Low density lipoprotein-receptor, class A,domain-containing protein

Overview
NameLow density lipoprotein-receptor, class A,domain-containing protein
Smed IDSMED30034987
Length (bp)902
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low density lipoprotein-receptor, class A,domain-containing protein (SMED30034987) t-SNE clustered cells

Violin plots show distribution of expression levels for Low density lipoprotein-receptor, class A,domain-containing protein (SMED30034987) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low density lipoprotein-receptor, class A,domain-containing protein (SMED30034987) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low density lipoprotein-receptor, class A,domain-containing protein (SMED30034987) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034987

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034987SMESG000059509.1 SmedASXL_028927SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034987SMESG000059509.1 SmedASXL_003643SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30034987SMESG000059509.1 dd_Smed_v4_6710_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034987SMESG000059509.1 dd_Smed_v4_6710_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30034987SMESG000059509.1 dd_Smed_v4_6710_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034987SMESG000059509.1 Contig20664newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034987SMESG000059509.1 Contig20664uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30034987SMESG000059509.1 dd_Smed_v6_6710_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034987SMESG000059509.1 OX_Smed_1.0.16337ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Match: F58H1.7 (NMDA receptor auxiliary protein [Source:UniProtKB/TrEMBL;Acc:G5EEF9])

HSP 1 Score: 63.5438 bits (153), Expect = 5.843e-12
Identity = 37/135 (27.41%), Postives = 62/135 (45.93%), Query Frame = 3
Query:  207 AFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFI-----TKYKDWLIPNY--------LGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIEL 572
            A +   CP   P+ C + G C+   ++CDG  DC D YDE++++CTA  RPP      F+        KD+L+  +         G G  +KV+  L ++     +   M +   E ++   ++E +  G   EL
Sbjct:   29 ADAATPCPTWHPFACPS-GECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLVKVFGPKAKAELSGMGGVDKVAVALSQTPTADLFASEMKLDDGETQHMLEVMEGILNGSTDEL 162          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Match: F58H1.7 (NMDA receptor auxiliary protein [Source:UniProtKB/TrEMBL;Acc:G5EEF9])

HSP 1 Score: 63.5438 bits (153), Expect = 5.932e-12
Identity = 36/129 (27.91%), Postives = 60/129 (46.51%), Query Frame = 3
Query:  225 CPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFI-----TKYKDWLIPNY--------LGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIEL 572
            CP   P+ C + G C+   ++CDG  DC D YDE++++CTA  RPP      F+        KD+L+  +         G G  +KV+  L ++     +   M +   E ++   ++E +  G   EL
Sbjct:   37 CPTWHPFACPS-GECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLVKVFGPKAKAELSGMGGVDKVAVALSQTPTADLFASEMKLDDGETQHMLEVMEGILNGSTDEL 164          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0083762)

HSP 1 Score: 80.8777 bits (198), Expect = 9.839e-18
Identity = 46/155 (29.68%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  225 CPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYL----GS---------GTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            C   +P+ C   G C+S  ++CDG  DC D YDED  LCTA  RPP      F+        PNYL    GS         G  EKV+  L ES+  +++  ++++   + E+ +S+  +V+ G    L   G+      ++     ++V +GF+
Sbjct:   64 CHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0083763)

HSP 1 Score: 80.8777 bits (198), Expect = 9.839e-18
Identity = 46/155 (29.68%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  225 CPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYL----GS---------GTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            C   +P+ C   G C+S  ++CDG  DC D YDED  LCTA  RPP      F+        PNYL    GS         G  EKV+  L ES+  +++  ++++   + E+ +S+  +V+ G    L   G+      ++     ++V +GF+
Sbjct:   64 CHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0330030)

HSP 1 Score: 80.1073 bits (196), Expect = 2.800e-17
Identity = 46/155 (29.68%), Postives = 74/155 (47.74%), Query Frame = 3
Query:  225 CPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYL----GS---------GTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            C   +P+ C   G C+S  ++CDG  DC D YDED  LCTA  RPP      F+        PNYL    GS         G  EKV+  L ES+  +++  ++++   + E+ +S+  +V+ G    L   G+      ++     ++V +GF+
Sbjct:   64 CHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|E2AX35|PROH4_CAMFO (IDLSRF-like peptide OS=Camponotus floridanus OX=104421 GN=EAG_01737 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.145e-18
Identity = 45/157 (28.66%), Postives = 75/157 (47.77%), Query Frame = 3
Query:  219 NNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGS-------------GTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            + C   +P+ C   G+C+S  ++CDG  DC D YDED  LCTA  RPP      F+        PNYL               G  EKV+  L ES+  +++  ++++   + E+ +S+  +V+ G    L   G+      ++     ++VK+GF+
Sbjct:   44 DACHPYEPFKCPGDGLCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETATFLQSLLASHGPNYLEKLFGNKARDTLKPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFL 200          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|P85831|PROH4_APIME (Prohormone-4 OS=Apis mellifera OX=7460 PE=1 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.399e-17
Identity = 45/159 (28.30%), Postives = 75/159 (47.17%), Query Frame = 3
Query:  213 SGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYL----GS---------GTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            SG+ C   +P+ C     C+S  ++CDG  DC D YDED  LCTA  RPP      F+        PNYL    G+         G    V+  L ES+  +++  ++++   + E+ +S+  +V+ G    L   G+      ++     ++VK+GF+
Sbjct:   43 SGDACRPYEPFKCPGDDTCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETASFLQSLLASHGPNYLEKLFGTKARDTLKPLGGVNTVAIALSESQTIEDFGAALHLLRTDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFL 201          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|A0A0F7YYX3|CPROH_CONVC (Neuropeptide prohormone-4 OS=Conus victoriae OX=319920 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.852e-16
Identity = 40/149 (26.85%), Postives = 69/149 (46.31%), Query Frame = 3
Query:  201 EKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGF 647
            ++     +C  + P+ C+    CL    +C+G  DC+   DED  LC A  RP   ++ +F+   +DW++PN       + V+  L E+ +  +    +N+T +  EN ++       G    L+  GMP RAW E+  L   +   G 
Sbjct:   43 KRTLCPEDCDIASPFKCEESPTCLRLFQVCNGRWDCEHGSDEDNALCAAVLRPLECMIWEFLEGQRDWILPNLFNDANTDLVAHALHEAYSMGDLQSYLNLTDQNIENIRNSTRGAIVGDPRPLMALGMPDRAWPEVMYLLKELYNLGL 191          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: G7YUJ9 (Prohormone-4 OS=Clonorchis sinensis OX=79923 GN=CLF_111265 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 4.058e-52
Identity = 81/148 (54.73%), Postives = 105/148 (70.95%), Query Frame = 3
Query:  207 AFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            A  GN+CPESKPWPC+TPG+CLSF  ICDGE DC + YDED+ +CTAK RP    L  FI KY++WLIP+ LG G PE ++T L+ES+N  +Y ++ ++TP + +    LL  VK G+QI L M GMP  AW+EL +LF RI  SGF+
Sbjct:   43 ANRGNDCPESKPWPCRTPGICLSFALICDGEPDCPEEYDEDQEMCTAKLRPAEEHLQGFINKYREWLIPDILGEGKPEDLATKLVESRNIVDYARAAHLTPAQVQRLVELLMGVKSGKQILLHMMGMPLGAWSELYVLFYRIYLSGFL 190          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A3R7FID4 (IDLSRF-like peptide OS=Clonorchis sinensis OX=79923 GN=CSKR_544s PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.052e-51
Identity = 82/155 (52.90%), Postives = 107/155 (69.03%), Query Frame = 3
Query:  186 RLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            R    + A  GN+CPESKPWPC+TPG+CLSF  ICDGE DC + YDED+ +CTAK RP    L  FI KY++WLIP+ LG G PE ++T L+ES+N  +Y ++ ++TP + +    LL  VK G+QI L M GMP  AW+EL +LF RI  SGF+
Sbjct:   55 RCELSDTANRGNDCPESKPWPCRTPGICLSFALICDGEPDCPEEYDEDQEMCTAKLRPAEEHLQGFINKYREWLIPDILGEGKPEDLATKLVESRNIVDYARAAHLTPAQVQRLVELLMGVKSGKQILLHMMGMPLGAWSELYVLFYRIYLSGFL 209          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A5K3F2A5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.820e-51
Identity = 85/198 (42.93%), Postives = 124/198 (62.63%), Query Frame = 3
Query:   60 IPEMFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFS-GNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            +P    + +L +E+ FLL            + +  KI   P RL   +   +  N+CPES PWPC++P  CLSFDFICDG+ DC D YDED+ +CTAK RPP   L +FI +Y+DWLIP +LG G P  ++T L+ES + ++Y KS  +   +  N +SL+E V + ++++L++ GMP  AW+EL  LF RI +SGF+
Sbjct:    2 VPSQAIRRLLIVEVVFLL-----------RSGLSSKI---PTRLGNADSNRTIANDCPESSPWPCRSPNFCLSFDFICDGDLDCPDGYDEDQEMCTAKQRPPIEYLYRFIKRYQDWLIPEFLGEGEPFDLATKLVESPSIEDYAKSARLAQHQLANLRSLIEGVVQRKEMQLVLLGMPLGAWSELFYLFDRIARSGFV 185          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A4S2L9Y8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008860 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 6.078e-51
Identity = 80/148 (54.05%), Postives = 104/148 (70.27%), Query Frame = 3
Query:  207 AFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            A  GN+CPESKPWPC+TPG+CLSF  ICDGE DC + YDED+ +CTAK RP    L  FI KY++WLIP+ LG G PE ++T L+ES+N  +Y ++ ++T  + +    LL  VK G+QI L M GMP  AW+EL +LF RI  SGF+
Sbjct:   28 ANRGNDCPESKPWPCRTPGICLSFALICDGEPDCPEEYDEDQEMCTAKLRPAEEHLQGFINKYREWLIPDILGEGKPEDLATKLVESRNIVDYARAAHLTQAQVQRLIELLMGVKSGKQILLHMMGMPLGAWSELYVLFYRIYLSGFL 175          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: W6UW14 (Prohormone-4 OS=Echinococcus granulosus OX=6210 GN=EGR_02423 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 8.763e-51
Identity = 77/150 (51.33%), Postives = 105/150 (70.00%), Query Frame = 3
Query:  216 GNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT*IKS 665
             N CPES PWPC+ PG CLSFDFICDGE DC D YDED  +CTAK RPP   L +FI +Y+DWLIP +LG GTP +++  L+ES   ++Y +S ++T ++  N  SL+E V + +++ +++ GMP  AW+EL  LF RIV SGF+  + S
Sbjct:   70 ANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKQRPPIEYLFRFIQRYQDWLIPTFLGKGTPLELAKKLVESPTIEDYARSAHLTEKQLVNLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFVGTVDS 219          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000059509.1 (SMESG000059509.1)

HSP 1 Score: 424.476 bits (1090), Expect = 3.033e-151
Identity = 204/205 (99.51%), Postives = 204/205 (99.51%), Query Frame = 3
Query:   39 KKNCIYRIPEMFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT 653
            K NCIYRIPEMFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT
Sbjct:   63 KINCIYRIPEMFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT 267          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000059509.1 (SMESG000059509.1)

HSP 1 Score: 402.134 bits (1032), Expect = 1.731e-143
Identity = 195/195 (100.00%), Postives = 195/195 (100.00%), Query Frame = 3
Query:   69 MFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT 653
            MFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT
Sbjct:    1 MFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT 195          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000021406.1 (SMESG000021406.1)

HSP 1 Score: 219.935 bits (559), Expect = 6.918e-72
Identity = 97/146 (66.44%), Postives = 118/146 (80.82%), Query Frame = 3
Query:  213 SGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            SGN CPES+PWPCKTPG CLSFDFICDGE DC D YDED++LCTAKNRPPF +L++F+ KY+ WLIP YLG GT  +++T+LIES N +EY   M +T ++ ++   LL +VKEGRQIELIM GMPPRAWNEL +LFGRI  SGF+
Sbjct:   28 SGNGCPESQPWPCKTPGQCLSFDFICDGEPDCPDKYDEDQSLCTAKNRPPFEVLDKFLLKYESWLIPKYLGQGTHTQIATYLIESTNAEEYSNKMKLTQQQKKDLMDLLTAVKEGRQIELIMEGMPPRAWNELYLLFGRIASSGFL 173          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000021406.1 (SMESG000021406.1)

HSP 1 Score: 219.935 bits (559), Expect = 7.392e-72
Identity = 97/146 (66.44%), Postives = 118/146 (80.82%), Query Frame = 3
Query:  213 SGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            SGN CPES+PWPCKTPG CLSFDFICDGE DC D YDED++LCTAKNRPPF +L++F+ KY+ WLIP YLG GT  +++T+LIES N +EY   M +T ++ ++   LL +VKEGRQIELIM GMPPRAWNEL +LFGRI  SGF+
Sbjct:   31 SGNGCPESQPWPCKTPGQCLSFDFICDGEPDCPDKYDEDQSLCTAKNRPPFEVLDKFLLKYESWLIPKYLGQGTHTQIATYLIESTNAEEYSNKMKLTQQQKKDLMDLLTAVKEGRQIELIMEGMPPRAWNELYLLFGRIASSGFL 176          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000037863.1 (SMESG000037863.1)

HSP 1 Score: 203.756 bits (517), Expect = 3.518e-65
Identity = 103/181 (56.91%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  114 LLPRSRTNELREN--QIYRKIFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 650
            LL R +  EL +N  + YR      IR S  E  F GN C E  PWPCKT G CLS DF+CDG+ DC D YDED  +C AK+RPP+ IL +FI KY+DWL+P YLG   P  ++T LIES    EY K MN+  E+  N  SL+E+V+E R+IELI+FGMPPRAWNELSILFGRI KSGF+
Sbjct:   35 LLKRQKQIELDQNIEEKYR------IRKSTYE--FQGNQCLEKTPWPCKTSGYCLSLDFVCDGDFDCPDGYDEDVKMCIAKSRPPYEILKRFIEKYQDWLVPAYLGEADPGYIATQLIESPTINEYSKMMNLNKEQILNLISLMEAVREDREIELIIFGMPPRAWNELSILFGRITKSGFV 207          
The following BLAST results are available for this feature:
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F58H1.75.843e-1227.41NMDA receptor auxiliary protein [Source:UniProtKB... [more]
F58H1.75.932e-1227.91NMDA receptor auxiliary protein [Source:UniProtKB... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG312219.839e-1829.68gene:FBgn0051221 transcript:FBtr0083762[more]
CG312219.839e-1829.68gene:FBgn0051221 transcript:FBtr0083763[more]
CG312212.800e-1729.68gene:FBgn0051221 transcript:FBtr0330030[more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|E2AX35|PROH4_CAMFO2.145e-1828.66IDLSRF-like peptide OS=Camponotus floridanus OX=10... [more]
sp|P85831|PROH4_APIME5.399e-1728.30Prohormone-4 OS=Apis mellifera OX=7460 PE=1 SV=1[more]
sp|A0A0F7YYX3|CPROH_CONVC3.852e-1626.85Neuropeptide prohormone-4 OS=Conus victoriae OX=31... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YUJ94.058e-5254.73Prohormone-4 OS=Clonorchis sinensis OX=79923 GN=CL... [more]
A0A3R7FID41.052e-5152.90IDLSRF-like peptide OS=Clonorchis sinensis OX=7992... [more]
A0A5K3F2A51.820e-5142.93Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4S2L9Y86.078e-5154.05Uncharacterized protein OS=Opisthorchis felineus O... [more]
W6UW148.763e-5151.33Prohormone-4 OS=Echinococcus granulosus OX=6210 GN... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059509.13.033e-15199.51SMESG000059509.1[more]
SMESG000059509.11.731e-143100.00SMESG000059509.1[more]
SMESG000021406.16.918e-7266.44SMESG000021406.1[more]
SMESG000021406.17.392e-7266.44SMESG000021406.1[more]
SMESG000037863.13.518e-6556.91SMESG000037863.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034987 ID=SMED30034987|Name=Low density lipoprotein-receptor, class A,domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=902bp
TTTTTTAAATTGCAATTTATAAATCTTATTTTTTTCGAAAAAAGAATTGC
ATTTATCGAATTCCTGAAATGTTCTGTCAATATGTGTTATTTATTGAAAT
TGGATTCTTATTACTTCTACCGAGAAGTCGAACAAATGAACTAAGAGAAA
ATCAGATCTATCGTAAAATTTTTCTCCGCCCAATTCGGCTAAGTCCAGGA
GAAAAAGCGTTCTCTGGAAACAATTGTCCAGAAAGCAAACCTTGGCCTTG
CAAAACGCCTGGAGTTTGTCTGTCATTCGACTTCATTTGTGACGGAGAGA
AGGACTGCGATGACAATTATGATGAAGATGAAAATCTTTGCACTGCAAAA
AACCGTCCACCATTTATTATATTGAATCAATTCATAACGAAGTACAAAGA
TTGGCTAATTCCAAATTATCTTGGCAGTGGAACTCCGGAAAAAGTTTCTA
CGCATTTAATAGAGAGCAAGAATGACCAAGAATATATTAAAAGCATGAAT
ATGACACCAGAAGAAGCCGAAAACTTTAAAAGTCTCTTGGAGTCAGTCAA
AGAAGGTCGGCAAATCGAGTTGATTATGTTTGGAATGCCACCTAGAGCAT
GGAATGAATTGTCTATTCTTTTCGGAAGAATAGTCAAAAGTGGATTTATG
ACTTAAATTAAATCCGGTTGGGAAATATATAAATTTTCAAAAAAAACATT
GAAGCATCATACTGTTGTGTTTTGATTTCCGCGCCAGAAACAAATATAGA
TTCAACTTTATTTGTGTTGTTTTTGTCAGGAGATTATCCGCATTGTGATA
ATTCTTCAGTGTTTTTCTTATTGTTGAAAATGGTAATATATGCATTGGTT
AATTATGTTCTGGTAGAAATAATTAAAATTGAAATTACTTTATGCATATT
AT
back to top

protein sequence of SMED30034987-orf-1

>SMED30034987-orf-1 ID=SMED30034987-orf-1|Name=SMED30034987-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MFCQYVLFIEIGFLLLLPRSRTNELRENQIYRKIFLRPIRLSPGEKAFSG
NNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFI
ILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEA
ENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFMT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR002172LDrepeatLR_classA_rpt
IPR023415LDLR_class-A_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 52..93
e-value: 1.1E-4
score: 31.5
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 52..92
score: 10.663
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 53..91
e-value: 1.52723E-5
score: 38.727
NoneNo IPR availableGENE3DG3DSA:2.40.128.620coord: 51..148
e-value: 7.3E-9
score: 38.0
NoneNo IPR availablePANTHERPTHR20967UNCHARACTERIZEDcoord: 51..108
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.597
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 67..91
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 58..92