GOLD domain-containing protein

Overview
NameGOLD domain-containing protein
Smed IDSMED30035002
Length (bp)1177
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GOLD domain-containing protein (SMED30035002) t-SNE clustered cells

Violin plots show distribution of expression levels for GOLD domain-containing protein (SMED30035002) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GOLD domain-containing protein (SMED30035002) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GOLD domain-containing protein (SMED30035002) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30035002

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30035002SMESG000034989.1 dd_Smed_v4_2557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30035002SMESG000034989.1 dd_Smed_v4_2557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30035002SMESG000034989.1 dd_Smed_v4_2557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30035002SMESG000034989.1 dd_Smed_v4_2557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30035002SMESG000034989.1 dd_Smed_v4_2557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035002SMESG000034989.1 Contig39308newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035002SMESG000034989.1 Contig39308uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30035002SMESG000034989.1 Contig2966GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30035002SMESG000034989.1 dd_Smed_v6_2557_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30035002SMESG000034989.1 dd_Smed_v6_2557_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GOLD domain-containing protein vs. Ensembl Human
Match: TMED7 (transmembrane p24 trafficking protein 7 [Source:HGNC Symbol;Acc:HGNC:24253])

HSP 1 Score: 147.902 bits (372), Expect = 1.071e-41
Identity = 76/187 (40.64%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +WS+  A+ ++V   GQV +LK+FFSDK
Sbjct:   36 EITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDK 215          
BLAST of GOLD domain-containing protein vs. Ensembl Human
Match: TMED3 (transmembrane p24 trafficking protein 3 [Source:HGNC Symbol;Acc:HGNC:28889])

HSP 1 Score: 138.658 bits (348), Expect = 2.647e-38
Identity = 71/186 (38.17%), Postives = 110/186 (59.14%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK-PI 661
            + TFELPD  + CF+E++E   K+   Y+VI GG  DVD  +  P    +Y + K  +D+  ++    G+Y  CFSNEFS+F+HK V+F+ +      +  + G  V  +ALT ME++   IH  L  V + QT YR +E + R  ++DLN  V +WS+   I + V  + QV++LK+FF++K PI
Sbjct:   28 ELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRV--TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPI 211          
BLAST of GOLD domain-containing protein vs. Ensembl Human
Match: TMED7-TICAM2 (TMED7-TICAM2 readthrough [Source:HGNC Symbol;Acc:HGNC:33945])

HSP 1 Score: 119.398 bits (298), Expect = 2.309e-31
Identity = 62/160 (38.75%), Postives = 93/160 (58.13%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLF 574
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +
Sbjct:   36 EITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAY 188          
BLAST of GOLD domain-containing protein vs. Ensembl Human
Match: TMED7-TICAM2 (TMED7-TICAM2 readthrough [Source:HGNC Symbol;Acc:HGNC:33945])

HSP 1 Score: 122.865 bits (307), Expect = 8.837e-31
Identity = 63/161 (39.13%), Postives = 94/161 (58.39%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFW 577
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +W
Sbjct:   36 EITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYW 189          
BLAST of GOLD domain-containing protein vs. Ensembl Human
Match: TMED3 (transmembrane p24 trafficking protein 3 [Source:HGNC Symbol;Acc:HGNC:28889])

HSP 1 Score: 88.1965 bits (217), Expect = 2.648e-20
Identity = 37/92 (40.22%), Postives = 57/92 (61.96%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR 382
            + TFELPD  + CF+E++E   K+   Y+VI GG  DVD  +  P    +Y + K  +D+  ++    G+Y  CFSNEFS+F+HK V+F+ +
Sbjct:   28 ELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQ 119          
BLAST of GOLD domain-containing protein vs. Ensembl Celegans
Match: F57B10.5 (pep chromosome:WBcel235:I:6562699:6563660:1 gene:WBGene00019003.1 transcript:F57B10.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B10.5)

HSP 1 Score: 135.191 bits (339), Expect = 1.338e-37
Identity = 70/183 (38.25%), Postives = 108/183 (59.02%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD    CFYE L+ +   VF ++V+ GG  DVD+ +  PN K +Y+  K  +D++NFK    G Y  CFSNEFS+F+HK V+ + +     +L   A +     A+T +E     I   L  +++YQT +R +E   R  +++LN+ V+ WSL  +  ++  G GQV +LK+FF+DK
Sbjct:   19 ELTFELPDNANQCFYEDLKKDVDTVFEFQVVTGGHYDVDLIIEDPNGKVLYKDTKKQYDSINFKAEVEGTYKACFSNEFSTFSHKIVYMDWQFGDQNALH--AAVTQGAHAMTQLENYAVAIGDKLRTIDDYQTHHRLREATGRKRAEELNERVMIWSLGQSAVVVFIGIGQVFLLKSFFNDK 199          
BLAST of GOLD domain-containing protein vs. Ensembl Celegans
Match: sel-9 (Suppressor/enhancer of lin-12 protein 9 [Source:UniProtKB/Swiss-Prot;Acc:O17528])

HSP 1 Score: 77.411 bits (189), Expect = 2.184e-16
Identity = 47/179 (26.26%), Postives = 82/179 (45.81%), Query Frame = 2
Query:  134 QRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTL--METSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            +  CF+++L    K    + V +GG  D+DVK+  P+ K +Y+  +       F  +  G+Y  CF N+ S+ T K V F +  EI E  Q+  G      A     +E  +  +   L  V+  Q     +E   R ++++ N  V+ W+   A  ++    GQ+  LK FF  + ++
Sbjct:   27 EEQCFFDRLTSGTKMGLMFEVAEGGFLDIDVKITGPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTV--EITEPHQQAPGAAANQDAADNAKLEEMVRELSSALMSVKHEQEYMEVRERVHRNINENTNSRVVMWAAFEAFVLVGMTVGQIFYLKRFFEVRTMV 203          
BLAST of GOLD domain-containing protein vs. Ensembl Celegans
Match: K08E4.6 (pep chromosome:WBcel235:IV:12077107:12078162:-1 gene:WBGene00010670.1 transcript:K08E4.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08E4.6)

HSP 1 Score: 64.3142 bits (155), Expect = 1.207e-11
Identity = 52/203 (25.62%), Postives = 98/203 (48.28%), Query Frame = 2
Query:  110 FTFELPDKQRMCFYEKLEINKKYVF--SYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFD-TVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRP-EIYESLQEE--AGMPVKPSALTL----METSLDNIHV-------HLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIG 667
            FT E+P  +  CF++ +++ K       Y+VI GG  D+++  +  +  N+ ++++   D +   +  + G Y +CF N FS  + K VFFEI   + + +L E   + M    S L+     +  ++D  H        +L++VE +Q L R  E   R +       V FWS++  + ++     QV ++++ F +   IG
Sbjct:   25 FTVEVPAGKFQCFFQPVDLAKHKTLEVDYQVIDGG--DLNINFMILHGANILKQDQLKVDGSHRIELNQPGDYQVCFDNSFSYQSRKVVFFEIFLFDAHGNLDEADLSAMARTDSDLSAKMNELGVTIDEFHRRANGIKNNLNKVEYHQALLRAHEARDRAVMSANFDRVTFWSVVHTLVMVGVAGVQVFMIRSLFEENSKIG 225          
BLAST of GOLD domain-containing protein vs. Ensembl Fly
Match: p24-1 (gene:FBgn0030341 transcript:FBtr0073604)

HSP 1 Score: 137.117 bits (344), Expect = 3.248e-38
Identity = 72/186 (38.71%), Postives = 108/186 (58.06%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPV---KPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            +FTF+L D    CFYE+++ N    F ++V  GGQ DVDV L  P  K +Y   K  FD+  F    TG+Y  CF N+FS+F+HK V+ + +      + EE  +P      + LT METS   IH  L+++ + QT +R +E + R  ++DLNQ V+ WS L    +IV G  Q+++L+ FF+D+
Sbjct:   21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQ------VGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDR 200          
BLAST of GOLD domain-containing protein vs. Ensembl Fly
Match: p24-1 (gene:FBgn0030341 transcript:FBtr0334455)

HSP 1 Score: 137.117 bits (344), Expect = 3.248e-38
Identity = 72/186 (38.71%), Postives = 108/186 (58.06%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPV---KPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            +FTF+L D    CFYE+++ N    F ++V  GGQ DVDV L  P  K +Y   K  FD+  F    TG+Y  CF N+FS+F+HK V+ + +      + EE  +P      + LT METS   IH  L+++ + QT +R +E + R  ++DLNQ V+ WS L    +IV G  Q+++L+ FF+D+
Sbjct:   21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQ------VGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDR 200          
BLAST of GOLD domain-containing protein vs. Ensembl Fly
Match: CHOp24 (gene:FBgn0029709 transcript:FBtr0343566)

HSP 1 Score: 84.7297 bits (208), Expect = 7.701e-19
Identity = 52/175 (29.71%), Postives = 88/175 (50.29%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPS-ALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CF+E +E   K+  ++ VI GG  DVD+K+  P+   ++E  K       F     G Y +CF+NE SS T K V F I  ++ ++ Q   G P +     T +E  +  +   L+ V+  Q     ++   R+++++ N  V+ WS   A+ +++   GQV  LK FF  K ++
Sbjct:   36 CFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSI--DVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKRVV 208          
BLAST of GOLD domain-containing protein vs. Ensembl Fly
Match: CHOp24 (gene:FBgn0029709 transcript:FBtr0070675)

HSP 1 Score: 84.7297 bits (208), Expect = 7.701e-19
Identity = 52/175 (29.71%), Postives = 88/175 (50.29%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPS-ALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CF+E +E   K+  ++ VI GG  DVD+K+  P+   ++E  K       F     G Y +CF+NE SS T K V F I  ++ ++ Q   G P +     T +E  +  +   L+ V+  Q     ++   R+++++ N  V+ WS   A+ +++   GQV  LK FF  K ++
Sbjct:   36 CFFENVEGGTKFGVTFEVIDGGFLDVDIKISGPDNHVMHESEKESSGKYTFVAPAKGTYTVCFNNERSSMTPKLVMFSI--DVGDAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQVYYLKRFFEVKRVV 208          
BLAST of GOLD domain-containing protein vs. Ensembl Fly
Match: CG9308 (gene:FBgn0034681 transcript:FBtr0071749)

HSP 1 Score: 69.3218 bits (168), Expect = 1.820e-13
Identity = 47/200 (23.50%), Postives = 90/200 (45.00%), Query Frame = 2
Query:   77 LVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRP----EIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            LV  +F     F   L   + MCFY+   ++ K   S+ V++GG  DV V++  P+   ++   ++   +  F   + G Y +CF N+ S+ T K + F+       E Y    +     ++ + +   ++ ++ +   L  V+  Q     +      +SD +   VL WS+   + +I+T   +V  LK FF  K ++
Sbjct:    7 LVLVLFQAACGFIVTLDAHETMCFYDHANVSDKVTVSFEVMEGGFKDVGVEIAGPDDDRLHHSKQDTMGSFTFTAMKEGRYQLCFDNKMSTMTPKILMFQFHVARAIEFYMDSSKRVDDVIEQATV---QSMINQLSAKLGAVKMEQEYMHFRYRGHLEVSDMVELRVLAWSIFGPMMLIITAVLEVYYLKHFFEVKRVV 203          
BLAST of GOLD domain-containing protein vs. Ensembl Zebrafish
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 144.05 bits (362), Expect = 1.237e-40
Identity = 72/192 (37.50%), Postives = 112/192 (58.33%), Query Frame = 2
Query:   92 FSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
             S   + TFELPD  + CFYE + I  K    ++V+ GG  DVD +L  P    +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QV++L++FFSD+
Sbjct:   23 LSSASELTFELPDNAKQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RVTALTQMESACVSIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAFWSVGEALILLVVSVSQVLLLRSFFSDR 207          
BLAST of GOLD domain-containing protein vs. Ensembl Zebrafish
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 144.05 bits (362), Expect = 1.237e-40
Identity = 72/192 (37.50%), Postives = 112/192 (58.33%), Query Frame = 2
Query:   92 FSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
             S   + TFELPD  + CFYE + I  K    ++V+ GG  DVD +L  P    +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QV++L++FFSD+
Sbjct:   23 LSSASELTFELPDNAKQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RVTALTQMESACVSIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAFWSVGEALILLVVSVSQVLLLRSFFSDR 207          
BLAST of GOLD domain-containing protein vs. Ensembl Zebrafish
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 144.05 bits (362), Expect = 1.237e-40
Identity = 72/192 (37.50%), Postives = 112/192 (58.33%), Query Frame = 2
Query:   92 FSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
             S   + TFELPD  + CFYE + I  K    ++V+ GG  DVD +L  P    +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QV++L++FFSD+
Sbjct:   23 LSSASELTFELPDNAKQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RVTALTQMESACVSIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAFWSVGEALILLVVSVSQVLLLRSFFSDR 207          
BLAST of GOLD domain-containing protein vs. Ensembl Zebrafish
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 144.05 bits (362), Expect = 1.237e-40
Identity = 72/192 (37.50%), Postives = 112/192 (58.33%), Query Frame = 2
Query:   92 FSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
             S   + TFELPD  + CFYE + I  K    ++V+ GG  DVD +L  P    +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QV++L++FFSD+
Sbjct:   23 LSSASELTFELPDNAKQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RVTALTQMESACVSIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAFWSVGEALILLVVSVSQVLLLRSFFSDR 207          
BLAST of GOLD domain-containing protein vs. Ensembl Zebrafish
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 144.05 bits (362), Expect = 1.237e-40
Identity = 72/192 (37.50%), Postives = 112/192 (58.33%), Query Frame = 2
Query:   92 FSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
             S   + TFELPD  + CFYE + I  K    ++V+ GG  DVD +L  P    +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QV++L++FFSD+
Sbjct:   23 LSSASELTFELPDNAKQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPEGTVLYKEMKKQYDSFTFSAARNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RVTALTQMESACVSIHEALKSVMDYQTHFRLREAQGRSRAEDLNSRVAFWSVGEALILLVVSVSQVLLLRSFFSDR 207          
BLAST of GOLD domain-containing protein vs. Ensembl Xenopus
Match: serinc2 (serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-968901])

HSP 1 Score: 144.821 bits (364), Expect = 1.180e-40
Identity = 75/187 (40.11%), Postives = 111/187 (59.36%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+   +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME+S  +IH  L  V +YQT +R +E + R+ ++DLN  V +WS+  AI ++V   GQV +LK+FFSDK
Sbjct:   37 ELTFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGIVLYKEMKKQYDSFTFTATRNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RATALTQMESSCVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNSRVAYWSIGEAIILLVVSIGQVFLLKSFFSDK 216          
BLAST of GOLD domain-containing protein vs. Ensembl Xenopus
Match: serinc2 (serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-968901])

HSP 1 Score: 144.436 bits (363), Expect = 1.521e-40
Identity = 75/187 (40.11%), Postives = 111/187 (59.36%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+   +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME+S  +IH  L  V +YQT +R +E + R+ ++DLN  V +WS+  AI ++V   GQV +LK+FFSDK
Sbjct:   31 ELTFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGIVLYKEMKKQYDSFTFTATRNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RATALTQMESSCVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNSRVAYWSIGEAIILLVVSIGQVFLLKSFFSDK 210          
BLAST of GOLD domain-containing protein vs. Ensembl Xenopus
Match: tmed1 (transmembrane p24 trafficking protein 1 [Source:NCBI gene;Acc:734138])

HSP 1 Score: 79.337 bits (194), Expect = 1.343e-16
Identity = 58/194 (29.90%), Postives = 93/194 (47.94%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQ-----EEAGMPVKPSALTLMET-----SLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVT-GYGQVVILKTFFSDK 655
            + TF LP  ++ CFY+    N      Y+VI G   DVD  +  P+   +  + +        +  E G Y ICF N FS+ + K VFFE+   I+++ Q     +     V+P  L  ++      S++++   L    + QT+ R  E   R L D   + V FWS  + +G++VT  + QV +LK+ F DK
Sbjct:   26 ELTFLLPAGRQECFYQTTLYNGSMEIEYQVIGGAGLDVDFSVTTPSGILLIMERRRSDGVHTVEPTEAGDYMICFDNSFSTISEKLVFFEL---IFDNQQGDEEPDSWADVVEPDELLDIKLEDIKESIESVKSRLERSIQMQTVLRAFEARDRNLQDSNLERVNFWSA-INVGVLVTVAFLQVYMLKSLFDDK 215          
BLAST of GOLD domain-containing protein vs. Ensembl Xenopus
Match: tmed2 (transmembrane p24 trafficking protein 2 [Source:NCBI gene;Acc:734103])

HSP 1 Score: 77.7962 bits (190), Expect = 3.724e-16
Identity = 47/175 (26.86%), Postives = 87/175 (49.71%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSA-LTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CF+E++    K    + V +GG  D+DV++  P+ K +++ ++       F  +  G Y  CFSN  S+ T K V F I  +I E+ +   G  ++  A    +E  ++ + V ++ V+  Q     +E   R ++D+ N  V+ WS   A+ ++    GQ+  LK FF  + ++
Sbjct:   32 CFFEQVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIHKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTI--DIGEAPK---GQDMETEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV 201          
BLAST of GOLD domain-containing protein vs. Ensembl Xenopus
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:NCBI gene;Acc:549314])

HSP 1 Score: 77.7962 bits (190), Expect = 6.100e-16
Identity = 52/198 (26.26%), Postives = 93/198 (46.97%), Query Frame = 2
Query:   95 SFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEA-----------GMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            S    +TF LP  Q+ CF++ ++ +      Y+V+ G   DVD  L +PN + +  + +      + +T + G Y  CF N FS  + K +FFE+   I + L +E            G  +    L  +  +++++   L++  + QTL +  E   R L +   + V FWS+     ++V    QV +L++ F DK
Sbjct:   25 SVDSDYTFTLPAGQKECFFQPMKRDATLEIEYQVLDGAGLDVDFSLTSPNGELLLSEERQSDGVHSVETID-GDYQFCFDNSFSRMSEKVIFFEL---ILDHLNDEGNELEDWKSYITGTDLLDMKLEDILETINSVKGRLTKSAQIQTLLKAFEARDRNLQESNFERVTFWSVFNLTVMVVVSALQVYMLRSLFEDK 218          
BLAST of GOLD domain-containing protein vs. Ensembl Mouse
Match: Tmed7 (transmembrane p24 trafficking protein 7 [Source:MGI Symbol;Acc:MGI:1913926])

HSP 1 Score: 147.132 bits (370), Expect = 1.247e-41
Identity = 76/187 (40.64%), Postives = 112/187 (59.89%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +WS+  A+ ++V   GQV +LK+FFSDK
Sbjct:   36 EITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSVGQVFLLKSFFSDK 215          
BLAST of GOLD domain-containing protein vs. Ensembl Mouse
Match: Tmed3 (transmembrane p24 trafficking protein 3 [Source:MGI Symbol;Acc:MGI:1913361])

HSP 1 Score: 140.198 bits (352), Expect = 4.148e-39
Identity = 71/183 (38.80%), Postives = 109/183 (59.56%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CF+E++E   K+   Y+VI GG  DVD  +  P    +Y + K  +D+  +KT   G+Y  CFSNEFS+F+HK V+F+ +      +  + G  V  +ALT ME++   IH  L  V + QT YR +E + R  ++DLN  V +WS+   I + V  + QV++LK+FF++K
Sbjct:   32 ELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRV--TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEK 212          
BLAST of GOLD domain-containing protein vs. Ensembl Mouse
Match: Tmed7 (transmembrane p24 trafficking protein 7 [Source:MGI Symbol;Acc:MGI:1913926])

HSP 1 Score: 118.627 bits (296), Expect = 2.986e-31
Identity = 62/160 (38.75%), Postives = 92/160 (57.50%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLF 574
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F     G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +
Sbjct:   36 EITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAY 188          
BLAST of GOLD domain-containing protein vs. Ensembl Mouse
Match: Tmed1 (transmembrane p24 trafficking protein 1 [Source:MGI Symbol;Acc:MGI:106201])

HSP 1 Score: 83.5741 bits (205), Expect = 4.565e-18
Identity = 60/193 (31.09%), Postives = 89/193 (46.11%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEA-----GMPVKPSAL--TLMET---SLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            +FTF LP  ++ CFY+    N      Y+VI G   DVD  L +P    +  +++        +  E G Y +CF N FS+ + K VFFE+   I++S Q+E         V+P  +    ME    S++ +   L    +  TL R  E   R L +D  + V FWS      +++    QV  LK FF DK
Sbjct:   33 EFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADGVHTVEPTEAGDYRLCFDNSFSTISEKLVFFEL---IFDSFQDEEEVEGWAEAVEPEEMLDVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEDNLERVNFWSAANVAVLLLVAVLQVCTLKRFFHDK 222          
BLAST of GOLD domain-containing protein vs. Ensembl Mouse
Match: Tmed5 (transmembrane p24 trafficking protein 5 [Source:MGI Symbol;Acc:MGI:1921586])

HSP 1 Score: 82.0333 bits (201), Expect = 1.626e-17
Identity = 61/204 (29.90%), Postives = 97/204 (47.55%), Query Frame = 2
Query:   80 VNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKN-VYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEE-----------AGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
              +  S    FTF LP  ++ CFY+ + +       Y+V+ GG+ D+D  L +P  +  V+E+ K+  D V+    E G Y  CF N FS+ + K +FFE+   I +++ EE               V    L  +  S+++I   LS+    QTL R  E   R + +     V FWS++  + ++V    QV  LK+ F DK
Sbjct:   26 AGFTPSLDSDFTFTLPAGRKECFYQPMPLKASLEIEYQVLDGGELDIDFHLTSPEGRTLVFEQRKS--DGVHTIETEDGDYMFCFDNTFSTISEKVIFFEL---ILDNMGEEVQGQEDWKKYITNTDVLEMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSVVNLMVMVVVSAIQVYTLKSLFEDK 224          
BLAST of GOLD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y3B3|TMED7_HUMAN (Transmembrane emp24 domain-containing protein 7 OS=Homo sapiens OX=9606 GN=TMED7 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 5.146e-41
Identity = 76/187 (40.64%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +WS+  A+ ++V   GQV +LK+FFSDK
Sbjct:   36 EITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDK 215          
BLAST of GOLD domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZTX0|TMED7_RAT (Transmembrane emp24 domain-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Tmed7 PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.860e-41
Identity = 76/187 (40.64%), Postives = 113/187 (60.43%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CFYE +    K    ++VI GG  DVD +L  P+ K +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+ +    P ++ S         + SALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V +WS+  A+ ++V   GQV +LK+FFSDK
Sbjct:   38 EITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSEN-------RVSALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDK 217          
BLAST of GOLD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q78IS1|TMED3_MOUSE (Transmembrane emp24 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Tmed3 PE=1 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 2.902e-38
Identity = 71/183 (38.80%), Postives = 109/183 (59.56%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD  + CF+E++E   K+   Y+VI GG  DVD  +  P    +Y + K  +D+  +KT   G+Y  CFSNEFS+F+HK V+F+ +      +  + G  V  +ALT ME++   IH  L  V + QT YR +E + R  ++DLN  V +WS+   I + V  + QV++LK+FF++K
Sbjct:   32 ELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPRGNVIYRETKKQYDSFTYKTEAKGVYRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRV--TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEK 212          
BLAST of GOLD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y3Q3|TMED3_HUMAN (Transmembrane emp24 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=TMED3 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.271e-37
Identity = 71/186 (38.17%), Postives = 110/186 (59.14%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK-PI 661
            + TFELPD  + CF+E++E   K+   Y+VI GG  DVD  +  P    +Y + K  +D+  ++    G+Y  CFSNEFS+F+HK V+F+ +      +  + G  V  +ALT ME++   IH  L  V + QT YR +E + R  ++DLN  V +WS+   I + V  + QV++LK+FF++K PI
Sbjct:   28 ELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRV--TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPI 211          
BLAST of GOLD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AY25|TMED3_RAT (Transmembrane emp24 domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Tmed3 PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.346e-37
Identity = 73/186 (39.25%), Postives = 111/186 (59.68%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK-PI 661
            + TFELPD  + CF+E++E   K+   Y+VI GG  DVD  +  P    +Y + K  +D+  +KT   G+Y  CFSNEFS+F+HK V+F+ +      +  + G  V  +ALT ME++   IH  L  V + QT YR +E + R  ++DLN  V +WS+   I + V  + QV++LK+FF++K PI
Sbjct:   32 ELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPMGNIIYRETKKQYDSFTYKTEVKGVYRFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRV--TALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPI 215          
BLAST of GOLD domain-containing protein vs. TrEMBL
Match: A0A267DZB5 (GOLD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013619g1 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 5.260e-53
Identity = 87/194 (44.85%), Postives = 133/194 (68.56%), Query Frame = 2
Query:   98 FPKQFTFELPDKQRMCFYEKLEINK-KYVFS--YRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGY 670
            +PK+F FELPD +  CFYE+   +  K  F+  +RVI+GG NDVD  + AP+ + VYEK K HFD  +  T+  G Y+ CF N+FS+ THK ++F +  +  ESL EEAG    P+A++L++T ++ IH +L  VE  Q++Y+ +E E R +S+DLN+ V+ +S ++A+ ++V G+GQVV+L+TFFSDK  + Y
Sbjct:   21 YPKEFVFELPDNEEFCFYEEFAQDAAKEAFNTVFRVIRGGNNDVDFAITAPDNQKVYEKQKQHFDE-HEHTFRPGTYSFCFGNKFSTITHKQIYFALNRKRPESLAEEAGATNVPTAMSLLQTKMEAIHEYLVTVETVQSIYKVREAEGREISEDLNERVMVFSAILAMAVVVCGFGQVVVLRTFFSDKKSVSY 213          
BLAST of GOLD domain-containing protein vs. TrEMBL
Match: A0A4Z2DSX6 (Transmembrane emp24 domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_007082 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 5.302e-53
Identity = 86/196 (43.88%), Postives = 129/196 (65.82%), Query Frame = 2
Query:   77 LVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYET-GIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPI 661
            L+  +  +P + TFELPD + +CFYE L  ++KYVFSY VI GGQNDVD+ +  P +  V    +   D + F T  + G Y+ CFSNEFSS +HK V+FEIRPE +ESL EEAG+P+ P+ +TL+++ ++ +H +LS  E Y    +N++     +++DLN  V  WS+++   +++T  GQV ILK FFS+K +
Sbjct:   11 LLGSLIGYPSRLTFELPDNEAICFYEDLPASRKYVFSYHVIHGGQNDVDISIKDPKQVIVSNVERGSEDDIPFTTISSNGTYSFCFSNEFSSISHKLVYFEIRPEDFESLAEEAGLPIFPTVMTLLDSVIEVLHHYLSRAEGYGIELKNRDYGDFLVAEDLNSAVFVWSIIITFVVVITSVGQVTILKNFFSEKKV 206          
BLAST of GOLD domain-containing protein vs. TrEMBL
Match: A0A267F3A0 (GOLD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004258g2 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 5.732e-53
Identity = 87/194 (44.85%), Postives = 133/194 (68.56%), Query Frame = 2
Query:   98 FPKQFTFELPDKQRMCFYEKLEINK-KYVFS--YRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGY 670
            +PK+F FELPD +  CFYE+   +  K  F+  +RVI+GG NDVD  + AP+ + VYEK K HFD  +  T+  G Y+ CF N+FS+ THK ++F +  +  ESL EEAG    P+A++L++T ++ IH +L  VE  Q++Y+ +E E R +S+DLN+ V+ +S ++A+ ++V G+GQVV+L+TFFSDK  + Y
Sbjct:   21 YPKEFVFELPDNEEFCFYEEFAQDAAKEAFNTVFRVIRGGNNDVDFAITAPDNQKVYEKQKQHFDE-HEHTFRPGTYSFCFGNKFSTITHKQIYFALNRKRPESLAEEAGATNVPTAMSLLQTKMEAIHEYLVTVETVQSIYKVREAEGREISEDLNERVMVFSAILAMAVVVCGFGQVVVLRTFFSDKKSVSY 213          
BLAST of GOLD domain-containing protein vs. TrEMBL
Match: A0A267FCW8 (GOLD domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004258g1 PE=3 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 6.047e-53
Identity = 87/194 (44.85%), Postives = 133/194 (68.56%), Query Frame = 2
Query:   98 FPKQFTFELPDKQRMCFYEKLEINK-KYVFS--YRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGY 670
            +PK+F FELPD +  CFYE+   +  K  F+  +RVI+GG NDVD  + AP+ + VYEK K HFD  +  T+  G Y+ CF N+FS+ THK ++F +  +  ESL EEAG    P+A++L++T ++ IH +L  VE  Q++Y+ +E E R +S+DLN+ V+ +S ++A+ ++V G+GQVV+L+TFFSDK  + Y
Sbjct:   21 YPKEFVFELPDNEEFCFYEEFAQDATKEAFNTVFRVIRGGNNDVDFAITAPDNQKVYEKQKQHFDE-HEHTFRPGTYSFCFGNKFSTITHKQIYFALNRKRPESLAEEAGATNVPTAMSLLQTKMEAIHEYLVTVETVQSIYKVREAEGREISEDLNERVMVFSAILAMAVVVCGFGQVVVLRTFFSDKKSVSY 213          
BLAST of GOLD domain-containing protein vs. TrEMBL
Match: A0A4E0RLK3 (Putative cop-coated vesicle membrane protein P24 (Emp24/gp25l family) OS=Fasciola hepatica OX=6192 GN=D915_007021 PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 3.233e-52
Identity = 87/201 (43.28%), Postives = 129/201 (64.18%), Query Frame = 2
Query:   89 VFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGYDSVRKTR 691
            VF++PK+FT E+PD +  C YE L   KKY   Y+VI GG  DVD+ +  P K+ ++E  +   + + F ++  G +  CF NEFSS + K V+FE+RP+ YE+L EEAG     + LT+++++L++ H++LS  E  Q   RN+E   R +++DLNQ VL+WS+ V I I VT  GQV ILK FF+DK +  + S R +R
Sbjct:   18 VFAYPKRFTIEIPDGETFCAYENLFAQKKYALMYQVIHGGNLDVDLIIRDPMKRTIHETKRGSHEDIKFDSHVNGTFEFCFGNEFSSLSEKLVYFELRPDPYETLSEEAGEAPHVTVLTMVQSALESAHLYLSHAESTQIELRNRELGDRLVAEDLNQAVLYWSIAVTIAIFVTTLGQVTILKNFFADKKV--FYSTRASR 216          
BLAST of GOLD domain-containing protein vs. Ensembl Cavefish
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 144.821 bits (364), Expect = 5.849e-41
Identity = 77/198 (38.89%), Postives = 114/198 (57.58%), Query Frame = 2
Query:   77 LVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKP-----SALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            L  +V+    + TFELPD  + CFYE + I  K    ++V+ GG  DVD +L  P+   +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+         Q     P+ P     +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A  ++V    QVV+L++FFSDK
Sbjct:   24 LCGWVWG--SELTFELPDNAKQCFYEDITIGTKCTLEFQVVTGGHYDVDCRLEDPDGTVLYKEMKKQYDSFTFTAAKNGTYKFCFSNEFSTFTHKTVYFD--------FQVGEDPPLFPNENRVTALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAFWSIGEAFILLVVSISQVVLLRSFFSDK 211          
BLAST of GOLD domain-containing protein vs. Ensembl Cavefish
Match: tmed3 (transmembrane p24 trafficking protein 3 [Source:NCBI gene;Acc:111192548])

HSP 1 Score: 139.428 bits (350), Expect = 5.506e-39
Identity = 74/185 (40.00%), Postives = 109/185 (58.92%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPV--KPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD ++ CFYE LE   K+   ++VI GG  DVD  +  P    +YE+ K  +D+    T   G+Y +CFSNEFS+F+HK V+ + R       +E   +P   + +ALT ME++  +IH  L  V + QT YR +E + R  ++DLN  V FWS    + + +   GQV+ILK+FFS+K
Sbjct:   20 ELTFELPDNEKQCFYEDLEEGVKFEIDFQVIAGGNYDVDCFVTDPLGNTLYEERKKQYDSFTHTTALKGVYKVCFSNEFSTFSHKTVYLDFRAG-----EETPLLPDMNRATALTQMESACLSIHEILKVVSDTQTWYRLREAQDRIRAEDLNDRVSFWSGGETLILFLVSLGQVLILKSFFSEK 199          
BLAST of GOLD domain-containing protein vs. Ensembl Cavefish
Match: tmed3 (transmembrane p24 trafficking protein 3 [Source:NCBI gene;Acc:111192548])

HSP 1 Score: 135.576 bits (340), Expect = 1.532e-37
Identity = 72/182 (39.56%), Postives = 106/182 (58.24%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPV--KPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFF 646
            + TFELPD ++ CFYE LE   K+   ++VI GG  DVD  +  P    +YE+ K  +D+    T   G+Y +CFSNEFS+F+HK V+ + R       +E   +P   + +ALT ME++  +IH  L  V + QT YR +E + R  ++DLN  V FWS    + + +   GQV+ILK+FF
Sbjct:   20 ELTFELPDNEKQCFYEDLEEGVKFEIDFQVIAGGNYDVDCFVTDPLGNTLYEERKKQYDSFTHTTALKGVYKVCFSNEFSTFSHKTVYLDFRAG-----EETPLLPDMNRATALTQMESACLSIHEILKVVSDTQTWYRLREAQDRIRAEDLNDRVSFWSGGETLILFLVSLGQVLILKSFF 196          
BLAST of GOLD domain-containing protein vs. Ensembl Cavefish
Match: tmed1b (transmembrane emp24 domain-containing protein 1-like [Source:NCBI gene;Acc:103026656])

HSP 1 Score: 93.2041 bits (230), Expect = 1.253e-21
Identity = 62/198 (31.31%), Postives = 90/198 (45.45%), Query Frame = 2
Query:  104 KQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSAL----TLME-------TSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
             + TF LP     CFY+    N      Y+VI G   DVD  +I+P+   +  + +        +  E G Y  CF N FS F+ K VFFE+   I ES   +AG   + + L     L+E        S+D++H HL    + QT+ R  E   R L +D    V FWS    + ++V  + QV  ++  F DK  I
Sbjct:   35 SELTFVLPAGHTECFYQSAARNGTMEVEYQVIAGAGMDVDFSIISPHGVQLVSEFRRSDGVHMVEPTEEGDYQFCFDNSFSRFSEKMVFFEV---ILESSANDAGADDEWAGLGEPENLLEYKLEDIRESMDSVHRHLERSRQMQTVLRAFEARDRNLLEDNLWRVSFWSCTSLMVMLVVAFTQVYTVRRLFDDKRRI 229          
BLAST of GOLD domain-containing protein vs. Ensembl Cavefish
Match: TMED2 (transmembrane emp24 domain-containing protein 2 [Source:NCBI gene;Acc:103022411])

HSP 1 Score: 83.1889 bits (204), Expect = 3.584e-18
Identity = 48/179 (26.82%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYES-----LQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CFYE++    K    + V +GG  D+DV++  P+ K +Y+ ++      +   +  G Y  CFSN+ S+ T K V F I  +I E+     ++ E G     +    +E  ++ + V ++ V+  Q     +E   R ++D+ N  V+ WS   A+ ++    GQ+  LK FF  + ++
Sbjct:   32 CFYERVNSGTKMGLMFEVAEGGFLDIDVEITGPDGKQIYKGDRESSGKYSVAAHMDGTYKFCFSNKMSTMTPKIVMFTI--DIGEAPKGDGMETEVGGGTWDAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV 208          
BLAST of GOLD domain-containing protein vs. Ensembl Sea Lamprey
Match: tmed3 (transmembrane p24 trafficking protein 3 [Source:ZFIN;Acc:ZDB-GENE-030131-8335])

HSP 1 Score: 145.976 bits (367), Expect = 7.328e-42
Identity = 76/183 (41.53%), Postives = 111/183 (60.66%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFEL D  + CFYE ++   K    ++VI GG  DVD ++  P+   +Y +N+  +D+  + T + G Y ICFSNEFS+FTHK V+F+++      L  + G  V   ALT ME++   IH  L  V+ YQT +R QET+ R  ++ LN  V  WS+   I ++V G GQV++LK+FFSDK
Sbjct:   44 EVTFELKDNAKQCFYEDIDQGVKVTLDFQVITGGNYDVDCRVKGPHDSVLYNENRKQYDSYAWTTEQRGTYEICFSNEFSTFTHKTVYFDLQVGEEAPLFRDEGTRV--VALTQMESACVTIHEGLKSVDNYQTQHRLQETQDRHQAEVLNSRVNMWSIGETIILVVVGVGQVMLLKSFFSDK 224          
BLAST of GOLD domain-containing protein vs. Ensembl Sea Lamprey
Match: tmed7 (transmembrane p24 trafficking protein 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2570])

HSP 1 Score: 113.235 bits (282), Expect = 9.780e-30
Identity = 60/178 (33.71%), Postives = 102/178 (57.30%), Query Frame = 2
Query:  122 LPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            LP +Q  C +  +++ +     ++VI GG  DVD ++  P+ + +Y++ +  +D+  +   + GIYAICFSNEFS+F+HK V+F+   +I +             +LT ME++   IH  L  V  YQT +R +E + R  ++ LN  V  WS+   + ++    GQV++LK+FF+DK
Sbjct:   34 LPAQQCRCLFMPIKVGRTCSKEWQVITGGNYDVDCRVEGPSGEILYKEMRKQYDSHVWTAEKKGIYAICFSNEFSTFSHKTVYFDW--QIGDEKPVGKASTNGAVSLTQMESACVTIHEALKSVISYQTHHRLEEAQDRYQAEHLNSRVTLWSVGETLMLLSVVVGQVMLLKSFFADK 209          
BLAST of GOLD domain-containing protein vs. Ensembl Sea Lamprey
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1302])

HSP 1 Score: 85.1149 bits (209), Expect = 1.946e-19
Identity = 54/192 (28.12%), Postives = 89/192 (46.35%), Query Frame = 2
Query:  110 FTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEI----------RPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
             TF L    R CFY+ ++        Y+VI GG+ DVD  + AP+   +  +++      +    E G Y ICF N FS  + K +FFEI          RPE  +++  +  + +K   L  ++ SL+++   LS   + QT+ R  E   R L +     V  WS    + ++     QV ++++ F DK
Sbjct:   39 LTFSLAPGHRECFYQPVKPGTVVEIEYQVIDGGELDVDFTVTAPSGTVLLAEHRQGDGVHSVDVKEEGDYEICFDNSFSHISEKLIFFEILLDHMQPEEERPEWMDAISADHLIGMK---LEDLQESLNSVKARLSRSHQIQTVLRAFEARDRNLQESNLARVNLWSAASVLALMGVSALQVYLVRSLFEDK 227          
BLAST of GOLD domain-containing protein vs. Ensembl Sea Lamprey
Match: tmed5 (transmembrane p24 trafficking protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1302])

HSP 1 Score: 76.2554 bits (186), Expect = 2.350e-16
Identity = 52/200 (26.00%), Postives = 91/200 (45.50%), Query Frame = 2
Query:   95 SFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPS-------------ALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            S    FTF LP  +  CFY+ L         Y+VI G   DVD  + +P  + ++ + +      + +  + G Y  CF N FS  + K VFFE+   I ++++ E     KP+              L  ++ ++DNI   L +  + Q++ R  E   R L +   + V  WS +  + +++    QV  L++ F+D+
Sbjct:   25 SLDGDFTFSLPAGRTECFYQALTAGASMEVEYQVIDGAGMDVDFSISSPTGQVLFAEYRKSEGLQSVEAKQDGDYMFCFDNSFSHVSEKVVFFEV---ILDNMEVEK--DDKPAWKDFVEVDEIIDMKLEDLQETMDNIKTRLGKSIQMQSVLRVYEARDRKLQETNFEMVNLWSGISMVVLVMVAGLQVYTLRSLFNDQ 219          
BLAST of GOLD domain-containing protein vs. Ensembl Sea Lamprey
Match: tmed2 (transmembrane p24 trafficking protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-269])

HSP 1 Score: 58.151 bits (139), Expect = 1.108e-10
Identity = 33/148 (22.30%), Postives = 69/148 (46.62%), Query Frame = 2
Query:  224 VKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSA-LTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            V++  P+ + +Y  ++       F  +  G+Y  CF N+ S+ T K V F I     +  +   G  ++  A    +E  ++ +   ++ V+  Q     +E   R+++D+ N  V+ W+   A+ ++    GQ+  LK FF  + ++
Sbjct:    1 VQITGPDGREIYRGDRESNGKYTFAAHMDGVYKFCFGNKMSTMTPKMVMFTI-----DMGETPKGQDMETEAHQNKLEEMINELATAMTAVKHEQEYMEVRERIHRSVNDNTNSRVVLWAFFEALVLVAMTLGQIYYLKRFFEVRRVV 143          
BLAST of GOLD domain-containing protein vs. Ensembl Yeast
Match: ERP4 (Member of the p24 family involved in ER to Golgi transport; similar to Emp24p and Erv25p; ERP4 has a paralog, ERP2, that arose from the whole genome duplication [Source:SGD;Acc:S000005542])

HSP 1 Score: 55.4546 bits (132), Expect = 1.769e-9
Identity = 49/184 (26.63%), Postives = 87/184 (47.28%), Query Frame = 2
Query:  122 LPDKQRMCFYEKLEINKK-YVFSYRVIKGGQNDVDVKLIAPNKKN-VYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHK-HVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLS--EVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIV-TGYGQVVILKTFFSDK 655
            LP   + C Y  L  +K   V SY+V+ GG  ++D  + AP+    V E+ K H D +  K++  G Y  C SN + +   K  +  E   EI  S + +  + +  +A+  ++ +L+ I   +      E++ +Y    TESR          L W  L+ +G++V     Q +I++ FF+ +
Sbjct:   31 LPAFTKECLYYDLSSDKDVLVVSYQVLTGGNFEIDFDITAPDGSVIVTERQKKHSDFL-LKSFGIGKYTFCLSNNYGTSPKKVEITLEKEKEIVSSHESKEDI-IANNAIEEIDRNLNKITKTMDYLRAREWRNMYTVSSTESR----------LTWLSLLIMGVMVGISIVQALIIQFFFTSR 202          
BLAST of GOLD domain-containing protein vs. Ensembl Nematostella
Match: EDO42051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2I7])

HSP 1 Score: 135.961 bits (341), Expect = 4.037e-38
Identity = 72/183 (39.34%), Postives = 110/183 (60.11%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFEL D  R CFYE+L+ + K    ++VI GG  DVDV L   N+K +Y   K  +D+  F   + GIY  CFSNEFS+ +HK V+F+ +    E  Q    M    +ALT MET+   IH +L    +YQT +R +E++ R +++ LN+ V +WS+  ++ I++ G  QV IL+ FF+++
Sbjct:   25 ELTFELEDNARQCFYEELKKDAKATLEFQVITGGNYDVDVILYDINEKELYSVQKKQYDSHTFTVEQPGIYKFCFSNEFSTISHKTVYFDFQSG--EETQLTKTMGNHHTALTQMETACVTIHENLKIAIDYQTHHRLRESQGRDMAEYLNERVQWWSVGESVLIVIVGICQVFILRQFFAER 205          
BLAST of GOLD domain-containing protein vs. Ensembl Nematostella
Match: EDO35763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKI6])

HSP 1 Score: 81.6481 bits (200), Expect = 5.535e-18
Identity = 51/188 (27.13%), Postives = 87/188 (46.28%), Query Frame = 2
Query:   95 SFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLME---TSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFS 649
            +    FTF +   +R CFYE ++ N      Y+VI+GG  D+   L AP+ K   E      +  +  T E G Y  CF N FS+   K +F ++  +  + +Q+  G+  +     L +    +L+N+ V L + E  Q    +       L+   +  V +WSL+ ++ +I     QV ++K FF 
Sbjct:   30 ALKSGFTFRVDPGKRDCFYETIKRNVTLDVEYQVIEGGDLDIGFTLQAPSGKIAIEDGHRTDEAHSLVTEEEGEYEFCFDNTFSTVASKAIFADLGVDFEDDIQKMIGIKDENLEEDLHDRFVRTLENVRVDLDKAEHIQNFISSAAARDFRLAKSKDSRVFWWSLIQSVALIGVAIVQVNVVKHFFG 217          
BLAST of GOLD domain-containing protein vs. Ensembl Nematostella
Match: EDO49537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ6])

HSP 1 Score: 77.411 bits (189), Expect = 1.037e-16
Identity = 49/175 (28.00%), Postives = 82/175 (46.86%), Query Frame = 2
Query:   95 SFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFS-SFTHKHVFFEIRPEI---YESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIV 607
            SF +   F L   +  CFY+ +    +    +  I G    VDV L  P+   +Y  +K  +D   F T   G Y +CFSN +  +     V+F+    +   + ++           ALT +ETSL  IH +++ +E YQ  YR +E   R  ++ LN  V +WS+  +I +++
Sbjct:   21 SFARHLQFHLSGYE--CFYQDILEKTECSLEFAPITGNDPKVDVTLEDPSGNVIYRVDKKDYDLHKFTTTMNGTYQVCFSNVYDFTIGENLVYFDFIAGVEDEFGTIGTAGETGPASKALTQLETSLSTIHENMNLIERYQNYYRLREANGRIAAESLNSKVQWWSIGQSIIVVL 193          
BLAST of GOLD domain-containing protein vs. Ensembl Nematostella
Match: EDO31547 (Transmembrane emp24 domain-containing protein [Source:UniProtKB/Swiss-Prot;Acc:A7SXK3])

HSP 1 Score: 73.559 bits (179), Expect = 2.363e-15
Identity = 50/179 (27.93%), Postives = 88/179 (49.16%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYE-----SLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CF++K+    K    + V +GG  D+DVK+I P++K +Y   +       F  +  G Y  CFSN+ S+ T K + F +  +I E     S ++ AG       L+ M + L      +   +EY  +   +E   R+++D+ N  V++WS   ++ ++    GQV  LK FF  + ++
Sbjct:   34 CFHDKVTSGTKMGLIFEVAEGGFLDIDVKIIGPDQKVIYSGERETSGKYTFAAHMDGTYNYCFSNKMSTMTPKVLKFSM--DIGEAPKDTSKEDNAG----HDKLSEMVSQLSEAMTGVKHEQEYMEV---RERIHRSINDNTNSRVVWWSFFESLVLVAMTLGQVYYLKRFFEVRRVV 203          
BLAST of GOLD domain-containing protein vs. Ensembl Nematostella
Match: EDO35953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK51])

HSP 1 Score: 52.373 bits (124), Expect = 5.917e-8
Identity = 43/209 (20.57%), Postives = 89/209 (42.58%), Query Frame = 2
Query:   80 VNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVD-----------VKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICF---SNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            + Y+    +   F + + ++ CF E++      +  Y+     +N  D           V++  PN K +  K  +      F ++  G + IC    S  +S +    +   +  ++ E   + A +  K   LT ++  +  +   + ++ + Q   R +E   R  S+  NQ VL+W+L   + ++ TG+ Q+  LK FF  K ++
Sbjct:   10 IGYMLGNVQALYFHMGETEKKCFIEEIPDETMVIGKYKTQLYDENIKDFLPSSPGIGMHVEVKDPNGKIIMSKYYSSEGRFTFTSHTPGEHVICLHSNSTRWSLWAGGRLRIHLDIQVGEHANDYAQIAAK-DKLTELQLRIRQLLDQVEQISKEQNYQRFREERFRMTSESTNQRVLWWALAQTVILLATGFWQMRHLKGFFEAKKLV 217          
BLAST of GOLD domain-containing protein vs. Ensembl Medaka
Match: tmed7 (transmembrane emp24 domain-containing protein 7 [Source:NCBI gene;Acc:101168626])

HSP 1 Score: 146.362 bits (368), Expect = 1.051e-41
Identity = 77/198 (38.89%), Postives = 114/198 (57.58%), Query Frame = 2
Query:   77 LVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKP-----SALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            L  +V     + TFELPD  + CFYE + +  K    ++VI GG  DVD +L  P+   +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+         Q     P+ P     +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QVV+L++FFSDK
Sbjct:   11 LCGWVLG--SELTFELPDNAKQCFYEDITVGTKCTLEFQVITGGHYDVDCRLEDPDGTTLYKEMKKQYDSFTFTAAKNGTYKFCFSNEFSTFTHKTVYFD--------FQVGDDPPLFPNENRVTALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAFWSIGEALILLVVSISQVVLLRSFFSDK 198          
BLAST of GOLD domain-containing protein vs. Ensembl Medaka
Match: tmed7 (transmembrane emp24 domain-containing protein 7 [Source:NCBI gene;Acc:101168626])

HSP 1 Score: 145.591 bits (366), Expect = 2.394e-41
Identity = 74/197 (37.56%), Postives = 116/197 (58.88%), Query Frame = 2
Query:   77 LVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIR----PEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            L  +V     + TFELPD  + CFYE + +  K    ++V+ GG  DVD +L  P+   +Y++ K  +D+  F   + G Y  CFSNEFS+FTHK V+F+ +    P ++ +         + +ALT ME++  +IH  L  V +YQT +R +E + R+ ++DLN  V FWS+  A+ ++V    QVV+L++FFSDK
Sbjct:   18 LCGWVLG--SELTFELPDNAKQCFYEDITVGTKCTLEFQVVTGGHYDVDCRLEDPDGTTLYKEMKKQYDSFTFTAAKNGTYKFCFSNEFSTFTHKTVYFDFQVGDDPPLFPNEN-------RVTALTQMESACVSIHEALKSVIDYQTHFRLREAQGRSRAEDLNTRVAFWSIGEALILLVVSISQVVLLRSFFSDK 205          
BLAST of GOLD domain-containing protein vs. Ensembl Medaka
Match: tmed3 (transmembrane emp24 domain-containing protein 3 [Source:NCBI gene;Acc:101155019])

HSP 1 Score: 140.198 bits (352), Expect = 2.260e-39
Identity = 75/183 (40.98%), Postives = 110/183 (60.11%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TFELPD ++ CFYE+LE + K+   ++VI GG  DVD  +  P    +Y + K  +D+ +  T   G+Y +CFSNEFS+FTHK V+ + R    E L +        +ALT +E+S   IH  L  V + QT YR +E + RT ++ L Q V +WS   A+ + V G GQV++LK+FFS+K
Sbjct:   20 ELTFELPDNEKQCFYEELEKDVKFDIDFQVISGGNYDVDSFVTDPQNNVLYNERKKQYDSFSHTTTMKGVYKVCFSNEFSTFTHKTVYLDFRYGDEEPLLQSM---TGSTALTQLESSCVAIHEILKVVADSQTWYRLREAQDRTKAEHLLQRVTYWSFGEAVFLFVIGIGQVMLLKSFFSEK 199          
BLAST of GOLD domain-containing protein vs. Ensembl Medaka
Match: tmed1b (transmembrane emp24 domain-containing protein 1 [Source:NCBI gene;Acc:101156470])

HSP 1 Score: 84.3445 bits (207), Expect = 1.910e-18
Identity = 57/192 (29.69%), Postives = 82/192 (42.71%), Query Frame = 2
Query:  107 QFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEI---RPEIYESLQEEAGMPVKPSALTL------METSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            + TF LP     CFY+    N      Y+VI G   DVD  +++P    +  +++        +  E G Y ICF N FS F+ K VFFEI    P       EE  M  +P    L      +  S+D ++  L    + QT+ R  E   R L +D    V FWS    + ++     QV  ++  F DK
Sbjct:   38 ELTFLLPAGSSECFYQSAVQNGTMEVEYQVIAGAGMDVDFTIVSPEGVRLIVESRRSDGVHVVEPTEGGDYQICFDNSFSRFSEKMVFFEILTEAPGGDAGGDEEWPMLDEPDGSLLEYKLEDIRDSMDAVYRRLDRSRQMQTVLRAFEARDRNLLEDNLWRVSFWSCASVLVMLCVALTQVYTVRKLFDDK 229          
BLAST of GOLD domain-containing protein vs. Ensembl Medaka
Match: tmed2 (transmembrane emp24 domain-containing protein 2 [Source:NCBI gene;Acc:101161906])

HSP 1 Score: 81.2629 bits (199), Expect = 1.665e-17
Identity = 48/178 (26.97%), Postives = 88/178 (49.44%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQ----EEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CFYE++    K    + V +GG  D+DV+++ P+ K +Y+ ++      +   +  G Y  CFSN+ S+ T K V F I  +I E+ +    E  G     +    +E  ++ + V ++ V+  Q     +E   R ++D+ N  V+ WS   A+ ++    GQ+  LK FF  + ++
Sbjct:   32 CFYERVNSGTKMGLMFEVAEGGFLDIDVEIMGPDGKQIYKGDRESSGKYSVAAHMDGTYKFCFSNKMSTMTPKIVMFTI--DIGEAPKGQNMETEGANSWDAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAMTLGQIYYLKRFFEVRRVV 207          
BLAST of GOLD domain-containing protein vs. Planmine SMEST
Match: SMESG000034989.1 (SMESG000034989.1)

HSP 1 Score: 430.639 bits (1106), Expect = 5.945e-153
Identity = 208/208 (100.00%), Postives = 208/208 (100.00%), Query Frame = 2
Query:   74 NLVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGYDSVRKTRNV 697
            NLVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGYDSVRKTRNV
Sbjct:   12 NLVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPIIGYDSVRKTRNV 219          
BLAST of GOLD domain-containing protein vs. Planmine SMEST
Match: SMESG000038972.1 (SMESG000038972.1)

HSP 1 Score: 158.303 bits (399), Expect = 1.999e-46
Identity = 81/188 (43.09%), Postives = 116/188 (61.70%), Query Frame = 2
Query:   92 FSFPKQFTFELPDKQRMCFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDK 655
            FS   +FTFELPD+QR CFYE L+   + V  Y+VI GG  DVD+ +  P+   +Y K +  +++ +F     GIY +CFSNEFSS THK ++FE +       +EE     K SALT METS  N+H  ++ + E QT  R +E+  R  +++LN  VL+WS+  A+ I+  G GQV +L++FF DK
Sbjct:   13 FSISAEFTFELPDRQRQCFYEDLKSGDRNVIEYQVISGGHYDVDIVIKDPSNNIIYNKERKQYESHSFIPSVNGIYQVCFSNEFSSITHKTIYFEWQS---TEKREEGFEKSKSSALTFMETSAVNLHEAMNNINEEQTHIRLRESIGRYFAEELNSRVLYWSIGQALLIVAVGIGQVFVLRSFFYDK 197          
BLAST of GOLD domain-containing protein vs. Planmine SMEST
Match: SMESG000026239.1 (SMESG000026239.1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.566e-18
Identity = 54/177 (30.51%), Postives = 86/177 (48.59%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFE---IRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CF+++++ +   +  Y V +GG  D+D K++ P+   +Y   K   D   F+T   GIY  CFSN  SS T+K + F    I P   +S       P   S L  M + LD     L+ V+  Q     +E   R ++++ N  VL W++  A  +I+   GQV  LK FF  + ++
Sbjct:   29 CFFDRIKPDTDMLLLYEVAEGGSLDIDAKVLDPSGSILYSAVKKSDDKFTFRTKVDGIYKYCFSNTMSSVTNKILMFSLDTISPAKKDS-------PDSHSKLEEMVSELDK---ALTTVKHEQEYMETREKIHRKINENTNSRVLLWAIFEACVLIIMSAGQVYYLKRFFEVRRVV 195          
BLAST of GOLD domain-containing protein vs. Planmine SMEST
Match: SMESG000069470.1 (SMESG000069470.1)

HSP 1 Score: 78.9518 bits (193), Expect = 6.058e-17
Identity = 46/174 (26.44%), Postives = 85/174 (48.85%), Query Frame = 2
Query:  143 CFYEKLEINKKYVFSYRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            CF+++L    K +  + V++GG  D+DVK+  P+ K +Y  ++       F  +  GIY  CFSN+ S+ T K + F +         +E       + L  M   L N  +++   +EY  +   +E   R+++++ N  V+ WS   A+ ++    GQV  L+ FF  + ++
Sbjct:   31 CFFDRLVSGAKMMLMFEVVEGGFLDIDVKVFGPDGKAIYTGDRESNGKYAFSAHVDGIYKYCFSNKMSTMTPKIIMFSMDVSQKPRENKEMNTDAHQNKLEDMVYELSNSLLNVKHQQEYLEV---RERVHRSINENTNSRVVLWSAFEAVLLLSMTIGQVYYLRRFFEVRRVV 201          
BLAST of GOLD domain-containing protein vs. Planmine SMEST
Match: SMESG000069470.1 (SMESG000069470.1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.457e-14
Identity = 42/159 (26.42%), Postives = 77/159 (48.43%), Query Frame = 2
Query:  188 YRVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNEFSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSEVEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKTFFSDKPII 664
            + V++GG  D+DVK+  P+ K +Y  ++       F  +  GIY  CFSN+ S+ T K + F +         +E       + L  M   L N  +++   +EY  +   +E   R+++++ N  V+ WS   A+ ++    GQV  L+ FF  + ++
Sbjct:    2 FEVVEGGFLDIDVKVFGPDGKAIYTGDRESNGKYAFSAHVDGIYKYCFSNKMSTMTPKIIMFSMDVSQKPRENKEMNTDAHQNKLEDMVYELSNSLLNVKHQQEYLEV---RERVHRSINENTNSRVVLWSAFEAVLLLSMTIGQVYYLRRFFEVRRVV 157          
The following BLAST results are available for this feature:
BLAST of GOLD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMED71.071e-4140.64transmembrane p24 trafficking protein 7 [Source:HG... [more]
TMED32.647e-3838.17transmembrane p24 trafficking protein 3 [Source:HG... [more]
TMED7-TICAM22.309e-3138.75TMED7-TICAM2 readthrough [Source:HGNC Symbol;Acc:H... [more]
TMED7-TICAM28.837e-3139.13TMED7-TICAM2 readthrough [Source:HGNC Symbol;Acc:H... [more]
TMED32.648e-2040.22transmembrane p24 trafficking protein 3 [Source:HG... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F57B10.51.338e-3738.25pep chromosome:WBcel235:I:6562699:6563660:1 gene:W... [more]
sel-92.184e-1626.26Suppressor/enhancer of lin-12 protein 9 [Source:U... [more]
K08E4.61.207e-1125.62pep chromosome:WBcel235:IV:12077107:12078162:-1 ge... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p24-13.248e-3838.71gene:FBgn0030341 transcript:FBtr0073604[more]
p24-13.248e-3838.71gene:FBgn0030341 transcript:FBtr0334455[more]
CHOp247.701e-1929.71gene:FBgn0029709 transcript:FBtr0343566[more]
CHOp247.701e-1929.71gene:FBgn0029709 transcript:FBtr0070675[more]
CG93081.820e-1323.50gene:FBgn0034681 transcript:FBtr0071749[more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed71.237e-4037.50transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed71.237e-4037.50transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed71.237e-4037.50transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed71.237e-4037.50transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed71.237e-4037.50transmembrane p24 trafficking protein 7 [Source:ZF... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serinc21.180e-4040.11serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-... [more]
serinc21.521e-4040.11serine incorporator 2 [Source:Xenbase;Acc:XB-GENE-... [more]
tmed11.343e-1629.90transmembrane p24 trafficking protein 1 [Source:NC... [more]
tmed23.724e-1626.86transmembrane p24 trafficking protein 2 [Source:NC... [more]
tmed56.100e-1626.26transmembrane p24 trafficking protein 5 [Source:NC... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmed71.247e-4140.64transmembrane p24 trafficking protein 7 [Source:MG... [more]
Tmed34.148e-3938.80transmembrane p24 trafficking protein 3 [Source:MG... [more]
Tmed72.986e-3138.75transmembrane p24 trafficking protein 7 [Source:MG... [more]
Tmed14.565e-1831.09transmembrane p24 trafficking protein 1 [Source:MG... [more]
Tmed51.626e-1729.90transmembrane p24 trafficking protein 5 [Source:MG... [more]
back to top
BLAST of GOLD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y3B3|TMED7_HUMAN5.146e-4140.64Transmembrane emp24 domain-containing protein 7 OS... [more]
sp|D3ZTX0|TMED7_RAT5.860e-4140.64Transmembrane emp24 domain-containing protein 7 OS... [more]
sp|Q78IS1|TMED3_MOUSE2.902e-3838.80Transmembrane emp24 domain-containing protein 3 OS... [more]
sp|Q9Y3Q3|TMED3_HUMAN1.271e-3738.17Transmembrane emp24 domain-containing protein 3 OS... [more]
sp|Q6AY25|TMED3_RAT1.346e-3739.25Transmembrane emp24 domain-containing protein 3 OS... [more]
back to top
BLAST of GOLD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DZB55.260e-5344.85GOLD domain-containing protein OS=Macrostomum lign... [more]
A0A4Z2DSX65.302e-5343.88Transmembrane emp24 domain-containing protein OS=S... [more]
A0A267F3A05.732e-5344.85GOLD domain-containing protein OS=Macrostomum lign... [more]
A0A267FCW86.047e-5344.85GOLD domain-containing protein OS=Macrostomum lign... [more]
A0A4E0RLK33.233e-5243.28Putative cop-coated vesicle membrane protein P24 (... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed75.849e-4138.89transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed35.506e-3940.00transmembrane p24 trafficking protein 3 [Source:NC... [more]
tmed31.532e-3739.56transmembrane p24 trafficking protein 3 [Source:NC... [more]
tmed1b1.253e-2131.31transmembrane emp24 domain-containing protein 1-li... [more]
TMED23.584e-1826.82transmembrane emp24 domain-containing protein 2 [S... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed37.328e-4241.53transmembrane p24 trafficking protein 3 [Source:ZF... [more]
tmed79.780e-3033.71transmembrane p24 trafficking protein 7 [Source:ZF... [more]
tmed51.946e-1928.13transmembrane p24 trafficking protein 5 [Source:ZF... [more]
tmed52.350e-1626.00transmembrane p24 trafficking protein 5 [Source:ZF... [more]
tmed21.108e-1022.30transmembrane p24 trafficking protein 2 [Source:ZF... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ERP41.769e-926.63Member of the p24 family involved in ER to Golgi t... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420514.037e-3839.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357635.535e-1827.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495371.037e-1628.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315472.363e-1527.93Transmembrane emp24 domain-containing protein [So... [more]
EDO359535.917e-820.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GOLD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed71.051e-4138.89transmembrane emp24 domain-containing protein 7 [S... [more]
tmed72.394e-4137.56transmembrane emp24 domain-containing protein 7 [S... [more]
tmed32.260e-3940.98transmembrane emp24 domain-containing protein 3 [S... [more]
tmed1b1.910e-1829.69transmembrane emp24 domain-containing protein 1 [S... [more]
tmed21.665e-1726.97transmembrane emp24 domain-containing protein 2 [S... [more]
back to top
BLAST of GOLD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034989.15.945e-153100.00SMESG000034989.1[more]
SMESG000038972.11.999e-4643.09SMESG000038972.1[more]
SMESG000026239.11.566e-1830.51SMESG000026239.1[more]
SMESG000069470.16.058e-1726.44SMESG000069470.1[more]
SMESG000069470.16.457e-1426.42SMESG000069470.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30035002 ID=SMED30035002|Name=GOLD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1177bp
CGTGGCTATAAAAATGTTTGTTTAATTGATTATATTAGTTATGATAATTC
AATTTATATTTTTGATTGTTATTAATTTAGTTAATTATGTATTTTCATTT
CCAAAACAATTCACATTTGAACTTCCAGACAAACAACGAATGTGTTTCTA
TGAAAAATTAGAAATTAATAAAAAATATGTTTTCAGTTACAGAGTTATTA
AAGGCGGACAGAATGATGTTGATGTTAAATTAATTGCTCCAAATAAGAAG
AATGTTTATGAAAAAAATAAAAATCATTTTGATACAGTTAATTTCAAAAC
ATACGAAACAGGAATATATGCAATTTGTTTCAGTAATGAATTCTCTTCAT
TTACTCATAAACATGTATTTTTTGAAATACGACCAGAGATTTATGAATCC
CTTCAAGAAGAAGCTGGGATGCCTGTAAAGCCATCCGCGCTTACATTGAT
GGAAACATCCCTTGACAATATTCATGTTCATTTATCTGAAGTTGAGGAAT
ATCAAACTTTATATCGAAATCAAGAAACTGAGAGCAGAACCTTAAGTGAT
GATTTAAACCAAGGAGTTCTATTCTGGAGTTTATTGGTGGCAATTGGAAT
AATTGTTACTGGATATGGTCAAGTTGTTATACTTAAAACATTTTTCAGTG
ATAAACCTATCATTGGATATGATAGTGTTAGAAAAACAAGAAATGTTTAA
TTCCGATAGTCTTTATTTATTTTTCGCAATGAAAGTTATGGTTGTTGTTT
AATGATATCGTTCTATGAAAATCTTATCAATAAATTGTACTTTTTAATTT
AAGGTAATATTTGTAAATAATTTTTGTTGGAGAATACATTTTGTTCATTT
TCTAATCAATTTTTTGACAAGGTAATTAAGATATAAGCAGTGTGATATTT
TGAGTTTTTGTATATGCAAATATTATTTTAATGTCATTCTGATTTTTCTA
TCATGAGTGCTTGTGCTATTGGATTGAGTGAATTGATATGGATTGAATAA
TATTTGTAAACATGTAGTGTATTGTTAAATTAGAAATTGCATTAATAGTT
GCTGCTTAATTTTTTGTTCTGTTCCAAAATTGATATTTTCAAAATTTCAT
CTTTAACGAAGCTTGATACATGCTGATTATCTTGATTTATTATCCAGTTT
AAATTAAATACTGAAAATGGATGGTTG
back to top

protein sequence of SMED30035002-orf-1

>SMED30035002-orf-1 ID=SMED30035002-orf-1|Name=SMED30035002-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
MIIQFIFLIVINLVNYVFSFPKQFTFELPDKQRMCFYEKLEINKKYVFSY
RVIKGGQNDVDVKLIAPNKKNVYEKNKNHFDTVNFKTYETGIYAICFSNE
FSSFTHKHVFFEIRPEIYESLQEEAGMPVKPSALTLMETSLDNIHVHLSE
VEEYQTLYRNQETESRTLSDDLNQGVLFWSLLVAIGIIVTGYGQVVILKT
FFSDKPIIGYDSVRKTRNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR015718TMED7
IPR015720TMP21-related
IPR036598GOLD_dom_sf
IPR009038GOLD_dom
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009038GOLD domainSMARTSM01190EMP24_GP25L_2coord: 23..203
e-value: 2.7E-45
score: 166.5
IPR009038GOLD domainPFAMPF01105EMP24_GP25Lcoord: 24..202
e-value: 5.6E-38
score: 130.7
IPR009038GOLD domainPROSITEPS50866GOLDcoord: 33..115
score: 17.098
IPR015718Transmembrane emp24 domain-containing protein 7PANTHERPTHR22811:SF117PROTEIN TMED7-TICAM2-RELATEDcoord: 8..205
IPR015720TMP21-relatedPANTHERPTHR22811TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEINcoord: 8..205
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..19
score: 0.537
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
IPR036598GOLD domain superfamilySUPERFAMILYSSF101576Supernatant protein factor (SPF), C-terminal domaincoord: 32..116