THAP-type domain-containing protein

Overview
NameTHAP-type domain-containing protein
Smed IDSMED30034998
Length (bp)2219
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of THAP-type domain-containing protein (SMED30034998) t-SNE clustered cells

Violin plots show distribution of expression levels for THAP-type domain-containing protein (SMED30034998) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of THAP-type domain-containing protein (SMED30034998) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for THAP-type domain-containing protein (SMED30034998) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034998

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034998h1SMcG0005919 SmedASXL_011429SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head marginSMED30034998h1SMcG0023062 SMED30034998smed_20140614PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30034998h1SMcG0005919 dd_Smed_v4_25893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034998h1SMcG0005919 dd_Smed_v4_25893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034998h1SMcG0005919 dd_Smed_v4_25893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30034998h1SMcG0005919 dd_Smed_v4_25893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034998h1SMcG0005919 dd_Smed_v6_25893_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034998h1SMcG0023062 OX_Smed_1.0.11353ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 72.7886 bits (177), Expect = 1.759e-12
Identity = 70/290 (24.14%), Postives = 127/290 (43.79%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQ--------VLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+      C++ E          + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:  608 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLH------CNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 885          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 70.8626 bits (172), Expect = 3.103e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 70.8626 bits (172), Expect = 3.103e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 70.8626 bits (172), Expect = 3.103e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Match: CTBP2 (C-terminal binding protein 2 [Source:HGNC Symbol;Acc:HGNC:2495])

HSP 1 Score: 70.8626 bits (172), Expect = 3.103e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 217.624 bits (553), Expect = 1.440e-60
Identity = 166/540 (30.74%), Postives = 268/540 (49.63%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIF---SSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNV---RQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQN------FDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PV DP+ DK +K+E+PPK  + S + R+K+   A+              E P                S DS    +K  +F  F  +L +   F    SP T +    +LP   + +  ND+L+  ST +N      P S+        R  + ++D  +  V+   L+ +  ++            K L EA A +++ +  L KE +   K ++ +F+IG GI NID  A     I +       +++VAD+ +  +L  +R      KS     +    D+    + +N    ++++ + LGI+G G +  ++  RA+ FG +++ +D  +   +    G E V T++  +   DCI L+ ++       I    L + K G +I++ ++     N + L+  L++ H+ G   +      FD     P     N I+ P +  ++ A  + LR + A E+++ +
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNSDR-RRKQNIPARFP----------RPESP----------------SGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPHTPH--PPVLPDPQQAL--NDILSMTSTRMN-----GPSSS--------RPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQ----VRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGL-INENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCPNIINTPHSAWMTEASCKDLRINAAKEIRKAI 491          
BLAST of THAP-type domain-containing protein vs. Ensembl Celegans
Match: ctbp-1 (C-terminal-binding protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20595])

HSP 1 Score: 68.9366 bits (167), Expect = 7.304e-12
Identity = 81/360 (22.50%), Postives = 162/360 (45.00%), Query Frame = 3
Query:  609 ILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNV---RQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQN------FDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            +LP   + +  ND+L+  ST +N      P S+        R  + ++D  +  V+   L+ +  ++            K L EA A +++ +  L KE +   K ++ +F+IG GI NID  A     I +       +++VAD+ +  +L  +R      KS     +    D+    + +N    ++++ + LGI+G G +  ++  RA+ FG +++ +D  +   +    G E V T++  +   DCI L+ ++       I    L + K G +I++ ++     N + L+  L++ H+ G   +      FD     P     N I+ P +  ++ A  + LR + A E+++ +
Sbjct:   31 VLPDPQQAL--NDILSMTSTRMN-----GPSSS--------RPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQ----VRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGL-INENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCPNIINTPHSAWMTEASCKDLRINAAKEIRKAI 370          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334515)

HSP 1 Score: 79.7221 bits (195), Expect = 3.037e-15
Identity = 75/286 (26.22%), Postives = 123/286 (43.01%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCX-------XXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC----DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   ++W    L KE +   K +R I +IG G  NID  A     I +  +  + ++EVAD  M  +L  YR         + L    +  K F    + VR+    C        G++G G +  ++A RAK FGFNV+ +D  +      + G+  V T++ +L   DC+ L+ ++N      I E  + +++PG F+++   +    +   L+  L+   I       D     P      D  N I  P     S A   +LR+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRR-------TYWLANMVREGKKFTG-PEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN-TARGGLVDDETLALALKQGRI--RAAALDVHENEPYNGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 336          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334514)

HSP 1 Score: 79.7221 bits (195), Expect = 3.042e-15
Identity = 75/286 (26.22%), Postives = 123/286 (43.01%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCX-------XXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC----DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   ++W    L KE +   K +R I +IG G  NID  A     I +  +  + ++EVAD  M  +L  YR         + L    +  K F    + VR+    C        G++G G +  ++A RAK FGFNV+ +D  +      + G+  V T++ +L   DC+ L+ ++N      I E  + +++PG F+++   +    +   L+  L+   I       D     P      D  N I  P     S A   +LR+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRR-------TYWLANMVREGKKFTG-PEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN-TARGGLVDDETLALALKQGRI--RAAALDVHENEPYNGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 336          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334517)

HSP 1 Score: 79.337 bits (194), Expect = 3.643e-15
Identity = 75/286 (26.22%), Postives = 123/286 (43.01%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCX-------XXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC----DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   ++W    L KE +   K +R I +IG G  NID  A     I +  +  + ++EVAD  M  +L  YR         + L    +  K F    + VR+    C        G++G G +  ++A RAK FGFNV+ +D  +      + G+  V T++ +L   DC+ L+ ++N      I E  + +++PG F+++   +    +   L+  L+   I       D     P      D  N I  P     S A   +LR+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRR-------TYWLANMVREGKKFTG-PEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN-TARGGLVDDETLALALKQGRI--RAAALDVHENEPYNGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 336          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0100161)

HSP 1 Score: 78.5666 bits (192), Expect = 7.576e-15
Identity = 75/289 (25.95%), Postives = 123/289 (42.56%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCX-------XXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   ++W    L KE +   K +R I +IG G  NID  A     I +  +  + ++EVAD  M  +L  YR         + L    +  K F    + VR+    C        G++G G +  ++A RAK FGFNV+ +D  +      + G+  V T++ +L   DC+ L+ ++N      I E  + +++PG F+++   +    +   L+  L+   I       D     P         D  N I  P     S A   +LR+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRR-------TYWLANMVREGKKFTG-PEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN-TARGGLVDDETLALALKQGRI--RAAALDVHENEPYNVFQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 339          
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Match: CtBP (gene:FBgn0020496 transcript:FBtr0334513)

HSP 1 Score: 77.411 bits (189), Expect = 8.060e-15
Identity = 74/285 (25.96%), Postives = 123/285 (43.16%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI------LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPN----CDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   ++W    L KE +   K +R I +IG G  NID  A     I +  +  + ++EVAD  M  +L  YR         + L    +  K F              +I+ + LG++G G +  ++A RAK FGFNV+ +D  +      + G+  V T++ +L   DC+ L+ ++N      I E  + +++PG F+++   +    +   L+  L+   I       D     P      D  N I  P     S A   +LR+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRR-------TYWLANMVREGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN-TARGGLVDDETLALALKQGRI--RAAALDVHENEPYNGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 336          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 73.9442 bits (180), Expect = 2.562e-13
Identity = 71/284 (25.00%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     + E  +      I  +     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 73.559 bits (179), Expect = 2.778e-13
Identity = 71/284 (25.00%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     + E  +      I  +     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 73.559 bits (179), Expect = 2.778e-13
Identity = 71/284 (25.00%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     + E  +      I  +     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 73.559 bits (179), Expect = 2.837e-13
Identity = 71/284 (25.00%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     + E  +      I  +     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Match: ctbp2a (C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB-GENE-010130-2])

HSP 1 Score: 73.559 bits (179), Expect = 2.837e-13
Identity = 71/284 (25.00%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     + E  +      I  +     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQAMREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: CTBP2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:493558])

HSP 1 Score: 78.1814 bits (191), Expect = 3.082e-14
Identity = 71/289 (24.57%), Postives = 128/289 (44.29%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCXXXXXXX-------XXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++ N  L +E +   K++R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR        N  L +  +     N + Q +R++ S    + G          +  ++A RAKVFGF+++ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++          S L+  L+   I G     D     P         D  N I  P T   S     ++R++ A EV+R +
Sbjct:  643 IHEKVLNEAVGAMMYHNITLTREDLEKFKSLRIIVRIGSGFDNIDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR-------NTWLYQALREGTRVNSVEQ-IREVASGAARMRGETLGLIGFGRVGQAVAVRAKVFGFSIIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKS-LAQALKEGRIRGAA--LDVHEVEPFIFAQGSLKDAPNLICTPHTAWYSEQASLEMREAAATEVRRAV 920          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: CTBP2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:493558])

HSP 1 Score: 78.1814 bits (191), Expect = 3.239e-14
Identity = 71/289 (24.57%), Postives = 128/289 (44.29%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCXXXXXXX-------XXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++ N  L +E +   K++R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR        N  L +  +     N + Q +R++ S    + G          +  ++A RAKVFGF+++ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++          S L+  L+   I G     D     P         D  N I  P T   S     ++R++ A EV+R +
Sbjct:  643 IHEKVLNEAVGAMMYHNITLTREDLEKFKSLRIIVRIGSGFDNIDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR-------NTWLYQALREGTRVNSVEQ-IREVASGAARMRGETLGLIGFGRVGQAVAVRAKVFGFSIIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKS-LAQALKEGRIRGAA--LDVHEVEPFIFAQGSLKDAPNLICTPHTAWYSEQASLEMREAAATEVRRAV 920          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: CTBP2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:493558])

HSP 1 Score: 78.1814 bits (191), Expect = 3.246e-14
Identity = 71/289 (24.57%), Postives = 128/289 (44.29%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCXXXXXXX-------XXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++ N  L +E +   K++R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR        N  L +  +     N + Q +R++ S    + G          +  ++A RAKVFGF+++ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++          S L+  L+   I G     D     P         D  N I  P T   S     ++R++ A EV+R +
Sbjct:  643 IHEKVLNEAVGAMMYHNITLTREDLEKFKSLRIIVRIGSGFDNIDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR-------NTWLYQALREGTRVNSVEQ-IREVASGAARMRGETLGLIGFGRVGQAVAVRAKVFGFSIIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKS-LAQALKEGRIRGAA--LDVHEVEPFIFAQGSLKDAPNLICTPHTAWYSEQASLEMREAAATEVRRAV 920          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: CTBP2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:493558])

HSP 1 Score: 75.0998 bits (183), Expect = 1.328e-13
Identity = 70/289 (24.22%), Postives = 128/289 (44.29%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCXXXXXXX-------XXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++ N  L +E +   K++R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR        N  L +  +     N + + +R++ S    + G          +  ++A RAKVFGF+++ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++          S L+  L+   I G     D     P         D  N I  P T   S     ++R++ A EV+R +
Sbjct:   58 IHEKVLNEAVGAMMYHNITLTREDLEKFKSLRIIVRIGSGFDNIDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR-------NTWLYQALREGTRVNSV-EQIREVASGAARMRGETLGLIGFGRVGQAVAVRAKVFGFSIIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKS-LAQALKEGRIRG--AALDVHEVEPFIFAQGSLKDAPNLICTPHTAWYSEQASLEMREAAATEVRRAV 335          
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Match: CTBP2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:493558])

HSP 1 Score: 74.7146 bits (182), Expect = 1.578e-13
Identity = 70/288 (24.31%), Postives = 128/288 (44.44%), Query Frame = 3
Query:  834 QNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCXXXXXXX-------XXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
              K L EA   +++ N  L +E +   K++R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR        N  L +  +     N + + +R++ S    + G          +  ++A RAKVFGF+++ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++          S L+  L+   I G     D     P         D  N I  P T   S     ++R++ A EV+R +
Sbjct:   56 HEKVLNEAVGAMMYHNITLTREDLEKFKSLRIIVRIGSGFDNIDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR-------NTWLYQALREGTRVNSV-EQIREVASGAARMRGETLGLIGFGRVGQAVAVRAKVFGFSIIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNTARGGLVDEKS-LAQALKEGRIRG--AALDVHEVEPFIFAQGSLKDAPNLICTPHTAWYSEQASLEMREAAATEVRRAV 332          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp2 (C-terminal binding protein 2 [Source:MGI Symbol;Acc:MGI:1201686])

HSP 1 Score: 72.7886 bits (177), Expect = 1.363e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:  611 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 888          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp2 (C-terminal binding protein 2 [Source:MGI Symbol;Acc:MGI:1201686])

HSP 1 Score: 70.8626 bits (172), Expect = 2.002e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   43 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 320          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp2 (C-terminal binding protein 2 [Source:MGI Symbol;Acc:MGI:1201686])

HSP 1 Score: 70.8626 bits (172), Expect = 2.246e-12
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 69.707 bits (169), Expect = 5.557e-12
Identity = 71/285 (24.91%), Postives = 127/285 (44.56%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINS-----VCDITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCK-----STRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  +     I +  + + S++E AD+ +  +L  YR    +T  +  L E  +      I  +     +I+   LGIIG G +  ++A RAK FGFNV+ +D  +    +   G++ V T++ +L   DC+ L+  +N      + D T +   +++ G F+++   +    +   L+  L+   I G   +         S  P  D  N I  P     S     ++R+  A E++R +
Sbjct:   51 IHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRR---TTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVK---QMRQGAFLVN-TARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAI 328          
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Match: Ctbp1 (C-terminal binding protein 1 [Source:MGI Symbol;Acc:MGI:1201685])

HSP 1 Score: 69.707 bits (169), Expect = 5.931e-12
Identity = 70/282 (24.82%), Postives = 126/282 (44.68%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCK-----STRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  +     I +  + + S++E AD+ +  +L  YR    +T  +  L E  +      I  +     +I+   LGIIG G +  ++A RAK FGFNV+ +D  +    +   G++ V T++ +L   DC+ L+  +N      I +  + +++ G F+++   +    +   L+  L+   I G   +         S  P  D  N I  P     S     ++R+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRR---TTWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAI 339          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q20595|CTBP1_CAEEL (C-terminal-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ctbp-1 PE=1 SV=3)

HSP 1 Score: 217.624 bits (553), Expect = 1.832e-59
Identity = 166/540 (30.74%), Postives = 268/540 (49.63%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIF---SSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNV---RQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQN------FDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PV DP+ DK +K+E+PPK  + S + R+K+   A+              E P                S DS    +K  +F  F  +L +   F    SP T +    +LP   + +  ND+L+  ST +N      P S+        R  + ++D  +  V+   L+ +  ++            K L EA A +++ +  L KE +   K ++ +F+IG GI NID  A     I +       +++VAD+ +  +L  +R      KS     +    D+    + +N    ++++ + LGI+G G +  ++  RA+ FG +++ +D  +   +    G E V T++  +   DCI L+ ++       I    L + K G +I++ ++     N + L+  L++ H+ G   +      FD     P     N I+ P +  ++ A  + LR + A E+++ +
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNSDR-RRKQNIPARFP----------RPESP----------------SGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPHTPH--PPVLPDPQQAL--NDILSMTSTRMN-----GPSSS--------RPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYSETRKTIGADQ----VRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGHDKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGL-INENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCPNIINTPHSAWMTEASCKDLRINAAKEIRKAI 491          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O46036|CTBP_DROME (C-terminal-binding protein OS=Drosophila melanogaster OX=7227 GN=CtBP PE=1 SV=3)

HSP 1 Score: 78.5666 bits (192), Expect = 7.594e-14
Identity = 75/289 (25.95%), Postives = 123/289 (42.56%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCX-------XXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   ++W    L KE +   K +R I +IG G  NID  A     I +  +  + ++EVAD  M  +L  YR         + L    +  K F    + VR+    C        G++G G +  ++A RAK FGFNV+ +D  +      + G+  V T++ +L   DC+ L+ ++N      I E  + +++PG F+++   +    +   L+  L+   I       D     P         D  N I  P     S A   +LR+  A E++R +
Sbjct:   62 IHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRR-------TYWLANMVREGKKFTG-PEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVN-TARGGLVDDETLALALKQGRI--RAAALDVHENEPYNVFQGALKDAPNLICTPHAAFFSDASATELREMAATEIRRAI 339          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0VCQ1|CTBP2_BOVIN (C-terminal-binding protein 2 OS=Bos taurus OX=9913 GN=CTBP2 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.066e-11
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVLFYDPYLQDGTERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P56545|CTBP2_HUMAN (C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.490e-11
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P56546|CTBP2_MOUSE (C-terminal-binding protein 2 OS=Mus musculus OX=10090 GN=Ctbp2 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.571e-11
Identity = 70/284 (24.65%), Postives = 128/284 (45.07%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  N+D  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGF+V+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTVCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAA-RGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A2P4WPR5 (THAP-type domain-containing protein OS=Caenorhabditis remanei OX=31234 GN=FL81_02459 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 3.411e-59
Identity = 167/542 (30.81%), Postives = 270/542 (49.82%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIF---SSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNV---RQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNC--ERNLSILSPYLRSNHIVGYIQN------FDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PV DP+ DK +K+E+PPK  + S + RK+              ++ S  E P                S DS    +K  +F  F  +L +   F    SP T +    +LP   + +  ND+L+  +T +N      P S+        R  + ++D  +  V+   L+ +  ++            K L EA A +++ +  L KE +   K ++ +F+IG GI NID  A     I +       +++VAD+ +  +L  +R      KS     +    D+    + +N    ++++ + LG++G G +  ++  RAK FG +V+ +D  +   +    G E V +++  +   DCI L+ ++       I+   L + KPG FI++ ++     E +L+     L+S H+ G   +      FD     P     N I+ P +  ++ +  ++LR   A E+++ +
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNSDRRRKQN-----------IPNRFSRPESP----------------SGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPQTPHQ--QVLPDPQQAL--NDILSMTNTRMN-----GPSSS--------RPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYTETRKTIGADQ----VRENAVGSKKVRGSVLGVLGCGRVGTAVGLRAKAFGLHVIFYDPFVRDGHDKALGFERVSSLDEFMSRSDCISLHCNLGDETRGIISADTLRQCKPGIFIVNTSHAGLIIENDLAAA---LKSGHVKGAALDVHDSVRFDPNCLNPLIGCPNIINTPHSAWMTESACKELRIQAAKEIRKAI 491          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: H3FBJ9 (Ctbp-1 OS=Pristionchus pacificus OX=54126 GN=WBGene00109143 PE=4 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 3.575e-59
Identity = 178/592 (30.07%), Postives = 280/592 (47.30%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPK-------------------IPRTS------SQGRKKREKSAK-----------LASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNI-------DKITSPISTNSRLNEF--KRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFK-NDKPFNI-----LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQV--------LLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHI-VGYIQNFDCKST----RPN--CDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PVADP+ D PL +++PPK                   + RTS       Q  + RE+  K           LA   L T+  SHS   K  + ++++       S  + ++     NF +     L  L   + +      S+     +Q   N++   +  +L+          I+      SR N     R  + ++D  +  ++ + L+ +  L+       +    K L EA A ++W +  L +  +   K ++ + +IG    NID  A     I +    S  ++E AD  M  +   YRN        F L++      KP  I      C   R+I+   LG++G G + +++A RAK FGFNV+ +D  +    + + G+E V T+  ++   +C+ L+      C +TE+         L  ++ G+FI++ +      ++  LS YL+S HI    +  F+ + T    +PN      N I+   +   S A  ++LR+  A EV+  +
Sbjct:    1 MPTTCGFPNCKFRSRYRGVEDNRHFYRIPKRPFVLRKRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVADPAIDPPLSIDLPPKEGKAPKRAAKSSPPGQKALLGRTSFTPPFLKQNNRPREQWVKKEESEDPEPNNLAKIALSTAAPSHSAGGKCKIGRTIT-------SKRTFIAAPLPPNFPTHDPVFLQKLRDDAAAKFAAKNSVTKKRRQQKKGNEVNHLLENSLHALPLLPDNSDISGIFGMASRANGVVSSRPLVALLDGRDCSIEMSILKDVATLAFCDAQSTSEIHEKVLTEAVAALMWHSIRLERADLEKFKALKVVVRIGSDADNIDIAAATDLGIAVCSTPSGCVEETADTTMSLITGMYRN-------TFMLSQKITMEGKPMPIDTMRTQCAGTRRIRGETLGLVGFGRIGMAVAIRAKTFGFNVIFYDPHVAEGIEKSIGVERVSTLIELVSKSNCLSLH------CPLTEETRHIINDSQLRVMQRGSFIVNTSRGGLISDVD-LSIYLKSGHIRAAALDVFEFEPTGNEYQPNHLATLPNVIATAHSSWYSDAACKELREMAAKEVRHAL 571          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A2A6BJS5 (Ctbp-1 OS=Pristionchus pacificus OX=54126 GN=PRIPAC_45313 PE=4 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 3.575e-59
Identity = 178/592 (30.07%), Postives = 280/592 (47.30%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPK-------------------IPRTS------SQGRKKREKSAK-----------LASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNI-------DKITSPISTNSRLNEF--KRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFK-NDKPFNI-----LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQV--------LLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHI-VGYIQNFDCKST----RPN--CDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PVADP+ D PL +++PPK                   + RTS       Q  + RE+  K           LA   L T+  SHS   K  + ++++       S  + ++     NF +     L  L   + +      S+     +Q   N++   +  +L+          I+      SR N     R  + ++D  +  ++ + L+ +  L+       +    K L EA A ++W +  L +  +   K ++ + +IG    NID  A     I +    S  ++E AD  M  +   YRN        F L++      KP  I      C   R+I+   LG++G G + +++A RAK FGFNV+ +D  +    + + G+E V T+  ++   +C+ L+      C +TE+         L  ++ G+FI++ +      ++  LS YL+S HI    +  F+ + T    +PN      N I+   +   S A  ++LR+  A EV+  +
Sbjct:    1 MPTTCGFPNCKFRSRYRGVEDNRHFYRIPKRPFVLRKRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVADPAIDPPLSIDLPPKEGKAPKRAAKSSPPGQKALLGRTSFTPPFLKQNNRPREQWVKKEESEDPEPNNLAKIALSTAAPSHSAGGKCKIGRTIT-------SKRTFIAAPLPPNFPTHDPVFLQKLRDDAAAKFAAKNSVTKKRRQQKKGNEVNHLLENSLHALPLLPDNSDISGIFGMASRANGVVSSRPLVALLDGRDCSIEMSILKDVATLAFCDAQSTSEIHEKVLTEAVAALMWHSIRLERADLEKFKALKVVVRIGSDADNIDIAAATDLGIAVCSTPSGCVEETADTTMSLITGMYRN-------TFMLSQKITMEGKPMPIDTMRTQCAGTRRIRGETLGLVGFGRIGMAVAIRAKTFGFNVIFYDPHVAEGIEKSIGVERVSTLIELVSKSNCLSLH------CPLTEETRHIINDSQLRVMQRGSFIVNTSRGGLISDVD-LSIYLKSGHIRAAALDVFEFEPTGNEYQPNHLATLPNVIATAHSSWYSDAACKELREMAAKEVRHAL 571          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A261CQW0 (THAP-type domain-containing protein (Fragment) OS=Caenorhabditis latens OX=1503980 GN=FL83_00450 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 3.986e-59
Identity = 168/542 (31.00%), Postives = 268/542 (49.45%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIF---SSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLN--EFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNV---RQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQN------FDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PV DP+ DK +K+E+PPK  + S + RK+              ++ S  E P                S DS    +K  +F  F  +L +   F    SP T +    +LP   + +  ND+L+                TN R+N     R  + ++D  +  V+   L+ +  ++            K L EA A +++ +  L KE +   K ++ +F+IG GI NID  A     I +       +++VAD+ +  +L  +R      KS     +    D+    + +N    ++++ + LGI+G G +  ++  RAK FG +V+ +D  +   +    G E V +++  +   DCI L+ ++       I+   L + KPG FI++ ++     N + L+  L+S H+ G   +      FD     P     N I+ P +  ++ +  ++LR   A E+++ +
Sbjct:    1 MPTTCGFPNCKFRSRYRGLEDNRHFYRIPKRPLILRQRWLTAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQIKIELPPKESKNSDRRRKQN-----------IPNRFSRPESP----------------SGDSPSYSKKSRSFRDFYPSLSSTPSFDPAQSPQTPHQ--QVLPDPQQAL--NDILSM---------------TNPRMNGPSSSRPLVALLDGRDCSVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVAALMYHSIKLEKEDLEKFKVLKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYTETRKTIGADQ----VRENAVGSKKVRGSVLGILGCGRVGTAVGLRAKAFGLHVIFYDPFVRDGHDKALGFERVSSLDEFMSRSDCISLHCNLGDETRGIISADTLRQCKPGIFIVNTSHAGL-INENDLAAALKSGHVKGAALDVHDSVRFDPNCLNPLIGCPNIINTPHSAWMTESACKELRIQAAKEIRKAI 491          
BLAST of THAP-type domain-containing protein vs. TrEMBL
Match: A0A016USN8 (THAP-type domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0028.g1730 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.607e-58
Identity = 171/547 (31.26%), Postives = 258/547 (47.17%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLL--APLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQI-------KSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYI------QNFDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCMKIEF 1661
            MPTTCGFPNCKFRSRYRG +D RHFYR+PK+P  LR +WL AIGRTEET+VSQLR+CS HFEGGEKKEGD+PV DP+ DK L +E+PPK    S  G +KR K +   S+ L   K+               +LP                    F++N L  +P   S+  T    T +LP    Q  N   +  +S+  N++                R  + ++D  +  ++   L+ +  ++            K L EA A +++ +  L KE +   K +R + KIG G  NID  A     I +       I+E+AD  M  +L  YR         + L +     K   +  ++VR++       + + LGIIG G +  ++A RA+ FG N++ +D  +   ++   G+E    ++ +L   D I L+  +       I EQ L + +PG FII+ +         + S YL+S H+ G        + ++     P     N I  P     S +  ++LR + A EV+R +   F
Sbjct:    1 MPTTCGFPNCKFRSRYRGQEDNRHFYRIPKRPQVLRQRWLLAIGRTEETVVSQLRICSAHFEGGEKKEGDIPVPDPTVDKQLNIELPPK---ESKGGERKRNKGSPPISRSLVVRKR---------------QLP-------------------DFLRNPLDTSPCPLSAEPT----TPLLPVERPQ--NIHGIIAMSSARNMNGPAG-----------ARPLVALLDGRDCTIEMPLLKDVATVAFCDAQSTHEIHEKVLNEAVAALMYHSIKLEKEDLEKFKALRVVVKIGYGFDNIDVKAATELGIAVCHTPGDCIEEIADFTMSLILNLYRR-------TYWLAKAVSEGKKV-VGAEHVREVAGGSKRMRGDVLGIIGMGRVGTAVALRARSFGMNIVFYDPFVPDGFEKALGVERCYALDDLLMKSDAISLHCLLTDETRHIINEQTLKQCRPGVFIINTSRGGLVDETDLAS-YLKSGHVRGAALDVHEQEPYEGNMMNPLSQCPNVIHTPHASWFSDSSCKELRVNAAKEVRRAILNRF 484          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000001402.2 (C-terminal binding protein 2 [Source:NCBI gene;Acc:103043993])

HSP 1 Score: 78.1814 bits (191), Expect = 8.167e-15
Identity = 74/284 (26.06%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAKVFGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   T P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   61 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVLFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHETEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 338          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000050975.1 (C-terminal binding protein 2 [Source:NCBI gene;Acc:103043993])

HSP 1 Score: 77.7962 bits (190), Expect = 1.007e-14
Identity = 74/284 (26.06%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAKVFGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   T P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   69 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVLFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHETEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 346          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037920.1 (C-terminal-binding protein 2-like [Source:NCBI gene;Acc:103037620])

HSP 1 Score: 77.411 bits (189), Expect = 1.202e-14
Identity = 76/288 (26.39%), Postives = 129/288 (44.79%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSI----LSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  L     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F++     NC R   +    L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHVLNLYRR---NTWLYQALREGSRVQSVEQIRELASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLV-----NCARGGLVDEKALAQALKEGRIRG--AALDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000000459.2 (C-terminal-binding protein 2-like [Source:NCBI gene;Acc:103037620])

HSP 1 Score: 78.5666 bits (192), Expect = 1.551e-14
Identity = 76/294 (25.85%), Postives = 128/294 (43.54%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQ--------VLLKLKPGNFIIDLNYKNCERNLSI----LSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  L     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+      C++ E          + +++ G F++     NC R   +    L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:  840 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHVLNLYRR---NTWLYQALREGSRVQSVEQIRELASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLH------CNLNEHNHHLINDFTIKQMRQGAFLV-----NCARGGLVDEKALAQALKEGRIRGAA--LDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 1117          
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000057888.1 (C-terminal-binding protein 2-like [Source:NCBI gene;Acc:103037620])

HSP 1 Score: 78.5666 bits (192), Expect = 1.551e-14
Identity = 76/294 (25.85%), Postives = 128/294 (43.54%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQ--------VLLKLKPGNFIIDLNYKNCERNLSI----LSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  L     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+      C++ E          + +++ G F++     NC R   +    L+  L+   I G     D   + P         D  N I  P T   S     ++R++ A E++R +
Sbjct:  840 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGEMGIAVCNIPSAAVEETADSTLCHVLNLYRR---NTWLYQALREGSRVQSVEQIRELASGAARIRGETLGLIGFGRSGQAVAVRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLH------CNLNEHNHHLINDFTIKQMRQGAFLV-----NCARGGLVDEKALAQALKEGRIRGAA--LDVHESEPFSFTQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 1117          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 77.7962 bits (190), Expect = 1.098e-14
Identity = 74/284 (26.06%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAKVFGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   T P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHETEPFTFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 77.411 bits (189), Expect = 1.255e-14
Identity = 74/284 (26.06%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAKVFGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   T P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   56 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHETEPFTFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 333          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 77.411 bits (189), Expect = 1.406e-14
Identity = 74/284 (26.06%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAKVFGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   T P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   81 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHETEPFTFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 358          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: ctbp2a (C-terminal binding protein 2 [Source:NCBI gene;Acc:101175355])

HSP 1 Score: 77.0258 bits (188), Expect = 1.689e-14
Identity = 74/284 (26.06%), Postives = 129/284 (45.42%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAKVFGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++   +    +   L+  L+   I G     D   T P         D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEETADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRSGQAVAVRAKVFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-TARGGLVDEKALAQALKEGRIRG--AALDVHETEPFTFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Match: CTBP2 (C-terminal-binding protein 2 [Source:NCBI gene;Acc:101168811])

HSP 1 Score: 74.7146 bits (182), Expect = 1.112e-13
Identity = 72/282 (25.53%), Postives = 129/282 (45.74%), Query Frame = 3
Query:  831 FQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNI--LCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCK-----STRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
               K L EA   +++    L +E +   K +R I +IG G  NID  A     I +  I S +++E AD+ +  +L  YR    +T     L E  +      I  +     +I+   LG+IG G    ++A RAK FGFNV+ +D  +    + + G++ V T++ +L   DC+ L+ ++N      I +  + +++ G F+++ + +    +   L+  L+   I G   +         S  P  D  N I  P T   S     ++R++ A E++R +
Sbjct:   68 IHEKVLNEAVGAMMYHTITLTREDLEKFKALRIIIRIGSGYDNIDIKAAGELGIAVCNIPSAAVEEAADSTLCHILNLYRR---NTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAIRAKAFGFNVIFYDPYLQDGLERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVN-SARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAI 345          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031097.1 (SMESG000031097.1)

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 566/566 (100.00%), Postives = 566/566 (100.00%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIIDESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCMKIEFNMNKSASAEKYTKSSDEYVAPTTSVESGFFSIKSLADN 1775
            MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIIDESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCLGIIGGGPLSLSIANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCMKIEFNMNKSASAEKYTKSSDEYVAPTTSVESGFFSIKSLADN
Sbjct:    1 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSFMQNLLAPLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIIDESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKNDKPFNILCQNVRQIKSNCLGIIGGGPLSLSIANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNCDFANFISVPLTQTLSPACMQKLRKSTAIEVQRCMKIEFNMNKSASAEKYTKSSDEYVAPTTSVESGFFSIKSLADN 566          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000028189.1 (SMESG000028189.1)

HSP 1 Score: 249.98 bits (637), Expect = 1.650e-73
Identity = 174/485 (35.88%), Postives = 255/485 (52.58%), Query Frame = 3
Query:   78 MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETIVSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKKREKSAKLASQILKTSKKSHSEK-----------------PKISVNQSLSKLPSTDISFDSTLSIEKDNNFNSF--MQNLLAPLI---FSSPSTLNNATSILPYAMRQISNNDLLTTISTTLNIDKITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIF--PTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFK-NDKPFNILCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQVLLKL----KPGNFIIDLN 1439
            MPTTCGFPNCKFRSRYRGSDD RHFYRVPKKP+ LRM+WLEAIGRTEETIVSQLRVCSGHF GGEKKEGDVPV+DPS DK +KVE+PPK  R+SS  ++ + +   L   IL   K   S                   P + +NQ  + +      F    S    N  NSF  + N  +PL    F +P + N         + Q +  D L  +S +                    +  ++I+D   +P+D   L  I         TIE    +  + +     I++   +L+K  ++  ++++H+ KIG  + + D   +  +NI L  I +  +DE+AD ++  +L  YR+    T S +   + F+ N  P N     VR IK   LG+IG G   +++A RA+VFGFNV  +DS++     W  G+  V++++ +L   DCI +N  I+  CD ++ +   L    K G++ ++++
Sbjct:    1 MPTTCGFPNCKFRSRYRGSDDNRHFYRVPKKPAILRMRWLEAIGRTEETIVSQLRVCSGHFPGGEKKEGDVPVSDPSIDKAIKVELPPKSFRSSSTIKRNKRRIKSLGHGILPQLKHFPSNSSLFASSNSNIISNSLTNPPLLMNQHFTNI------FQDLNSNTMSNYINSFGSILNGFSPLFKKPFLAPPSCNGI------PVYQDAPLDRLLKVSNS-------------------NKPAVLILDILPTPIDDVILGTICHYKYINTSTIETMTDEELNFISKANTIVYQK-NLSKTQLLKFRSLKHVVKIGPSLQSEDVREITEKNIALSVISAPCVDEIADTIICLILNLYRHTSFLTNSTYESKQIFEWNRNPHN--SHRVRPIKGQTLGLIGLGQTGIAVAIRARVFGFNVKFYDSTLSPGNDWYLGLRRVDSLQQLLLESDCISVN--IDPACDFSQSISPNLFGYFKKGSYFVNMS 449          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000039168.1 (SMESG000039168.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.211e-15
Identity = 82/337 (24.33%), Postives = 151/337 (44.81%), Query Frame = 3
Query:  687 ITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLN-----ENFKNDKPFNILCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            +T+ I+TN       R  + ++D  +  V+   L+ +  ++       +    + L EA A ++W   +L KE +   K+++ I +IG G  NID  A     I +  +  + ++E AD+ +  +L  YR      ++ +  N     +     +          +I+ + LGIIG G +  ++A RA+ FGF V  +D  +    + + GIE V T++ +L   DC+ L+ S+N      I +  L  ++PG F+++         L+ L+ +L+   I       D     P         D  N I  P +   S A  ++LR++ A EV+R +
Sbjct:    1 MTNRINTNGP--SLPRPLVALLDGRDCTVEMPLLKDVATVAFCDASSTSEIHERVLNEAVAALMWHTINLQKEDLQKFKSLKVIVRIGSGYDNIDIKAAGELGIAVCNVPGYGVEETADSTLCMILNLYR------RTYWLANIVKEGKRIAGPEMLKDAAAGCARIRGDTLGIIGFGRVGTAVAMRAQAFGFRVCFYDPYVPDGVERSMGIERVYTLQDLLYQSDCVSLHCSLNDQTKKLINDHTLKMMRPGAFLVNTARGGLIDELA-LANHLKDGRIRAVA--LDVVENEPFVLADSHLRDAPNVIVTPHSAYFSEASFRELREAAANEVRRAI 326          
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Match: SMESG000039168.1 (SMESG000039168.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.238e-15
Identity = 82/337 (24.33%), Postives = 151/337 (44.81%), Query Frame = 3
Query:  687 ITSPISTNSRLNEFKRQTLVIID--ESPVDWTFLEGIMRLSIFPTIEDAIFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLALKIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLN-----ENFKNDKPFNILCQNVRQIKSNCXXXXXXXXXXXXXANRAKVFGFNVMMFDSSIHGEYKWNTGIESVETVEHILQSCDCIILNPSINSVCD--ITEQVLLKLKPGNFIIDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNC-------DFANFISVPLTQTLSPACMQKLRKSTAIEVQRCM 1649
            +T+ I+TN       R  + ++D  +  V+   L+ +  ++       +    + L EA A ++W   +L KE +   K+++ I +IG G  NID  A     I +  +  + ++E AD+ +  +L  YR      ++ +  N     +     +          +I+ + LGIIG G +  ++A RA+ FGF V  +D  +    + + GIE V T++ +L   DC+ L+ S+N      I +  L  ++PG F+++         L+ L+ +L+   I       D     P         D  N I  P +   S A  ++LR++ A EV+R +
Sbjct:    2 MTNRINTNGP--SLPRPLVALLDGRDCTVEMPLLKDVATVAFCDASSTSEIHERVLNEAVAALMWHTINLQKEDLQKFKSLKVIVRIGSGYDNIDIKAAGELGIAVCNVPGYGVEETADSTLCMILNLYR------RTYWLANIVKEGKRIAGPEMLKDAAAGCARIRGDTLGIIGFGRVGTAVAMRAQAFGFRVCFYDPYVPDGVERSMGIERVYTLQDLLYQSDCVSLHCSLNDQTKKLINDHTLKMMRPGAFLVNTARGGLIDELA-LANHLKDGRIRAVA--LDVVENEPFVLADSHLRDAPNVIVTPHSAYFSEASFRELREAAANEVRRAI 327          
The following BLAST results are available for this feature:
BLAST of THAP-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTBP21.759e-1224.14C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP23.103e-1224.65C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP23.103e-1224.65C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP23.103e-1224.65C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
CTBP23.103e-1224.65C-terminal binding protein 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ctbp-11.440e-6030.74C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
ctbp-17.304e-1222.50C-terminal-binding protein 1 [Source:UniProtKB/Sw... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CtBP3.037e-1526.22gene:FBgn0020496 transcript:FBtr0334515[more]
CtBP3.042e-1526.22gene:FBgn0020496 transcript:FBtr0334514[more]
CtBP3.643e-1526.22gene:FBgn0020496 transcript:FBtr0334517[more]
CtBP7.576e-1525.95gene:FBgn0020496 transcript:FBtr0100161[more]
CtBP8.060e-1525.96gene:FBgn0020496 transcript:FBtr0334513[more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctbp2a2.562e-1325.00C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.778e-1325.00C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.778e-1325.00C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.837e-1325.00C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
ctbp2a2.837e-1325.00C-terminal binding protein 2a [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTBP23.082e-1424.57C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
CTBP23.239e-1424.57C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
CTBP23.246e-1424.57C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
CTBP21.328e-1324.22C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
CTBP21.578e-1324.31C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctbp21.363e-1224.65C-terminal binding protein 2 [Source:MGI Symbol;Ac... [more]
Ctbp22.002e-1224.65C-terminal binding protein 2 [Source:MGI Symbol;Ac... [more]
Ctbp22.246e-1224.65C-terminal binding protein 2 [Source:MGI Symbol;Ac... [more]
Ctbp15.557e-1224.91C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
Ctbp15.931e-1224.82C-terminal binding protein 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of THAP-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q20595|CTBP1_CAEEL1.832e-5930.74C-terminal-binding protein 1 OS=Caenorhabditis ele... [more]
sp|O46036|CTBP_DROME7.594e-1425.95C-terminal-binding protein OS=Drosophila melanogas... [more]
sp|Q0VCQ1|CTBP2_BOVIN1.066e-1124.65C-terminal-binding protein 2 OS=Bos taurus OX=9913... [more]
sp|P56545|CTBP2_HUMAN1.490e-1124.65C-terminal-binding protein 2 OS=Homo sapiens OX=96... [more]
sp|P56546|CTBP2_MOUSE1.571e-1124.65C-terminal-binding protein 2 OS=Mus musculus OX=10... [more]
back to top
BLAST of THAP-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P4WPR53.411e-5930.81THAP-type domain-containing protein OS=Caenorhabdi... [more]
H3FBJ93.575e-5930.07Ctbp-1 OS=Pristionchus pacificus OX=54126 GN=WBGen... [more]
A0A2A6BJS53.575e-5930.07Ctbp-1 OS=Pristionchus pacificus OX=54126 GN=PRIPA... [more]
A0A261CQW03.986e-5931.00THAP-type domain-containing protein (Fragment) OS=... [more]
A0A016USN83.607e-5831.26THAP-type domain-containing protein OS=Ancylostoma... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000001402.28.167e-1526.06C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ENSAMXT00000050975.11.007e-1426.06C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ENSAMXT00000037920.11.202e-1426.39C-terminal-binding protein 2-like [Source:NCBI gen... [more]
ENSAMXT00000000459.21.551e-1425.85C-terminal-binding protein 2-like [Source:NCBI gen... [more]
ENSAMXT00000057888.11.551e-1425.85C-terminal-binding protein 2-like [Source:NCBI gen... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THAP-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctbp2a1.098e-1426.06C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ctbp2a1.255e-1426.06C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ctbp2a1.406e-1426.06C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
ctbp2a1.689e-1426.06C-terminal binding protein 2 [Source:NCBI gene;Acc... [more]
CTBP21.112e-1325.53C-terminal-binding protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of THAP-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000031097.10.000e+0100.00SMESG000031097.1[more]
SMESG000028189.11.650e-7335.88SMESG000028189.1[more]
SMESG000039168.11.211e-1524.33SMESG000039168.1[more]
SMESG000039168.11.238e-1524.33SMESG000039168.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034998 ID=SMED30034998|Name=THAP-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2219bp
ACTTATTGTAACAGTAAATCTCTAATCTCTTTGAAATCCGCGTTAACCCA
GTTCAGATTTCATATTTTTTCAAAACAATGCCAACAACATGTGGATTTCC
CAATTGCAAATTTCGTTCTCGGTATCGTGGTTCTGATGACATTCGACATT
TCTATCGGGTTCCAAAGAAACCGTCACATTTGCGAATGAAATGGCTGGAA
GCTATTGGAAGAACGGAGGAAACCATTGTCAGCCAGCTTCGAGTGTGTAG
TGGTCATTTTGAAGGTGGAGAAAAGAAAGAGGGCGACGTACCAGTTGCAG
ATCCATCGACAGATAAACCATTGAAAGTGGAAATTCCTCCGAAAATTCCC
AGAACATCAAGTCAGGGAAGAAAAAAAAGGGAAAAATCCGCTAAATTAGC
ATCGCAAATTTTAAAAACATCAAAAAAATCTCATTCTGAAAAACCTAAAA
TCTCCGTCAATCAATCCTTATCTAAACTGCCTTCTACAGATATTAGCTTT
GATTCGACTTTATCAATTGAAAAGGATAACAATTTCAATAGTTTTATGCA
AAATCTTTTGGCTCCTTTGATCTTTTCATCTCCCTCAACTCTCAACAATG
CTACATCTATTCTACCCTATGCAATGAGACAAATTAGCAATAATGATCTC
TTAACAACGATCAGTACGACTCTTAATATTGATAAAATTACAAGTCCAAT
TTCAACCAATTCTCGCCTGAACGAATTCAAACGGCAAACCTTAGTCATCA
TTGACGAGTCTCCGGTAGATTGGACATTTTTAGAAGGAATTATGCGATTA
TCAATTTTCCCAACAATTGAAGATGCTATTTTTCAGAACAAAGATTTAGT
GGAGGCGGACGCGTTGATAATATGGGATAATTGTGATTTGGCAAAGGAAT
CTGTAATTCACATGAAAAATATGAGGCACATTTTCAAGATTGGATGTGGA
ATTGGAAATATCGACAATTTAGCACTAAAGATTAGAAATATACAATTGCA
TGAAATAATATCCCATTCGATTGATGAGGTTGCAGACAATGTCATGCTAA
GCCTATTAAAATTTTATCGAAATGGTGTTGGAAGCACAAAATCTAATTTT
TGTTTGAATGAAAATTTCAAAAACGATAAACCTTTCAACATTCTATGTCA
AAATGTGAGGCAGATCAAGTCAAATTGTCTTGGGATTATTGGAGGAGGCC
CGTTATCTTTGTCCATTGCAAATAGAGCAAAAGTGTTCGGATTTAATGTC
ATGATGTTTGATAGCAGCATACATGGGGAATACAAGTGGAATACTGGTAT
TGAATCAGTTGAGACTGTGGAACATATTTTACAAAGTTGTGACTGTATTA
TTTTGAATCCTTCCATAAATTCAGTCTGTGATATCACAGAGCAGGTCCTT
CTCAAATTGAAACCAGGGAATTTCATCATTGATTTAAACTATAAAAACTG
TGAAAGAAATCTTTCGATTTTGTCGCCTTATCTTAGATCAAATCATATTG
TTGGATATATTCAGAATTTCGATTGTAAATCAACAAGGCCGAATTGTGAC
TTCGCGAATTTCATATCAGTGCCTCTTACACAGACTCTAAGTCCTGCTTG
TATGCAGAAATTAAGAAAATCAACAGCCATTGAAGTGCAACGGTGTATGA
AGATCGAATTTAATATGAACAAAAGCGCGTCTGCAGAGAAATATACAAAA
TCATCAGATGAATATGTCGCACCAACAACATCAGTTGAATCCGGCTTCTT
CAGTATCAAATCTCTTGCGGACAACTAACACTTCAACCAGTGATCGTCTC
TGGTTTTGTCATTAATGAATTCGTGCCCATAGTTTTTTCAATTGAATTTC
CATTCAATTCATTTACTACTTCAGATGCATCGAAAAATTCGGATTTTTAT
TTATTTGTTCTCGTTATTGATATTAGAAAGTTTACTTTTGATTTCCATCA
GTGTAAATAGTGCTGAGTGTAAAATGATCGTTTTTGCCGAATTACTGATT
ATTATAATTTATTACAATGCGTTAATCACATTTATAGAATGGAGGTATTG
AAATTTTAGAGTTTTTTTTTTGAAAATTTAATTTGAAGAAAATGTAATTA
TTGATATAAAATGAGAATTGAATTAAAAAGTTGTGTAATTTTTATTGTTT
AAAATATCGATTTTAAAAACTGCTAGAAAAATGTTTTATTTTGCCCGTTA
ACGCATTTTTATTGGCTGC
back to top

protein sequence of SMED30034998-orf-1

>SMED30034998-orf-1 ID=SMED30034998-orf-1|Name=SMED30034998-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=567bp
MPTTCGFPNCKFRSRYRGSDDIRHFYRVPKKPSHLRMKWLEAIGRTEETI
VSQLRVCSGHFEGGEKKEGDVPVADPSTDKPLKVEIPPKIPRTSSQGRKK
REKSAKLASQILKTSKKSHSEKPKISVNQSLSKLPSTDISFDSTLSIEKD
NNFNSFMQNLLAPLIFSSPSTLNNATSILPYAMRQISNNDLLTTISTTLN
IDKITSPISTNSRLNEFKRQTLVIIDESPVDWTFLEGIMRLSIFPTIEDA
IFQNKDLVEADALIIWDNCDLAKESVIHMKNMRHIFKIGCGIGNIDNLAL
KIRNIQLHEIISHSIDEVADNVMLSLLKFYRNGVGSTKSNFCLNENFKND
KPFNILCQNVRQIKSNCLGIIGGGPLSLSIANRAKVFGFNVMMFDSSIHG
EYKWNTGIESVETVEHILQSCDCIILNPSINSVCDITEQVLLKLKPGNFI
IDLNYKNCERNLSILSPYLRSNHIVGYIQNFDCKSTRPNCDFANFISVPL
TQTLSPACMQKLRKSTAIEVQRCMKIEFNMNKSASAEKYTKSSDEYVAPT
TSVESGFFSIKSLADN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR038441THAP_Znf_sf
IPR036291NAD(P)-bd_dom_sf
IPR006612THAP_Znf
IPR016040NAD(P)-bd_dom
IPR006140D-isomer_DH_NAD-bd
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0051287NAD binding
GO:0003677DNA binding
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006612THAP-type zinc fingerSMARTSM00980THAP_2coord: 3..85
e-value: 0.0012
score: 28.2
IPR006612THAP-type zinc fingerPFAMPF05485THAPcoord: 5..69
e-value: 2.8E-9
score: 37.8
IPR006612THAP-type zinc fingerPROSITEPS50950ZF_THAPcoord: 1..79
score: 13.765
IPR006140D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding domainPFAMPF028262-Hacid_dh_Ccoord: 360..451
e-value: 1.6E-7
score: 30.8
IPR038441THAP-type zinc finger superfamilyGENE3DG3DSA:3.30.40.180coord: 1..89
e-value: 5.2E-39
score: 134.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 235..524
e-value: 3.3E-29
score: 103.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 315..503
e-value: 3.3E-29
score: 103.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 65..106
NoneNo IPR availablePANTHERPTHR46029:SF7C-TERMINAL-BINDING PROTEINcoord: 4..524
NoneNo IPR availablePANTHERPTHR46029FAMILY NOT NAMEDcoord: 4..524
NoneNo IPR availableSUPERFAMILYSSF52283Formate/glycerate dehydrogenase catalytic domain-likecoord: 226..332
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 1..66
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 318..478