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Xenopus
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:548926])

HSP 1 Score: 80.1073 bits (196), Expect = 3.724e-19
Identity = 51/108 (47.22%), Postives = 73/108 (67.59%), Query Frame = 1
Query:  130 EQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:   33 QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 140          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Rps27a (ribosomal protein S27A [Source:MGI Symbol;Acc:MGI:1925544])

HSP 1 Score: 85.5001 bits (210), Expect = 3.456e-21
Identity = 61/147 (41.50%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+  H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Match: Rps27a (ribosomal protein S27A [Source:MGI Symbol;Acc:MGI:1925544])

HSP 1 Score: 85.5001 bits (210), Expect = 3.456e-21
Identity = 61/147 (41.50%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+  H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMGSHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P69061|RS27A_KLULA (Ubiquitin-40S ribosomal protein S27a OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ubi3 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 9.135e-24
Identity = 66/145 (45.52%), Postives = 89/145 (61.38%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECPECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK +TTPKKI H HK   LA+L  Y +D +G + KLR+ECP CGPGIFLA H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIRHKHKKVKLAVLNYYKVDDEGKVAKLRKECPNCGPGIFLANHGDRFYCGKCHST 145          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P59271|R27AA_ARATH (Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidopsis thaliana OX=3702 GN=RPS27AA PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 1.412e-23
Identity = 64/151 (42.38%), Postives = 90/151 (59.60%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT-VFK 456
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK +T PKKI H HK   LA+L+ Y +D  G + +L++ECP   CGPG F+A H DR +CGKC  T VFK
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHTHKKVKLAVLQFYKVDGSGKVQRLKKECPSVSCGPGTFMASHFDRHYCGKCGTTYVFK 151          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P79781|RS27A_CHICK (Ubiquitin-40S ribosomal protein S27a OS=Gallus gallus OX=9031 GN=RPS27A PE=2 SV=3)

HSP 1 Score: 86.6557 bits (213), Expect = 6.821e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSEECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P62979|RS27A_HUMAN (Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 7.197e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P62978|RS27A_CAVPO (Ubiquitin-40S ribosomal protein S27a OS=Cavia porcellus OX=10141 GN=RPS27A PE=1 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 7.197e-21
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +++LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A507DVW0 (Ubiquitin-like domain-containing protein OS=Powellomyces hirtus OX=109895 GN=PhCBS80983_g04943 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.860e-23
Identity = 66/147 (44.90%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECPE--CGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK +TTPKKI H HK   LA+LK Y +D DG +T+LR ECP   CG GIF+A H DR++CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYTTPKKIRHKHKKVKLAVLKYYKVDDDGKITRLRRECPNETCGAGIFMAMHFDRQYCGKCGLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A507EDP5 (Ubiquitin-like domain-containing protein OS=Powellomyces hirtus OX=109895 GN=PhCBS80983_g00453 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.986e-23
Identity = 66/147 (44.90%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECPE--CGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK +TTPKKI H HK   LA+LK Y +D DG +T+LR ECP   CG GIF+A H DR++CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKTYTTPKKIRHKHKKVKLAVLKYYKVDDDGKITRLRRECPNETCGAGIFMAMHFDRQYCGKCGLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A1K0H796 (Probable ubiquitin/ribosomal protein S27a fusion protein OS=Ustilago bromivora OX=307758 GN=UBRO_06600 PE=4 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 5.397e-23
Identity = 63/149 (42.28%), Postives = 91/149 (61.07%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREEC--PECGPGIFLAEHADRRHCGKCSFTVF 453
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TLL  NI  E T+ +  RL GG  KRKKK +TTPK+I H  K   ++ILK Y +D DGN+ +LR EC  PECG GIF++ H +R++CGKC  T  
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKRIPHKRKKVKMSILKYYKVDGDGNIKRLRRECPSPECGAGIFMSWHKNRQYCGKCKLTFM 149          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A0U2V515 (40S ribosomal protein S27a OS=Acartia pacifica OX=335913 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.558e-22
Identity = 63/147 (42.86%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKK+N+TTPKKI H H+   LA+LK Y +D +G + +LR ECP  ECG G+F+A H DR+ CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKENYTTPKKIKHKHRKVKLAVLKYYKVDDNGKINRLRRECPSEECGAGVFMAAHFDRQTCGKCGLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Match: A0A3G2S3X0 (40S ribosomal protein S27a OS=Malassezia restricta CBS 7877 OX=425264 GN=RPS27A PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.593e-22
Identity = 63/149 (42.28%), Postives = 91/149 (61.07%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREEC--PECGPGIFLAEHADRRHCGKCSFTVF 453
            M +FVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK +TTPKKI H H+   +A LK Y I+ DG++ +LR EC  PECGPGIF+A H +R++CGKC  T  
Sbjct:    1 MQVFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKVYTTPKKIKHKHRKVKMATLKYYRINDDGSVKQLRRECPSPECGPGIFMAWHHNRQYCGKCHLTYL 149          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Cavefish
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:103044043])

HSP 1 Score: 85.5001 bits (210), Expect = 2.656e-21
Identity = 62/147 (42.18%), Postives = 89/147 (60.54%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G + +LR ECP  ECG G+F+A H DR +CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007011.1 (pep scaffold:Pmarinus_7.0:GL484716:14406:16135:-1 gene:ENSPMAG00000006335.1 transcript:ENSPMAT00000007011.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 1.446e-19
Identity = 51/108 (47.22%), Postives = 73/108 (67.59%), Query Frame = 1
Query:  130 EQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            +Q+ ++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G +T+LR ECP  ECG G+F+A H +R++CGKC  T
Sbjct:    5 DQQRIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKITRLRRECPSEECGAGVFMANHFNRQYCGKCCLT 112          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Yeast
Match: RPS31 (Fusion protein cleaved to yield ribosomal protein S31 and ubiquitin; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes; interacts genetically with translation factor eIF2B; homologous to mammalian ribosomal protein S27A, no bacterial homolog [Source:SGD;Acc:S000004157])

HSP 1 Score: 75.0998 bits (183), Expect = 2.638e-18
Identity = 66/150 (44.00%), Postives = 91/150 (60.67%), Query Frame = 1
Query:   25 MAIFVKYLD-KIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREEC--PECGPGIFLAEHADRRHCGKCSFTVFK 456
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK +TTPKKI H HK   LA+L  Y +D +G +TKLR EC  P CG G+FLA H DR +CGKC  +V+K
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAVLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKC-HSVYK 149          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Nematostella
Match: EDO48503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ25])

HSP 1 Score: 77.411 bits (189), Expect = 1.101e-18
Identity = 64/147 (43.54%), Postives = 91/147 (61.90%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKKN+TTPKKI H  K   LA+LK Y +D++G +T+LR ECP   CG G+F+A H DR++CGKC  T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKNYTTPKKIKHKKKKVKLAVLKYYKVDENGKITRLRRECPSESCGAGVFMASHFDRQYCGKCCLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Medaka
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:101164670])

HSP 1 Score: 87.0409 bits (214), Expect = 4.902e-22
Identity = 62/147 (42.18%), Postives = 90/147 (61.22%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y +D++G + +LR ECP  ECG G+F+A H DR +CGKC+ T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCTLT 147          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Medaka
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:101164670])

HSP 1 Score: 74.3294 bits (181), Expect = 6.988e-17
Identity = 62/171 (36.26%), Postives = 90/171 (52.63%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVEL---SQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSY------------------------SIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y                         +D++G + +LR ECP  ECG G+F+A H DR +CGKC+ T
Sbjct:    1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVWLEPAAAEPGSVSASGLTSVVLQVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCTLT 171          
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Medaka
Match: rps27a (ribosomal protein S27a [Source:NCBI gene;Acc:101164670])

HSP 1 Score: 67.781 bits (164), Expect = 3.352e-14
Identity = 51/132 (38.64%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  130 EQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSY------------------------SIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFT 447
            +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKK++TTPKK  H  K   LA+LK Y                         +D++G + +LR ECP  ECG G+F+A H DR +CGKC+ T
Sbjct:   55 QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVWLEPAAAEPGSVSASGLTSVVLQVDENGKIHRLRRECPADECGAGVFMASHFDRHYCGKCTLT 186          
BLAST of Ubiquitin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067884.1 (SMESG000067884.1)

HSP 1 Score: 271.166 bits (692), Expect = 1.183e-94
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 1
Query:   25 MAIFVKYLDKIFTVELSQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECPECGPGIFLAEHADRRHCGKCSFTVFKDQRNIST 477
            MAIFVKYLDKIFTVELSQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGKNKRKKKNFTTPKKIAHVHKSQPLAILKSYSIDKDGNLTKLREECPECGPGIFLAEHADRRHCGKCSFTVFKDQRNIST
Sbjct:    1 MAIFVKYLDKIFTVELSQLCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGKNKRKKKNFTTPKKIAHVHKSQPLAILKSYSIDKDGNLTKLREECPECGPGIFLAEHADRRHCGKCSFTVFKDQRNIST 151          
BLAST of Ubiquitin-like domain-containing protein vs. Planmine SMEST
Match: SMESG000048830.1 (SMESG000048830.1)

HSP 1 Score: 68.9366 bits (167), Expect = 4.098e-15
Identity = 64/153 (41.83%), Postives = 92/153 (60.13%), Query Frame = 1
Query:   25 MAIFVKYL-DKIFTVELSQ---LCNISEIIESVCNLRKQEQKIVYQGRLITDVKTLLSENICNEDTIEVFERLCGGXXXXXXXXXXXXXXIAHVHKSQPLAILKSYSIDKDGNLTKLREECP--ECGPGIFLAEHADRRHCGKCSFTVFKDQR 465
            M IFVK L  K  T+E+     + N+   I+    +   +Q++++ G+ + D +TL   NI  E T+ +  RL GG  KRKKKN+TTPKKI H  K   LA+LK Y +D +G + +LR+ECP   CGPG+F+A H DR++CGKC  T     +
Sbjct:    1 MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKNYTTPKKIKHKKKKVKLAVLKYYKVDSNGKIQRLRKECPNESCGPGVFMAAHFDRQYCGKCCLTYMHSNK 153          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS27A1.499e-2142.18ribosomal protein S27a [Source:HGNC Symbol;Acc:HGN... [more]
RPS27A1.499e-2142.18ribosomal protein S27a [Source:HGNC Symbol;Acc:HGN... [more]
RPS27A1.499e-2142.18ribosomal protein S27a [Source:HGNC Symbol;Acc:HGN... [more]
AL136454.11.797e-1942.86novel protein similar to ribosomal protein S27a RP... [more]
AL136454.11.797e-1942.86novel protein similar to ribosomal protein S27a RP... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ubl-16.669e-2040.54Ubiquitin-like protein 1-40S ribosomal protein S27... [more]
ubl-16.669e-2040.54Ubiquitin-like protein 1-40S ribosomal protein S27... [more]
ubl-16.669e-2040.54Ubiquitin-like protein 1-40S ribosomal protein S27... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
RpS27A2.213e-2142.18gene:FBgn0003942 transcript:FBtr0080016[more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rps27a3.134e-2142.18ribosomal protein S27a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rps27a3.134e-2142.18ribosomal protein S27a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
rps27a3.134e-2142.18ribosomal protein S27a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps27a1.358e-2142.18ribosomal protein S27a [Source:NCBI gene;Acc:54892... [more]
rps27a3.724e-1947.22ribosomal protein S27a [Source:NCBI gene;Acc:54892... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rps27a3.456e-2141.50ribosomal protein S27A [Source:MGI Symbol;Acc:MGI:... [more]
Rps27a3.456e-2141.50ribosomal protein S27A [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P69061|RS27A_KLULA9.135e-2445.52Ubiquitin-40S ribosomal protein S27a OS=Kluyveromy... [more]
sp|P59271|R27AA_ARATH1.412e-2342.38Ubiquitin-40S ribosomal protein S27a-1 OS=Arabidop... [more]
sp|P79781|RS27A_CHICK6.821e-2142.18Ubiquitin-40S ribosomal protein S27a OS=Gallus gal... [more]
sp|P62979|RS27A_HUMAN7.197e-2142.18Ubiquitin-40S ribosomal protein S27a OS=Homo sapie... [more]
sp|P62978|RS27A_CAVPO7.197e-2142.18Ubiquitin-40S ribosomal protein S27a OS=Cavia porc... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A507DVW02.860e-2344.90Ubiquitin-like domain-containing protein OS=Powell... [more]
A0A507EDP52.986e-2344.90Ubiquitin-like domain-containing protein OS=Powell... [more]
A0A1K0H7965.397e-2342.28Probable ubiquitin/ribosomal protein S27a fusion p... [more]
A0A0U2V5152.558e-2242.8640S ribosomal protein S27a OS=Acartia pacifica OX=... [more]
A0A3G2S3X02.593e-2242.2840S ribosomal protein S27a OS=Malassezia restricta... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps27a2.656e-2142.18ribosomal protein S27a [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007011.11.446e-1947.22pep scaffold:Pmarinus_7.0:GL484716:14406:16135:-1 ... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPS312.638e-1844.00Fusion protein cleaved to yield ribosomal protein ... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO485031.101e-1843.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rps27a4.902e-2242.18ribosomal protein S27a [Source:NCBI gene;Acc:10116... [more]
rps27a6.988e-1736.26ribosomal protein S27a [Source:NCBI gene;Acc:10116... [more]
rps27a3.352e-1438.64ribosomal protein S27a [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Ubiquitin-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000067884.11.183e-94100.00SMESG000067884.1[more]
SMESG000048830.14.098e-1541.83SMESG000048830.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035037 ID=SMED30035037|Name=Ubiquitin-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=499bp
TAATAAAAGTATTATTATTGAAAAATGGCAATTTTTGTAAAATATTTAGA
TAAAATTTTCACTGTTGAACTGTCCCAATTATGCAATATATCAGAAATTA
TTGAATCTGTTTGCAACCTTCGCAAGCAAGAACAGAAAATCGTCTACCAA
GGTCGACTGATTACTGACGTCAAAACGCTTCTGTCGGAAAATATCTGCAA
CGAGGATACCATTGAAGTGTTCGAGCGTTTGTGTGGTGGTAAAAATAAGC
GAAAAAAGAAGAATTTTACGACTCCTAAAAAGATTGCACATGTTCATAAA
AGTCAACCTTTAGCGATCTTGAAATCTTATTCAATAGACAAAGATGGAAA
TCTTACAAAATTGCGAGAAGAATGCCCAGAATGTGGTCCAGGGATTTTCC
TGGCTGAACACGCAGATAGAAGACATTGCGGAAAATGTTCCTTCACAGTT
TTCAAGGATCAAAGAAATATTTCTACTTAAATACTTTTTGAAGAAAAAA
back to top

protein sequence of SMED30035037-orf-1

>SMED30035037-orf-1 ID=SMED30035037-orf-1|Name=SMED30035037-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MAIFVKYLDKIFTVELSQLCNISEIIESVCNLRKQEQKIVYQGRLITDVK
TLLSENICNEDTIEVFERLCGGKNKRKKKNFTTPKKIAHVHKSQPLAILK
SYSIDKDGNLTKLREECPECGPGIFLAEHADRRHCGKCSFTVFKDQRNIS
T*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR038582S27a-like_sf
IPR002906Ribosomal_S27a
IPR000626Ubiquitin-like_dom
IPR011332Ribosomal_zn-bd
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0005634nucleus
GO:0005737cytoplasm
GO:0022627cytosolic small ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0000028ribosomal small subunit assembly
GO:0002109maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, LSU-rRNA,5S)
GO:0042254ribosome biogenesis
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0005515protein binding
GO:0031386protein tag
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002906Ribosomal protein S27aSMARTSM01402Ribosomal_S27_2coord: 98..141
e-value: 6.6E-20
score: 82.1
IPR002906Ribosomal protein S27aPFAMPF01599Ribosomal_S27coord: 98..141
e-value: 1.4E-18
score: 66.8
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 3..68
e-value: 1.0E-5
score: 25.2
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 1..72
score: 10.506
IPR038582S27a-like superfamilyGENE3DG3DSA:2.20.25.660coord: 75..148
e-value: 8.5E-29
score: 101.8
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..72
e-value: 2.2E-8
score: 36.0
NoneNo IPR availablePANTHERPTHR10666:SF328RIBOSOMAL PROTEIN S27Acoord: 1..143
NoneNo IPR availablePANTHERPTHR10666UBIQUITINcoord: 1..143
NoneNo IPR availableCDDcd17039Ubl_ubiquitin_likecoord: 3..66
e-value: 1.79579E-7
score: 43.739
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 1..92
IPR011332Zinc-binding ribosomal proteinSUPERFAMILYSSF57829Zn-binding ribosomal proteinscoord: 96..148