Doublecortin domain-containing protein

Overview
NameDoublecortin domain-containing protein
Smed IDSMED30035028
Length (bp)1400
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Doublecortin domain-containing protein (SMED30035028) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Doublecortin domain-containing protein (SMED30035028) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035028

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30035028SMESG000059704.1 SmedASXL_010687SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30035028SMESG000059704.1 dd_Smed_v4_20159_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30035028SMESG000059704.1 dd_Smed_v6_20159_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC2 (doublecortin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18141])

HSP 1 Score: 113.62 bits (283), Expect = 1.155e-26
Identity = 73/236 (30.93%), Postives = 124/236 (52.54%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTL 912
             VK+V ++RNGD F + RR V ++K++ +++ FL+++T  +    G +R+I+TP+TG +I+  D+IQ   NYVA    E  + + YL + +     KKR              P E      VN+ V   +  R  VS R +  +Q+   TI +  NGD    A  +++    L   D VL++V EK+ L  S  + RL+T++G+ +    +LE+ + Y+A+G + F    Y + L
Sbjct:   15 VVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVA-GGQEAFKKLNYLDIGE----IKKR--------------PMEV-----VNTEVKPVIHSRINVSARFRKPLQEPC-TIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITL-RSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELL 224          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC2C (doublecortin domain containing 2C [Source:HGNC Symbol;Acc:HGNC:32696])

HSP 1 Score: 94.3597 bits (233), Expect = 1.441e-20
Identity = 66/226 (29.20%), Postives = 112/226 (49.56%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF 885
             K + ++RNGD F   ++FV ++++  T++A LE LT  ++   G +R + TP  G ++   D +Q    YVA A  E+ + + Y+ ++  ++ AK R+   +        P    DI      +VPS  Q   ++S           + I +F NG  +     +++    L   D+VL  +GEKV  P    +R+LFTM+G  + D   L+DN  Y+A+G E F
Sbjct:   15 AKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLTEQVDVPFG-VRRLFTPTRGHRVLGLDALQAGGKYVA-AGRERFKELDYIHIVP-RKPAKIRKLKEI-------KPVVHCDI------NVPSKWQTYHRIS-----------RHINVFTNGRLFIPPAKIIIPKFSLSDWDIVLATIGEKV-FPLG-GVRKLFTMNGHLLGDSKDLQDNHFYVAVGLETF 211          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCDC2B (doublecortin domain containing 2B [Source:HGNC Symbol;Acc:HGNC:32576])

HSP 1 Score: 69.3218 bits (168), Expect = 3.445e-12
Identity = 59/231 (25.54%), Postives = 101/231 (43.72%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPP-----CESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF 885
             K V ++RNGD F    + V  +++  T +AFL ++TSA+      +R+++TP  G  +    +++    YVA A  E+   + YL    +    K  R      QG    PP     C+  I   + +  PS +                      +FRNGD  +    + L  +  +  + VLK++ EKV L  S  + +L T++G  +S   +L     Y+A+G + F
Sbjct:    8 AKRVVVYRNGDPFFPGSQLVVTQRRFPTMEAFLCEVTSAVQAPLA-VRALYTPCHGHPVTNLADLKNRGQYVA-AGFERFHKLHYLPHRGKDPGGKSCR-----LQG----PPVTRHLCDGAIGRQLPAGAPSYIH---------------------VFRNGDLVSPPFSLKLSQAASQDWETVLKLLTEKVKL-QSGAVCKLCTLEGLPLSAGKELVTGHYYVAVGEDEF 205          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 65.0846 bits (157), Expect = 8.068e-11
Identity = 70/315 (22.22%), Postives = 126/315 (40.00%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPFV-----------PCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQ 1107
             K V  +RNGD +     +  +  + R++DA L DLT +L+        +R I+T     KI + DE++   +YV  +S    + + Y + +                      P    ++ +  N   P ++        R   +   R K + I R+G +  +A+ V+L      S + VL  + E + L T + +++L+T+DG+ ++   D   D+  +IA G E F             C   +  P+   GPK            +PTP K   K+      S +P  S  +Q      ++++     KQ
Sbjct:   52 AKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVC-SSDNFFKKVEYTKNVN---------------------PNWSVNVKTSANMKAPQSLASSNSAQARENKDFV-RPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGV-VKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPK-----------ASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQ 331          
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 65.0846 bits (157), Expect = 8.068e-11
Identity = 70/315 (22.22%), Postives = 126/315 (40.00%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPFV-----------PCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQ 1107
             K V  +RNGD +     +  +  + R++DA L DLT +L+        +R I+T     KI + DE++   +YV  +S    + + Y + +                      P    ++ +  N   P ++        R   +   R K + I R+G +  +A+ V+L      S + VL  + E + L T + +++L+T+DG+ ++   D   D+  +IA G E F             C   +  P+   GPK            +PTP K   K+      S +P  S  +Q      ++++     KQ
Sbjct:   52 AKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVC-SSDNFFKKVEYTKNVN---------------------PNWSVNVKTSANMKAPQSLASSNSAQARENKDFV-RPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGV-VKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPK-----------ASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQ 331          
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Match: C06C3.3 (pep chromosome:WBcel235:II:9369178:9372485:-1 gene:WBGene00007374.1 transcript:C06C3.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06C3.3)

HSP 1 Score: 57.3806 bits (137), Expect = 1.224e-8
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASG 438
            F   + + RNGDMF   R  V  +KQ + W  FL+ LT  L   T  +R + T Q G  +  FD+++ N  YVA+ +G
Sbjct:   15 FPLRIRVFRNGDMFDHGRILVVTRKQFKHWIVFLDALTDLLRTATA-VRRLFTTQ-GIPVHHFDDLETNGEYVAVETG 90          

HSP 2 Score: 53.5286 bits (127), Expect = 2.157e-7
Identity = 28/83 (33.73%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  658 ICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQ 906
            I +FRNGD +     +++   + K   + L  + +  +L T+  +RRLFT  G  +   D LE N  Y+A+   PFV   YGQ
Sbjct:   19 IRVFRNGDMFDHGRILVVTRKQFKHWIVFLDALTD--LLRTATAVRRLFTTQGIPVHHFDDLETNGEYVAVETGPFVNVPYGQ 99          
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Match: rpi-1 (pep chromosome:WBcel235:II:13959239:13962417:-1 gene:WBGene00012332.1 transcript:W07G1.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rpi-1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.307e-8
Identity = 27/83 (32.53%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  658 ICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQ 906
            I I++NGD Y R +  ++    +K M+ +L  V +++ L  S   ++L+T DG+ ++   +LED K Y+A   + F+P  YG+
Sbjct:   37 ISIYKNGDRYHRGVKFVINPRVIKDMEPLLNQVNDRIEL--SHGAKKLYTTDGKIVNSIKELEDGKIYVAASAQ-FIPMRYGE 116          
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Match: rpi-1 (pep chromosome:WBcel235:II:13959239:13962417:-1 gene:WBGene00012332.1 transcript:W07G1.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rpi-1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.385e-8
Identity = 27/83 (32.53%), Postives = 49/83 (59.04%), Query Frame = 1
Query:  658 ICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQ 906
            I I++NGD Y R +  ++    +K M+ +L  V +++ L  S   ++L+T DG+ ++   +LED K Y+A   + F+P  YG+
Sbjct:   37 ISIYKNGDRYHRGVKFVINPRVIKDMEPLLNQVNDRIEL--SHGAKKLYTTDGKIVNSIKELEDGKIYVAASAQ-FIPMRYGE 116          
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Match: zyg-8 (Serine/threonine-protein kinase zyg-8 [Source:UniProtKB/Swiss-Prot;Acc:Q95QC4])

HSP 1 Score: 54.299 bits (129), Expect = 1.496e-7
Identity = 37/111 (33.33%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  589 STVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVIL-PTSLP--IRRLFTMDG-EAISDPDQLEDNKSYIALGHEPFVPCLYGQT 909
            S +QRR ++ G   Y    + K +  +RNGD+Y + I   L+   +KSM  +++ + + VI   T+LP  IR +FT+DG + I+  DQ ED   Y+    + F P  Y + 
Sbjct:  191 SEMQRRCRI-GPSGYPHLLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTALPHGIRHIFTIDGAQRITSVDQFEDGGGYVCSSTDAFKPVDYSRA 300          
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Match: zyg-8 (Serine/threonine-protein kinase zyg-8 [Source:UniProtKB/Swiss-Prot;Acc:Q95QC4])

HSP 1 Score: 53.1434 bits (126), Expect = 3.041e-7
Identity = 37/111 (33.33%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  589 STVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVIL-PTSLP--IRRLFTMDG-EAISDPDQLEDNKSYIALGHEPFVPCLYGQT 909
            S +QRR ++ G   Y    + K +  +RNGD+Y + I   L+   +KSM  +++ + + VI   T+LP  IR +FT+DG + I+  DQ ED   Y+    + F P  Y + 
Sbjct:   38 SEMQRRCRI-GPSGYPHLLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTALPHGIRHIFTIDGAQRITSVDQFEDGGGYVCSSTDAFKPVDYSRA 147          
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Match: dcdc2b (doublecortin domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-051113-124])

HSP 1 Score: 99.7525 bits (247), Expect = 3.108e-22
Identity = 69/241 (28.63%), Postives = 123/241 (51.04%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG 930
            VK+V ++RNGD F S RRFV N++Q+ T DA L D+T  +      +R+++TP+ G ++    ++Q  + YVA A  E+ + + YL       A  K+              P +S  ++            R  VS + + ++      I +FRNGD  + A+ +++    LK+++ +L ++ EK +L T   +RR+ T++G  ++  ++LE  + Y+A+G E F    Y + L N   G
Sbjct:   13 VKSVMVYRNGDPFFSGRRFVVNQRQIATMDALLNDITLNIGAPLA-VRTLYTPRYGHRVADLGDLQQGAQYVA-AGSERFKKLDYL------SAGLKK-----------AVEPTQSKTLA------------RPNVSAKWR-KVITLPCIIHVFRNGDILSPAMRLIIPRHMLKNLEQILSLISEKAMLRTGA-VRRICTLEGFTVTSAEELETGQCYVAVGSERFKKLPYVEILLNKATG 220          
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-25g12.4 (si:dkey-25g12.4 [Source:ZFIN;Acc:ZDB-GENE-160113-73])

HSP 1 Score: 93.9745 bits (232), Expect = 1.513e-20
Identity = 71/225 (31.56%), Postives = 109/225 (48.44%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF 885
            K V + RNGD F   RRF+ N++Q  T+D FL  +T  +    G +R+I+TP  G ++ +  ++     YVA A GE+L+ + Y  +   Q+ AKK+                 S+ I PV       V  R  V  R K  +     TI +F NGD       +++    L S + VL +V EKV L T   + RL  ++G  +    +L++N SY+A+G E F
Sbjct:   10 KTVTVFRNGDAFYPGRRFIINQRQSVTFDTFLNTVTRDITAPFGAVRNIYTPN-GHRVVSLQQLMHGQMYVA-AGGERLKKMDYNNI--TQKPAKKK-----------------SESIQPV-------VHSRIIVPARWK-RISNESCTINVFINGDILVPPARILIPKHTLASWENVLAMVTEKVSLRTG-AVHRLCMLNGRPLRGAYELQNNHSYVAVGAEKF 204          
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Match: dcdc2b (doublecortin domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-051113-124])

HSP 1 Score: 67.0106 bits (162), Expect = 6.815e-13
Identity = 33/86 (38.37%), Postives = 54/86 (62.79%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYL 465
            VK+V ++RNGD F S RRFV N++Q+ T DA L D+T  +      +R+++TP+ G ++    ++Q  + YVA A  E+ + + YL
Sbjct:   13 VKSVMVYRNGDPFFSGRRFVVNQRQIATMDALLNDITLNIGAPLA-VRTLYTPRYGHRVADLGDLQQGAQYVA-AGSERFKKLDYL 96          
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 60.8474 bits (146), Expect = 2.399e-9
Identity = 53/230 (23.04%), Postives = 104/230 (45.22%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDG-EAISDPDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R++DA L +LT +L+        +RSI+T   G KI + D++    +YV  AS E  + + Y + +                      P    ++ +  + S+PS    + ++  R   +  K  K + + R+G +  +A+ ++L      S + VL  + + + L +   ++RL+T++G + I   D   D+  +IA G E +
Sbjct:   63 AKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVC-ASNEPFRKVDYTKNVN---------------------PNWSVNVKTGASRSMPSLTATKNELRERESKDYIK-PKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSG-AVKRLYTLEGKQIICLQDFFGDDDVFIACGPEKY 268          
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 60.8474 bits (146), Expect = 2.454e-9
Identity = 54/230 (23.48%), Postives = 104/230 (45.22%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDG-EAISDPDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R++DA L +LT +L+        +RSI+T   G KI + D++    +YV  AS E  + + Y + +                      P    ++ +  + S+PS    + ++  R   +  K  K + + R+G +  +A+ ++L      S + VL  + + + L  S  ++RL+T++G + I   D   D+  +IA G E +
Sbjct:   63 AKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVC-ASNEPFRKVDYTKNVN---------------------PNWSVNVKTGASRSMPSLTATKNELRERESKDYIK-PKLVTVIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKL-DSGAVKRLYTLEGKQIICLQDFFGDDDVFIACGPEKY 268          
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Match: DCDC2 (doublecortin domain containing 2 [Source:NCBI gene;Acc:100493004])

HSP 1 Score: 106.301 bits (264), Expect = 3.259e-24
Identity = 70/231 (30.30%), Postives = 117/231 (50.65%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLY 900
            VK+V++ RNGD F   RR + ++K++ T+D FL+D+T  +    G +R+I+TP+ G ++ + D++QP   YVA    E  + + YL +        KR+                   + P+ S V      R  VS R +   Q+   T+ +  NGD     I +++    L+  +LVL +V EKV L  S  + RL+T++G  I +  +LE+ + Y+A+G E F    Y
Sbjct:   23 VKSVHVFRNGDPFYRGRRMLIHEKRVGTFDVFLKDVTGGVQAPFGAVRNIYTPRNGHRVTSLDDLQPGECYVA-GGRETFKKLDYLHI-----GEIKRK------------------TVDPL-SQVKPVSHSRINVSARFRKNFQEPC-TVFLVANGDTMNPFIRLLIPRKTLEQWELVLALVTEKVKL-RSGAVHRLYTLEGTPIQNGLELENGQFYVAVGREKFKKLPY 226          
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Match: DCDC2B (doublecortin domain containing 2B [Source:NCBI gene;Acc:100496860])

HSP 1 Score: 96.2857 bits (238), Expect = 4.800e-21
Identity = 76/241 (31.54%), Postives = 117/241 (48.55%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKT-----ICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTL 912
              KNV ++RNGD F   R+ V N+KQ  T++AFL ++TS +      +R I+TP+ G +I    E+    +YVA    EK + + YL    +Q A +K                             P  VQ   QV  ++ +  + R  T     I +FRNGD  T    V+L  + LK  +LVL ++ +K+ L  S  +R+L T+DG ++S+  +L   + Y+ALG E +  CL  Q L
Sbjct:   12 LAKNVVVYRNGDPFHMGRKMVVNEKQFLTFEAFLNEVTSCIQAPVA-VRCIYTPRNGHRITQLGELLNKGHYVA-GGTEKFRKLDYLHTEIKQPAFQK-----------------------------PREVQ---QVYPKLNFIERWRKDTQLPCVIHVFRNGDLMTPPFRVLLYPAILKEWELVLSLLTQKLNL-NSGAVRKLCTLDGVSLSNGAELVSGEYYVALGSEKY-KCLPYQEL 216          
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 55.8398 bits (133), Expect = 1.168e-7
Identity = 52/230 (22.61%), Postives = 99/230 (43.04%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDG-EAISDPDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R+++A L DLT  L+        +R+I+T     KI + D++    +YV   S E  + + Y + +    +   +          + AP     + +P  S       + F            R K + I R+G +  +A+ ++L      S + VL  + + + L + + ++RL+T+DG + +   D   D+  +IA G E F
Sbjct:   56 AKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVC-GSIEPFKKLDYTKNVNPNWSVNVK---------TTAAPRSAQPLAAPKQSFSEGRENKDFI-----------RPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGV-VKRLYTLDGKQVLCLQDFFGDDDIFIACGPEKF 263          
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 55.4546 bits (132), Expect = 1.354e-7
Identity = 52/230 (22.61%), Postives = 99/230 (43.04%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDG-EAISDPDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R+++A L DLT  L+        +R+I+T     KI + D++    +YV   S E  + + Y + +    +   +          + AP     + +P  S       + F            R K + I R+G +  +A+ ++L      S + VL  + + + L + + ++RL+T+DG + +   D   D+  +IA G E F
Sbjct:   56 AKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVC-GSIEPFKKLDYTKNVNPNWSVNVK---------TTAAPRSAQPLAAPKQSFSEGRENKDFI-----------RPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGV-VKRLYTLDGKQVLCLQDFFGDDDIFIACGPEKF 263          
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Match: arhgap24 (Rho GTPase activating protein 24 [Source:Xenbase;Acc:XB-GENE-996257])

HSP 1 Score: 55.4546 bits (132), Expect = 1.657e-7
Identity = 52/230 (22.61%), Postives = 99/230 (43.04%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDG-EAISDPDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R+++A L DLT  L+        +R+I+T     KI + D++    +YV   S E  + + Y + +    +   +          + AP     + +P  S       + F            R K + I R+G +  +A+ ++L      S + VL  + + + L + + ++RL+T+DG + +   D   D+  +IA G E F
Sbjct:   56 AKKVRFYRNGDRYFKGIVYAISPDRFRSFEALLADLTRTLSDNVNLPQGVRTIYTVDGSKKITSLDQLVEGESYVC-GSIEPFKKLDYTKNVNPNWSVNVK---------TTAAPRSAQPLAAPKQSFSEGRENKDFI-----------RPKLVTIIRSGVKPRKAVRILLNKKTAHSFEQVLTDITDAIKLDSGV-VKRLYTLDGKQVLCLQDFFGDDDIFIACGPEKF 263          
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Match: Dcdc2a (doublecortin domain containing 2a [Source:MGI Symbol;Acc:MGI:2652818])

HSP 1 Score: 113.62 bits (283), Expect = 2.550e-27
Identity = 92/316 (29.11%), Postives = 155/316 (49.05%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHE-----PFVPCL---------YGQ---TLPNIICGPKKQERIRYLNSVTT--------PTPGKQRKKNKSHS------NDSMTPKSSRQNQPD 1062
            VK+V ++RNGD F + RR V ++K++ ++D FL+++T  +    G +R+I+TP+TG +I+  D+I+   NYVA    E  + + YL + +     KKR              P E+     VN+ V   +  R  VS R +  + +   TI +  NGD  + A  +++    L   D VL++V EK+ L  S  + RL+T++G+ +    +LE+ + Y+A+G +     P+   L         YGQ   +LP ++   K +    Y  S +T        P P K++ K  S+S        S+  K+S Q  PD
Sbjct:   16 VKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVA-GGPEAFKKLNYLDIGE----IKKR--------------PMEA-----VNTEVKPVIHSRINVSARFRKSLHEPC-TIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITL-RSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQKASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKTSHQAIPD 305          
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Match: Dcdc2a (doublecortin domain containing 2a [Source:MGI Symbol;Acc:MGI:2652818])

HSP 1 Score: 115.161 bits (287), Expect = 2.581e-27
Identity = 92/317 (29.02%), Postives = 155/317 (48.90%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHE-----PFVPCL---------YGQ---TLPNIICGPKKQERIRYLNSVTT--------PTPGKQRKKNKSHSN------DSMTPKSSRQNQPD 1062
             VK+V ++RNGD F + RR V ++K++ ++D FL+++T  +    G +R+I+TP+TG +I+  D+I+   NYVA    E  + + YL + +     KKR              P E+     VN+ V   +  R  VS R +  + +   TI +  NGD  + A  +++    L   D VL++V EK+ L  S  + RL+T++G+ +    +LE+ + Y+A+G +     P+   L         YGQ   +LP ++   K +    Y  S +T        P P K++ K  S+S        S+  K+S Q  PD
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVA-GGPEAFKKLNYLDIGE----IKKR--------------PMEA-----VNTEVKPVIHSRINVSARFRKSLHEPC-TIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITL-RSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQKASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKTSHQAIPD 305          
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Match: Dcdc2c (doublecortin domain containing 2C [Source:MGI Symbol;Acc:MGI:1915761])

HSP 1 Score: 97.8265 bits (242), Expect = 4.976e-22
Identity = 79/279 (28.32%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF--VPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKS 1041
            K + ++RNGD F   R+FV++++++  ++A LE LT  +    G +R ++TP  G  +   D +Q    YVA A  E+ + + Y+ ++  ++ +K R+   +        P    DI       VPS    R+Q+  R         + I +F NG  +   I V++    L   + VL ++GEKV  P    +R+LFTMDG  + D   L+DN  Y+A G E F  +P      +P+ +     Q+R    +  T      + K  +   NDS+ P+S
Sbjct:   16 KTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFG-VRRLYTPTRGHPVLGLDALQTGGKYVA-AGRERFKKLDYIHIV-PRKPSKMRKLKEI-------KPVVHCDI------KVPS----RWQIQSRT-------SRYINVFTNGRLFIPPIKVIIPKFSLSDWNSVLAMIGEKV-FPLG-GVRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKSIPYWKSSWVPSEV-----QQRFGGNDKYTQTKKRVESKVKEPLQNDSVPPRS 260          
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Match: Dcdc2c (doublecortin domain containing 2C [Source:MGI Symbol;Acc:MGI:1915761])

HSP 1 Score: 98.2117 bits (243), Expect = 5.508e-22
Identity = 79/279 (28.32%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF--VPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKS 1041
            K + ++RNGD F   R+FV++++++  ++A LE LT  +    G +R ++TP  G  +   D +Q    YVA A  E+ + + Y+ ++  ++ +K R+   +        P    DI       VPS    R+Q+  R         + I +F NG  +   I V++    L   + VL ++GEKV  P    +R+LFTMDG  + D   L+DN  Y+A G E F  +P      +P+ +     Q+R    +  T      + K  +   NDS+ P+S
Sbjct:   16 KTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFG-VRRLYTPTRGHPVLGLDALQTGGKYVA-AGRERFKKLDYIHIV-PRKPSKMRKLKEI-------KPVVHCDI------KVPS----RWQIQSRT-------SRYINVFTNGRLFIPPIKVIIPKFSLSDWNSVLAMIGEKV-FPLG-GVRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKSIPYWKSSWVPSEV-----QQRFGGNDKYTQTKKRVESKVKEPLQNDSVPPRS 260          
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Match: Dcdc2b (doublecortin domain containing 2b [Source:MGI Symbol;Acc:MGI:2686212])

HSP 1 Score: 75.0998 bits (183), Expect = 2.245e-14
Identity = 58/235 (24.68%), Postives = 100/235 (42.55%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTL 912
             K + ++RNGD F    + V  +++  T +A L ++TSA+      +R ++T   G  +    ++Q    YVA A  E+   I YL    +    K R+ +  P        PC+      + +  P  +                      +FRNGD  +    + L  + ++  D VLK++ EKV L  S  + +L T++G  +S    L +   Y+A+G E F    Y + L
Sbjct:    2 AKRILVYRNGDAFFPGHQLVVTQRRYPTMEALLYEVTSAVQAPLA-VRVLYTLSDGHPVTNLADLQNGGQYVA-AGFERFHKIHYLPPGMKHPGGKTRQQHEPPVSQR----PCDGVFGQWLPADAPCYIH---------------------VFRNGDLLSPPFSLKLSQTAIQDWDTVLKLLSEKVTL-QSGAVHKLCTLEGLPLSTGTALVNGHYYVAVGEEEFKALPYMELL 208          
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5DU00|DCDC2_MOUSE (Doublecortin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcdc2 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 1.721e-26
Identity = 92/317 (29.02%), Postives = 155/317 (48.90%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHE-----PFVPCL---------YGQ---TLPNIICGPKKQERIRYLNSVTT--------PTPGKQRKKNKSHSN------DSMTPKSSRQNQPD 1062
             VK+V ++RNGD F + RR V ++K++ ++D FL+++T  +    G +R+I+TP+TG +I+  D+I+   NYVA    E  + + YL + +     KKR              P E+     VN+ V   +  R  VS R +  + +   TI +  NGD  + A  +++    L   D VL++V EK+ L  S  + RL+T++G+ +    +LE+ + Y+A+G +     P+   L         YGQ   +LP ++   K +    Y  S +T        P P K++ K  S+S        S+  K+S Q  PD
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVA-GGPEAFKKLNYLDIGE----IKKR--------------PMEA-----VNTEVKPVIHSRINVSARFRKSLHEPC-TIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITL-RSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQKASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKTSHQAIPD 305          
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UHG0|DCDC2_HUMAN (Doublecortin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=DCDC2 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 5.549e-26
Identity = 73/236 (30.93%), Postives = 124/236 (52.54%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTL 912
             VK+V ++RNGD F + RR V ++K++ +++ FL+++T  +    G +R+I+TP+TG +I+  D+IQ   NYVA    E  + + YL + +     KKR              P E      VN+ V   +  R  VS R +  +Q+   TI +  NGD    A  +++    L   D VL++V EK+ L  S  + RL+T++G+ +    +LE+ + Y+A+G + F    Y + L
Sbjct:   15 VVKSVLVYRNGDPFYAGRRVVIHEKKVSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVA-GGQEAFKKLNYLDIGE----IKKR--------------PMEV-----VNTEVKPVIHSRINVSARFRKPLQEPC-TIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITL-RSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELL 224          
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZR10|DCDC2_RAT (Doublecortin domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Dcdc2 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.100e-25
Identity = 91/317 (28.71%), Postives = 155/317 (48.90%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHE-----PFVPCL---------YGQ---TLPNIICGPKKQERIRYLNSVTT--------PTPGKQRKKNKSHSN------DSMTPKSSRQNQPD 1062
             VK+V ++RNGD F + RR V ++K++ ++D FL+++T  +    G +R+I+TP+TG +I+  D+I+   NYVA    E  + + YL + +     KKR              P E+     VN+ V   +  +  VS R +  + +   TI +  NGD  + A  +++    L   D VL++V EK+ L  S  + RL+T++G+ +    +LE+ + Y+A+G +     P+   L         YGQ   +LP ++   K +    Y  S +T        P P K++ K  S+S        S+  K+S Q  PD
Sbjct:   15 VVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDIFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVA-GGQEAFKKLNYLDIGE----IKKR--------------PMEA-----VNTEVKPVIHSKINVSARFRKALHEPC-TIFLIANGDLISPASRLLIPRKALNQWDHVLQMVTEKITL-RSGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQKASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKNSHQAIPD 305          
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D1B8|DCD2C_MOUSE (Doublecortin domain-containing protein 2C OS=Mus musculus OX=10090 GN=Dcdc2c PE=2 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 3.415e-21
Identity = 79/279 (28.32%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF--VPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKS 1041
            K + ++RNGD F   R+FV++++++  ++A LE LT  +    G +R ++TP  G  +   D +Q    YVA A  E+ + + Y+ ++  ++ +K R+   +        P    DI       VPS    R+Q+  R         + I +F NG  +   I V++    L   + VL ++GEKV  P    +R+LFTMDG  + D   L+DN  Y+A G E F  +P      +P+ +     Q+R    +  T      + K  +   NDS+ P+S
Sbjct:   16 KTILVYRNGDQFYVGRKFVFSRRRVANFEALLEQLTEQVEVPFG-VRRLYTPTRGHPVLGLDALQTGGKYVA-AGRERFKKLDYIHIV-PRKPSKMRKLKEI-------KPVVHCDI------KVPS----RWQIQSRT-------SRYINVFTNGRLFIPPIKVIIPKFSLSDWNSVLAMIGEKV-FPLG-GVRKLFTMDGHLLDDSKNLQDNYFYVAAGLETFKSIPYWKSSWVPSEV-----QQRFGGNDKYTQTKKRVESKVKEPLQNDSVPPRS 260          
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Match: sp|A8MYV0|DCD2C_HUMAN (Doublecortin domain-containing protein 2C OS=Homo sapiens OX=9606 GN=DCDC2C PE=1 SV=4)

HSP 1 Score: 94.3597 bits (233), Expect = 6.919e-20
Identity = 66/226 (29.20%), Postives = 112/226 (49.56%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF 885
             K + ++RNGD F   ++FV ++++  T++A LE LT  ++   G +R + TP  G ++   D +Q    YVA A  E+ + + Y+ ++  ++ AK R+   +        P    DI      +VPS  Q   ++S           + I +F NG  +     +++    L   D+VL  +GEKV  P    +R+LFTM+G  + D   L+DN  Y+A+G E F
Sbjct:   15 AKTIVVYRNGDPFYVGKKFVLSRRRAATFEALLEQLTEQVDVPFG-VRRLFTPTRGHRVLGLDALQAGGKYVA-AGRERFKELDYIHIVP-RKPAKIRKLKEI-------KPVVHCDI------NVPSKWQTYHRIS-----------RHINVFTNGRLFIPPAKIIIPKFSLSDWDIVLATIGEKV-FPLG-GVRKLFTMNGHLLGDSKDLQDNHFYVAVGLETF 211          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A267EGS0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018380g1 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.810e-50
Identity = 108/285 (37.89%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSK-IQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAP------PCESD------IISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG-PKKQERIRYLNSVTTPTPGKQRKKNKSHSND 1023
            K VYI RNGD+F+ S++FV N++QLR WD FLE +T ++NP  G +R+I TP+ G + I   D  +   +YVALA GE+ + + Y+      EA       H   +G+  +P      P  S+      I+  V++    +VQ RF     +   +  + K I ++RNGDE+T AI VML+ SE  SM++VL+ V E+V+LP ++ IR+LF + G  I +P +L+  K Y+A GHEPF+   YGQ LP I+ G  +++  I+YL+   TP     RK  +    D
Sbjct:   40 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYV-----PEAEVGANGSHAETKGSGASPTASPRKPMGSNRVVLEPILPVVHNKKLMSVQPRFGAKMDV---ISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKAERKSTIKYLSQPITPEKHSSRKSKQDSQRD 316          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A267GFD5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018380g2 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.931e-50
Identity = 108/285 (37.89%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSK-IQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAP------PCESD------IISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG-PKKQERIRYLNSVTTPTPGKQRKKNKSHSND 1023
            K VYI RNGD+F+ S++FV N++QLR WD FLE +T ++NP  G +R+I TP+ G + I   D  +   +YVALA GE+ + + Y+      EA       H   +G+  +P      P  S+      I+  V++    +VQ RF     +   +  + K I ++RNGDE+T AI VML+ SE  SM++VL+ V E+V+LP ++ IR+LF + G  I +P +L+  K Y+A GHEPF+   YGQ LP I+ G  +++  I+YL+   TP     RK  +    D
Sbjct:   40 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYV-----PEAEVGANGSHAETKGSGASPTASPRKPMGSNRVLLEPILPVVHNKKLMSVQPRFGAKMDV---ISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKAERKSTIKYLSQPITPEKHSSRKSKQDSQRD 316          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A267H8Q0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016684g1 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.140e-50
Identity = 108/285 (37.89%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSK-IQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAP------PCESD------IISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG-PKKQERIRYLNSVTTPTPGKQRKKNKSHSND 1023
            K VYI RNGD+F+ S++FV N++QLR WD FLE +T ++NP  G +R+I TP+ G + I   D  +   +YVALA GE+ + + Y+      EA       H   +G+  +P      P  S+      I+  V++    +VQ RF     +   +  + K I ++RNGDE+T AI VML+ SE  SM++VL+ V E+V+LP ++ IR+LF + G  I +P +L+  K Y+A GHEPF+   YGQ LP I+ G  +++  I+YL+   TP     RK  +    D
Sbjct:   40 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYV-----PEAEVGANGSHAETKGSGASPTASPRKPMGSNRVVLEPILPVVHNKKLMSVQPRFGAKMDV---ISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKAERKSTIKYLSQPITPEKHSSRKSKQDSQRD 316          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A1I8IEM1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 8.584e-47
Identity = 108/285 (37.89%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSK-IQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAP------PCESD------IISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG-PKKQERIRYLNSVTTPTPGKQRKKNKSHSND 1023
            K VYI RNGD+F+ S++FV N++QLR WD FLE +T ++NP  G +R+I TP+ G + I   D  +   +YVALA GE+ + + Y+      EA       H   +G+  +P      P  S+      I+  V++    +VQ RF     +   +  + K I ++RNGDE+T AI VML+ SE  SM++VL+ V E+V+LP ++ IR+LF + G  I +P +L+  K Y+A GHEPF+   YGQ LP I+ G  +++  I+YL+   TP     RK  +    D
Sbjct:  414 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYV-----PEAEVGANGSHAETKGSGASPTASPRKPMGSNRVLLEPILPVVHNKKLMSVQPRFGAKMDV---ISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKAERKSTIKYLSQPITPEKHSSRKSKQDSQRD 690          
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Match: A0A1I8HIU1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 9.473e-47
Identity = 108/285 (37.89%), Postives = 163/285 (57.19%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSK-IQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAP------PCESD------IISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICG-PKKQERIRYLNSVTTPTPGKQRKKNKSHSND 1023
            K VYI RNGD+F+ S++FV N++QLR WD FLE +T ++NP  G +R+I TP+ G + I   D  +   +YVALA GE+ + + Y+      EA       H   +G+  +P      P  S+      I+  V++    +VQ RF     +   +  + K I ++RNGDE+T AI VML+ SE  SM++VL+ V E+V+LP ++ IR+LF + G  I +P +L+  K Y+A GHEPF+   YGQ LP I+ G  +++  I+YL+   TP     RK  +    D
Sbjct:  402 KCVYIFRNGDVFAPSKKFVLNRRQLRDWDVFLEQVTMSVNPLRGAVRNIVTPKRGRRRIHDLDSFEDKGHYVALARGERFKPMTYV-----PEAEVGANGSHAETKGSGASPTASPRKPMGSNRVVLEPILPVVHNKKLMSVQPRFGAKMDV---ISSQSKAIRVYRNGDEFTPAIIVMLRPSEQVSMEVVLRAVEERVVLPNNMAIRKLFDISGRRIREPQELQHEKHYVAGGHEPFLSRPYGQKLPLIVLGKAERKSTIKYLSQPITPEKHSSRKSKQDSQRD 678          
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Match: dcdc2b (doublecortin domain containing 2B [Source:ZFIN;Acc:ZDB-GENE-051113-124])

HSP 1 Score: 108.227 bits (269), Expect = 1.790e-25
Identity = 86/318 (27.04%), Postives = 147/318 (46.23%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQEKNNFLSKP----KDNPT 1149
            VK+V ++RNGD F + R+F+ N++Q+ T +AFL D+T ++      IR+++TP+ G ++   D +Q  + YVA A  E+ + I Y  +                  G   AP                 V  R  VS + + ++      I +FRNGD  + A+  ++  + LK+++ +L ++ EK +L T   +RRL T+DG  ++  ++LE  + Y+A+G E F    Y + L N   G        Y+        G  R+  +       T   +    P +  H      GS+++E + F +KP    KD PT
Sbjct:   13 VKSVMVYRNGDPFFTGRKFIVNQRQISTMEAFLNDVTVSIGAPLA-IRTLYTPRHGHRVPDLDHLQQGAQYVA-AGFERFKKIDYFSV------------------GLKRAP---------------VKVLSRPNVSAKWR-KVITLPCIINVFRNGDILSSAMRFIIPRNMLKNLEQILSLISEKAMLRTG-AVRRLCTLDGVTVASAEELESGQCYVAVGTERFKKLPYVELLLNKAAGGSADR--HYVGE-----RGLHRRSERDDRRVKSTGDEAAGTSPSQPHHRR--AGGSKREENSVFYAKPVRVRKDRPT 284          
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000050955.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:19696740:19722139:-1 gene:ENSAMXG00000037587.1 transcript:ENSAMXT00000050955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 7.584e-23
Identity = 71/236 (30.08%), Postives = 116/236 (49.15%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPN 918
            K++ ++RNGD F   ++FV N++Q  T+++FL  +T  +    G +R I+TP+ G +I++ ++      YVA A  E+L+ I YL +   +    K +                   I PV       V  +  V  R +  + +   TI +F NGD       ++L    L S + VL +V EKV L  S  + RLFT+DG  +    +L++N+ Y+A+G E F    Y Q +PN
Sbjct:   17 KSILVYRNGDAFYPGKKFVINQRQTATFESFLGSVTRGIEAPFGAVRHIYTPREGHRIRSLEQFSHGERYVA-AGAERLKNIDYLHITPNRPQRMKNKQ------------------IRPV-------VHSKIIVPARWRKNIDEPC-TINVFANGDILVPPARILLPKYTLNSWESVLAMVTEKVHL-RSGAVHRLFTLDGTPLLGTAELKNNQYYVAVGMEKFRHKPYVQNIPN 224          
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055346.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:19700301:19722115:-1 gene:ENSAMXG00000037587.1 transcript:ENSAMXT00000055346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.012e-18
Identity = 64/236 (27.12%), Postives = 107/236 (45.34%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPN 918
            K++ ++RNGD F   ++FV N++Q  T+++FL  +T  +    G +R I+TP+ G +I++ ++      YVA A  E+L+                                   +II PV       V  +  V  R +  + +      +F NGD       ++L    L S + VL +V EKV L +      LFT+DG  +    +L++N+ Y+A+G E F    Y Q +PN
Sbjct:    9 KSILVYRNGDAFYPGKKFVINQRQTATFESFLGSVTRGIEAPFGAVRHIYTPREGHRIRSLEQFSHGERYVA-AGAERLK-----------------------------------NIIRPV-------VHSKIIVPARWRKNIDE--PCTIVFANGDILVPPARILLPKYTLNSWESVLAMVTEKVHLRSGA--VHLFTLDGTPLLGTAELKNNQYYVAVGMEKFRHKPYVQNIPN 197          
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039996.1 (doublecortin domain containing 2 [Source:NCBI gene;Acc:103026450])

HSP 1 Score: 78.1814 bits (191), Expect = 3.726e-15
Identity = 62/235 (26.38%), Postives = 108/235 (45.96%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTL 912
            VK++ ++RNG+     RR V ++K++ + +  L +L+       G  R +HTPQ G ++    +IQ    YVA A  E  + I YL++    +   +                  + ++ PV        Q R  VS R    + +   TI I  NGD    A+ +++    L   + +L++V EK+ L     +R L+T DG ++ D  +LE+ + Y+A+G + F    Y   L
Sbjct:   14 VKSILVYRNGEHGRGPRRVVLHEKRVSSLEGLLRELS-------GGTRRLHTPQ-GHRVGALQDIQHRGAYVA-AGTETFKKIDYLQIGNRNKQTTQ-----------------SNGVLKPVP-------QNRINVSARFLKPINEP-CTIFIVANGDVLNPAVRLLVHSRLLGQFERILEMVTEKMGLRVLGGVRSLYTFDGISVMDGKELENGQFYVAVGRDKFKRLPYADLL 214          
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018326.2 (doublecortin [Source:NCBI gene;Acc:103035707])

HSP 1 Score: 63.1586 bits (152), Expect = 1.596e-10
Identity = 78/322 (24.22%), Postives = 134/322 (41.61%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQ-----EAAKKRRNYHLPFQGASEAPPCES-DIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPFVPCLYGQTLPNIIC----GPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRH--TTEIENGSQKQEKNNFL 1125
             K V  +RNGD +     +     + RT+DA L DLT +L+        +R I T     KI + DE++   +YV  AS    + + Y + +        +A   +RN      G   A P E+ D + P                           K + + R+G +  +A+ V+L      S + VL  + E + L + + ++R++T+DG+ ++   D   D+  +IA G E F       +L    C     PK Q       S  +P P ++ K     +N   T  SS+ + P  K+   +T    GS +++K+ +L
Sbjct:   52 AKKVRFYRNGDRYFKGIVYAVANDRFRTFDALLADLTRSLSDHINLPQGVRFIFTIDGAHKITSLDELEEGESYVC-ASENYYKKVDYTKNVNPNWSVNVKACAGQRNAMCVSGGRPGAEPRENKDFVRP---------------------------KLVTVMRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLESGV-VKRIYTLDGKQVTCLQDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKAPKGQR-----GSAKSPGPIRRSKSPAESTNG--TGSSSQLSTPISKQSPISTPTSPGSTRKQKDLYL 337          
BLAST of Doublecortin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007114.1 (pep scaffold:Pmarinus_7.0:GL477366:299514:356138:-1 gene:ENSPMAG00000006368.1 transcript:ENSPMAT00000007114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 3.687e-11
Identity = 58/230 (25.22%), Postives = 103/230 (44.78%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R++DA LEDLT  L         +R+I+T     ++ T DE+    +YV  AS E  + + Y + L          N+ +  + +               S+  S+ Q    VS   +     R K + + R+G +  +A+ ++L      S D VL  + + + L T + ++RL+T+DG+ ++   D   D+  +IA G E F
Sbjct:   60 AKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVC-ASNEPYRRLDYTKTLNP--------NWSVNIKSSG----------GKAQSAAGSSRQAVAGVSTGSESRDFIRPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLTDITDAIKLDTGV-VKRLYTLDGKQVTCLQDFFGDDDVFIACGPEKF 269          

HSP 2 Score: 46.9802 bits (110), Expect = 7.605e-6
Identity = 30/97 (30.93%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  640 QKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLP--IRRLFTMDGE-AISDPDQLEDNKSYIALGHEPFVPCLYGQTL-PN 918
            +KR K +  +RNGD Y R I   +     +S D +L+ +   +    +LP  +R ++T DG   +   D+L + +SY+   +EP+    Y +TL PN
Sbjct:   57 EKRAKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVCASNEPYRRLDYTKTLNPN 153          
BLAST of Doublecortin domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007117.1 (pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-1 gene:ENSPMAG00000006438.1 transcript:ENSPMAT00000007117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.144e-9
Identity = 50/210 (23.81%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAIS 828
             K V  +RNGD +     +  +  + R++DA LEDLT  L         +R+I+T     ++ T DE+    +YV  AS E  + + Y + L                      P    +I S    +  +    R+      +  +  R K + + R+G +  +A+ ++L      S D VL  + + + L T + ++RL+T+DG+ +S
Sbjct:   56 AKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVC-ASNEPYRRLDYTKTLN---------------------PNWSVNIKSSGGKAQSAAGSSRYTAGSESRDFI--RPKLVTVIRSGVKPRKAVRILLNKKTAHSFDQVLTDITDAIKLDTGV-VKRLYTLDGKQVS 240          

HSP 2 Score: 50.8322 bits (120), Expect = 1.811e-7
Identity = 37/136 (27.21%), Postives = 60/136 (44.12%), Query Frame = 1
Query:  640 QKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLP--IRRLFTMDG-EAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPK 1038
            +KR K +  +RNGD Y R I   +     +S D +L+ +   +    +LP  +R ++T DG   +   D+L + +SY+   +EP+    Y +TL      P     I+          G  R    S S D + PK
Sbjct:   53 EKRAKKVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVCASNEPYRRLDYTKTL-----NPNWSVNIKSSGGKAQSAAGSSRYTAGSESRDFIRPK 183          
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Match: EDO46255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ95])

HSP 1 Score: 105.145 bits (261), Expect = 1.080e-24
Identity = 74/224 (33.04%), Postives = 112/224 (50.00%), Query Frame = 1
Query:  217 VYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQ-KRGKTICIF--RNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHE 879
            V I++NG+     ++ V N +Q+R  DA L+ +T  +  +T   RS+ TP  G KI   ++I+P   YV +   E  + + Y+ +  E               G    P  E +I +PV  S       R Q+SGR +     ++G  + IF  +NGD  T ++ V L   ELKSMD V   +  KV L T   +R L+TMDGE + DP +L ++  Y+A GHE
Sbjct:    6 VTIYKNGEPKFPGKKVVVNPRQVRNMDACLDKITREMKLKTA-ARSLKTPTGGHKIDKLEKIEPGGQYV-VCGLEAFKRLNYMEIKPE---------------GMRPTPRKEIEI-TPVKHS-------RLQMSGRARKRADAEKGNNMGIFVYKNGDALTSSVKVHLSDRELKSMDKVCDFITNKVHLQTGA-VRILYTMDGECVKDPSELSNSAKYVAAGHE 203          
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Match: EDO44490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP9])

HSP 1 Score: 52.373 bits (124), Expect = 4.845e-8
Identity = 46/204 (22.55%), Postives = 89/204 (43.63%), Query Frame = 1
Query:  211 KNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEA---AKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMD 813
            K +  +RNGD F S  +   + ++ + +D+ L +L++ ++ +TG +R I   +TG+++Q   E+Q   +YV  +S    ++ G  R  Q Q A   AK      L     +E    + D I                           R K + + ++G +  + + ++L      S++ VL  +  KV   T   + +L+T+D
Sbjct:    2 KQIMFYRNGDRFFSGLKLAVSSERYKEFDSLLTELSAKIDLQTGAVRYIFNSETGNEVQDVTELQYGVSYVCSSSNHFQRIEGGYRNNQPQWALTSAKGNPKSELQNWQQNEQVDQQKDFI---------------------------RAKLVTVVKHGKKPQKKVTMLLNKKTASSLNQVLDHLSSKV---TVGKVDKLYTVD 175          
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Match: EDO47258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RME3])

HSP 1 Score: 49.6766 bits (117), Expect = 7.414e-8
Identity = 26/72 (36.11%), Postives = 40/72 (55.56%), Query Frame = 1
Query:  217 VYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALA 432
            + I++NGD FS  +  V N +  RT+D FL++ T      +  +R I TPQ    I++ DE+Q    YVA+ 
Sbjct:   12 ITIYKNGDPFSKGKDIVINHRYYRTFDTFLDNATRYAKC-SDAVRKIVTPQGRHHIKSVDELQNGGKYVAIG 82          
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Match: DCDC2 (doublecortin domain-containing protein 2 [Source:NCBI gene;Acc:101158630])

HSP 1 Score: 95.1301 bits (235), Expect = 7.450e-21
Identity = 62/235 (26.38%), Postives = 111/235 (47.23%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTL 912
            VKN+++ RNGD +  +RR V N+K++  ++  L ++T  +    G +R+I+TP+ G K+   + +     YVA A  E+ + + Y+++       +K+R            PP                   R  VS R    + K    I +  NGD    A+ +++    L   D +L+++ EK+ L     +R L+T +G  ++D ++LE  + Y+A+G E F   LY   L
Sbjct:   14 VKNIFMFRNGDPYYEARRIVVNEKRVCNFETLLREVTGGIQAPFGAVRTIYTPRGGHKVDCMESLHSGEQYVA-AGRERFKRLDYVQI-----GTRKKRMMQTLTTPTKPLPP------------------NRISVSARFLKPI-KEPCPIFVVANGDILNPAMRLLIHQRMLGQFDRILEMITEKMGLRVLGGVRSLYTCEGLQVTDGEKLESGQLYVAVGRERFKKLLYSDLL 223          
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Match: dcdc2b (doublecortin domain-containing protein 2 [Source:NCBI gene;Acc:101170886])

HSP 1 Score: 93.9745 bits (232), Expect = 1.665e-20
Identity = 66/226 (29.20%), Postives = 112/226 (49.56%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPF 885
            VK+V ++RNGD F + RRFV N++Q+ T +AFL ++T ++      +R+++TP+ G ++    ++Q  + YVA A  E+ + + YL             N  +  Q AS     E   +  V     +   R F  +  I          I +FRNGD     +  ++  S  + ++ +L V+ EKV L T   +RRL +++G  +S   +LE    Y+A+G E F
Sbjct:   14 VKSVVVYRNGDPFHTGRRFVVNQRQVATMEAFLNEVTRSIRAPLA-VRTLYTPKQGHRVTDLQDLQTGAQYVA-AGSERFKKLDYL-------------NAGVKKQPASR----EETQVKGVQKPHVTAKWREFVPAPCI----------IHVFRNGDLLCAPLRFLIPRSMRQDLEQILCVISEKVNLRTGA-VRRLCSLEGMTVSSAGELETGHCYVAVGTERF 209          
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033772.1 (doublecortin [Source:NCBI gene;Acc:101157476])

HSP 1 Score: 57.3806 bits (137), Expect = 1.284e-8
Identity = 55/236 (23.31%), Postives = 100/236 (42.37%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLR------LLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +     + R++D+ L DLT +L+        +R I T     KI T DE++   +YV  AS    + + Y +       +  + +A ++    L  + ASE P    + + P                           K + + R+G +  +A+ V+L      S + VL  + E + L +   ++R++T+DG+ ++   D   D+  +IA G E F
Sbjct:   52 AKKVRFYRNGDRYFKGIVYAVASDRFRSFDSLLADLTRSLSDHINLPQGVRFIFTIDGSRKISTLDELEEGESYVC-ASENFYKKVDYTKNVNPNWSVNVKASASQKNMQSLAAKAASE-PRENKEFVRP---------------------------KLVTVMRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLESG-AVKRIYTLDGKQVTCLQDFFGDDDVFIACGPEKF 257          
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003850.2 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 53.5286 bits (127), Expect = 3.480e-7
Identity = 56/232 (24.14%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQK--RGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R++DA L +LT +L         +RSI+T     KI + DE+     YV  AS +  + + Y ++                    +          + V++S  ST  +  +   R   E +   + K + + R+G +  +A+ V+L      S D VL  + E + L  S  ++RL+T+DG+ ++   D   D+  ++A G E F
Sbjct:   74 AKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVC-ASNQPFRKVDYTKISVPSWKPGASAGSGSSSSSRTTT------ASTGVSTSTASTASKE-RSDSRESRESKDFIKPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAIKL-DSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACGPEKF 296          
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000031333.1 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 53.5286 bits (127), Expect = 3.480e-7
Identity = 56/232 (24.14%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  208 VKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTG---PIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQK--RGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD-PDQLEDNKSYIALGHEPF 885
             K V  +RNGD +     +  +  + R++DA L +LT +L         +RSI+T     KI + DE+     YV  AS +  + + Y ++                    +          + V++S  ST  +  +   R   E +   + K + + R+G +  +A+ V+L      S D VL  + E + L  S  ++RL+T+DG+ ++   D   D+  ++A G E F
Sbjct:   74 AKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVC-ASNQPFRKVDYTKISVPSWKPGASAGSGSSSSSRTTT------ASTGVSTSTASTASKE-RSDSRESRESKDFIKPKLVTVIRSGVKPRKAVRVLLNKKTAHSFDQVLADITEAIKL-DSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACGPEKF 296          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000059704.1 (SMESG000059704.1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 409/412 (99.27%), Postives = 411/412 (99.76%), Query Frame = 1
Query:   82 MDSTENFKPINSTITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQEKNNFLSKPKDNPTKIHXXXXXXXXXXXXXXXXXXXXDQIIPQNXXXXXXXXXXXXXXRYPNYQNETNVE 1317
            MDSTENFKPINS ITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKR+TTEIENGSQKQEKNNFLSKPKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPERYPNYQNET+VE
Sbjct:    1 MDSTENFKPINSNITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRYTTEIENGSQKQEKNNFLSKPKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPERYPNYQNETDVE 412          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000059704.1 (SMESG000059704.1)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 409/421 (97.15%), Postives = 411/421 (97.62%), Query Frame = 1
Query:   82 MDSTENFKPINSTITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEA---------PPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQEKNNFLSKPKDNPTKIHXXXXXXXXXXXXXXXXXXXXDQIIPQNXXXXXXXXXXXXXXRYPNYQNETNVE 1317
            MDSTENFKPINS ITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEA         PPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKR+TTEIENGSQKQEKNNFLSKPKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPERYPNYQNET+VE
Sbjct:    1 MDSTENFKPINSNITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAVNSNDQHMTPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRYTTEIENGSQKQEKNNFLSKPKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPERYPNYQNETDVE 421          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000059704.1 (SMESG000059704.1)

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 397/412 (96.36%), Postives = 399/412 (96.84%), Query Frame = 1
Query:   82 MDSTENFKPINSTITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQEKNNFLSKPKDNPTKIHXXXXXXXXXXXXXXXXXXXXDQIIPQNXXXXXXXXXXXXXXRYPNYQNETNVE 1317
            MDSTENFKPINS ITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEA            SSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKR+TTEIENGSQKQEKNNFLSKPKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPERYPNYQNET+VE
Sbjct:    1 MDSTENFKPINSNITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEA------------SSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPTPGKQRKKNKSHSNDSMTPKSSRQNQPDEKRYTTEIENGSQKQEKNNFLSKPKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPERYPNYQNETDVE 400          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000040482.1 (SMESG000040482.1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.743e-21
Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1
Query:  205 FVKNVYIHRNGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGY 462
             VKN+ + +NGD +   +R V NKK    W+ FLED+T +LNPR G IR + TP  G++I++ +++  N  YVAL+ GE L++I Y
Sbjct:   33 LVKNILLFKNGDQYFPGKRVVVNKKYTPNWECFLEDITKSLNPRNGAIRDVRTPYHGTRIKSLEDLSTNGKYVALSKGESLKIINY 118          
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Match: SMESG000040454.1 (SMESG000040454.1)

HSP 1 Score: 89.7373 bits (221), Expect = 7.048e-19
Identity = 64/236 (27.12%), Postives = 114/236 (48.31%), Query Frame = 1
Query:  217 VYIHRNGDMFSSSRRFVYNKKQ-LRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSKIQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGASEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGDEYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISDPDQLEDNKSYIALGHEPFVPCLYGQTLPNI 921
            + I++NGD  S+ ++ +  K   L  W +FLE++TS L  +   ++ I     G K++  D+   +  YVA+  GE         +  +Q+        ++ F   S     +  +++ V S           ++ RI   +  +   I +++NGD  TRAI V ++      M  +LK + E+V L +  PI+RL+ ++GE I D  ++E+ KSY+   +E +    YGQ LP I
Sbjct:    4 IQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGE---------IFSKQD--------YIGFGKISIDSLNDLTMLTSVGSR---------NLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEI 213          
The following BLAST results are available for this feature:
BLAST of Doublecortin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC21.155e-2630.93doublecortin domain containing 2 [Source:HGNC Symb... [more]
DCDC2C1.441e-2029.20doublecortin domain containing 2C [Source:HGNC Sym... [more]
DCDC2B3.445e-1225.54doublecortin domain containing 2B [Source:HGNC Sym... [more]
DCX8.068e-1122.22doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
DCX8.068e-1122.22doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C06C3.31.224e-837.18pep chromosome:WBcel235:II:9369178:9372485:-1 gene... [more]
rpi-13.307e-832.53pep chromosome:WBcel235:II:13959239:13962417:-1 ge... [more]
rpi-13.385e-832.53pep chromosome:WBcel235:II:13959239:13962417:-1 ge... [more]
zyg-81.496e-733.33Serine/threonine-protein kinase zyg-8 [Source:Uni... [more]
zyg-83.041e-733.33Serine/threonine-protein kinase zyg-8 [Source:Uni... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcdc2b3.108e-2228.63doublecortin domain containing 2B [Source:ZFIN;Acc... [more]
si:dkey-25g12.41.513e-2031.56si:dkey-25g12.4 [Source:ZFIN;Acc:ZDB-GENE-160113-7... [more]
dcdc2b6.815e-1338.37doublecortin domain containing 2B [Source:ZFIN;Acc... [more]
dclk2a2.399e-923.04doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a2.454e-923.48doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC23.259e-2430.30doublecortin domain containing 2 [Source:NCBI gene... [more]
DCDC2B4.800e-2131.54doublecortin domain containing 2B [Source:NCBI gen... [more]
arhgap241.168e-722.61Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap241.354e-722.61Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
arhgap241.657e-722.61Rho GTPase activating protein 24 [Source:Xenbase;A... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dcdc2a2.550e-2729.11doublecortin domain containing 2a [Source:MGI Symb... [more]
Dcdc2a2.581e-2729.02doublecortin domain containing 2a [Source:MGI Symb... [more]
Dcdc2c4.976e-2228.32doublecortin domain containing 2C [Source:MGI Symb... [more]
Dcdc2c5.508e-2228.32doublecortin domain containing 2C [Source:MGI Symb... [more]
Dcdc2b2.245e-1424.68doublecortin domain containing 2b [Source:MGI Symb... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DU00|DCDC2_MOUSE1.721e-2629.02Doublecortin domain-containing protein 2 OS=Mus mu... [more]
sp|Q9UHG0|DCDC2_HUMAN5.549e-2630.93Doublecortin domain-containing protein 2 OS=Homo s... [more]
sp|D3ZR10|DCDC2_RAT1.100e-2528.71Doublecortin domain-containing protein 2 OS=Rattus... [more]
sp|Q9D1B8|DCD2C_MOUSE3.415e-2128.32Doublecortin domain-containing protein 2C OS=Mus m... [more]
sp|A8MYV0|DCD2C_HUMAN6.919e-2029.20Doublecortin domain-containing protein 2C OS=Homo ... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EGS03.810e-5037.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GFD53.931e-5037.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H8Q04.140e-5037.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IEM18.584e-4737.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HIU19.473e-4737.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcdc2b1.790e-2527.04doublecortin domain containing 2B [Source:ZFIN;Acc... [more]
ENSAMXT00000050955.17.584e-2330.08pep primary_assembly:Astyanax_mexicanus-2.0:9:1969... [more]
ENSAMXT00000055346.11.012e-1827.12pep primary_assembly:Astyanax_mexicanus-2.0:9:1970... [more]
ENSAMXT00000039996.13.726e-1526.38doublecortin domain containing 2 [Source:NCBI gene... [more]
ENSAMXT00000018326.21.596e-1024.22doublecortin [Source:NCBI gene;Acc:103035707][more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007114.13.687e-1125.22pep scaffold:Pmarinus_7.0:GL477366:299514:356138:-... [more]
ENSPMAT00000007117.11.144e-923.81pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO462551.080e-2433.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444904.845e-822.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472587.414e-836.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCDC27.450e-2126.38doublecortin domain-containing protein 2 [Source:N... [more]
dcdc2b1.665e-2029.20doublecortin domain-containing protein 2 [Source:N... [more]
ENSORLT00000033772.11.284e-823.31doublecortin [Source:NCBI gene;Acc:101157476][more]
ENSORLT00000003850.23.480e-724.14serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
ENSORLT00000031333.13.480e-724.14serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
back to top
BLAST of Doublecortin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059704.10.000e+099.27SMESG000059704.1[more]
SMESG000059704.10.000e+097.15SMESG000059704.1[more]
SMESG000059704.10.000e+096.36SMESG000059704.1[more]
SMESG000040482.12.743e-2144.19SMESG000040482.1[more]
SMESG000040454.17.048e-1927.12SMESG000040454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035028 ID=SMED30035028|Name=Doublecortin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1400bp
AGCAAATCTGTGCGTTGCTAAGCAACTAGACATATATAAAATGCAAGCCA
ACGTGAATAACTTTTCTGTATCAGAAAAAATATGGATTCTACAGAGAATT
TCAAACCCATTAATAGTACCATCACACCCAGAGAAAGTGACATAACAGCC
CGATCCAATGACTACCAGAAGGGGTCTGATTTTTTGAATGACGAAAATAA
CGGTTTTGTGAAAAATGTATATATCCACCGCAATGGAGATATGTTTTCAT
CGTCTCGGCGATTTGTGTACAATAAAAAACAGTTGAGAACATGGGATGCT
TTTCTCGAGGATTTAACGTCAGCCTTAAATCCAAGAACAGGACCAATTCG
AAGTATTCATACTCCACAAACCGGTTCAAAAATTCAAACTTTTGATGAAA
TTCAACCAAATTCAAATTATGTGGCATTAGCAAGCGGGGAAAAACTTCAG
ATGATTGGATATCTCAGACTTCTTCAAGAACAGGAGGCGGCTAAAAAACG
GCGTAATTATCACCTACCCTTTCAAGGTGCATCTGAAGCGCCGCCTTGTG
AATCTGATATTATTAGTCCGGTCAATTCCTCTGTACCAAGTACCGTACAA
AGACGTTTCCAAGTCAGTGGTAGAATCAAATATGAAATGCAAAAACGGGG
CAAAACTATCTGTATTTTCAGAAATGGCGATGAATACACTCGGGCTATTT
GTGTTATGCTAAAGTATTCTGAACTGAAGTCAATGGATTTGGTATTGAAG
GTTGTCGGAGAAAAAGTAATTTTACCAACTAGTTTGCCAATCAGAAGATT
ATTCACCATGGATGGCGAAGCAATCTCAGATCCAGATCAGTTAGAGGATA
ATAAGTCATACATTGCATTAGGTCATGAACCATTTGTGCCATGTTTGTAC
GGACAAACTCTACCAAATATTATTTGTGGACCAAAGAAACAAGAAAGGAT
TCGTTATCTCAATTCTGTCACCACTCCAACTCCTGGAAAACAAAGAAAAA
AAAATAAAAGCCACTCTAATGATTCGATGACCCCAAAATCTTCAAGACAA
AATCAGCCTGACGAAAAACGCCATACGACTGAAATTGAAAATGGGTCCCA
AAAACAAGAGAAAAATAATTTTCTATCGAAACCAAAAGACAATCCGACTA
AAATCCACAAATTGCAAGAGAAGGAGGAAAACAATGAAAAAGAAGATTTG
GAATTAAATTATGAAGAGGATCAAATCATACCGCAAAATGATGAGAGTTA
TTATTACGAAAAAGAATCAGAGGATCCAGAACGCTATCCTAACTATCAAA
ATGAAACGAATGTTGAATAGATGGGTTCCAAAAAGTGGATATGAATATTT
TTTTAGATTGTTTTCGTTTGATTTCACATTATGAAAATAGAATACAGCAC
back to top

protein sequence of SMED30035028-orf-1

>SMED30035028-orf-1 ID=SMED30035028-orf-1|Name=SMED30035028-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MDSTENFKPINSTITPRESDITARSNDYQKGSDFLNDENNGFVKNVYIHR
NGDMFSSSRRFVYNKKQLRTWDAFLEDLTSALNPRTGPIRSIHTPQTGSK
IQTFDEIQPNSNYVALASGEKLQMIGYLRLLQEQEAAKKRRNYHLPFQGA
SEAPPCESDIISPVNSSVPSTVQRRFQVSGRIKYEMQKRGKTICIFRNGD
EYTRAICVMLKYSELKSMDLVLKVVGEKVILPTSLPIRRLFTMDGEAISD
PDQLEDNKSYIALGHEPFVPCLYGQTLPNIICGPKKQERIRYLNSVTTPT
PGKQRKKNKSHSNDSMTPKSSRQNQPDEKRHTTEIENGSQKQEKNNFLSK
PKDNPTKIHKLQEKEENNEKEDLELNYEEDQIIPQNDESYYYEKESEDPE
RYPNYQNETNVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036572Doublecortin_dom_sf
IPR003533Doublecortin_dom
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0007605sensory perception of sound
GO:0030111regulation of Wnt signaling pathway
GO:1902017regulation of cilium assembly
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005929cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 361..381
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..337
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 346..371
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 295..412
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..412
NoneNo IPR availablePANTHERPTHR23004:SF11PROTEIN RPI-1coord: 44..372
NoneNo IPR availablePANTHERPTHR23004DOUBLECORTIN DOMAIN CONTAINING 2coord: 44..372
NoneNo IPR availableCDDcd17071DCX1_DCDC2_likecoord: 44..122
e-value: 3.33862E-26
score: 98.8329
NoneNo IPR availableCDDcd16113DCX2_DCDC2_likecoord: 190..264
e-value: 3.82746E-20
score: 81.8538
IPR003533Doublecortin domainSMARTSM00537doub1_11coord: 39..128
e-value: 1.1E-13
score: 61.5
coord: 186..274
e-value: 4.8E-18
score: 75.9
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 64..117
e-value: 9.2E-13
score: 48.1
coord: 214..268
e-value: 2.3E-12
score: 46.8
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 191..274
score: 22.195
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 44..115
score: 17.711
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 191..278
e-value: 6.2E-20
score: 72.6
coord: 44..133
e-value: 3.9E-19
score: 70.1
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 188..273
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 43..137