Protocadherin-1-like

Overview
NameProtocadherin-1-like
Smed IDSMED30034986
Length (bp)3055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1-like (SMED30034986) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1-like (SMED30034986) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034986

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034986SMESG000066263.1 SmedASXL_002008SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034986SMESG000066263.1 SmedASXL_000022SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034986SMESG000066263.1 dd_Smed_v6_31437_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30034986SMESG000066263.1 SMED30034986smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1-like vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 214.542 bits (545), Expect = 1.392e-56
Identity = 217/813 (26.69%), Postives = 359/813 (44.16%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +               Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D+D G    V +  ++D   F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   D+D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDN-----------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKSLHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 213.386 bits (542), Expect = 5.454e-56
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D+D G    V +  ++D   F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   D+D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKSLHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 213.001 bits (541), Expect = 6.515e-56
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D+D G    V +  ++D   F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   D+D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKSLHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 212.616 bits (540), Expect = 9.670e-56
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D+D G    V +  ++D   F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   D+D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKSLHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 208.379 bits (529), Expect = 1.305e-54
Identity = 244/910 (26.81%), Postives = 402/910 (44.18%), Query Frame = 2
Query:   11 NCHMSL--KLMMIIGLFLCKNYYFLIFHNVSV--TYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF--IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFF---NDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE-VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT---KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS--ANIFVQIVDIEPIL---KVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVV 2674
            NCH  L     +   L +C     ++FH+ +    Y I EE   ++ +GNL  D  +  I  N++ +      +L++     P      LI       E +  T +RIDRE++C                  R     D  C     + + P    +IF L+ +  +I D NDN PLFP   IN+ +       S   LP A D D+GIN V NY+L+   N   + +  +  G  +  + + K     L  +     ++ +  E   F   + T  +++ + +   ++  +F +      + EN  VGT + ++   ++  I    KI    SN +   A     +    G+I     LDREE   H + V+A+  D   + + + V + + D NDN P I +   +    + V + EN P+++ I  +   D D   NG + C       F + P+               ++L N   LD E +  +++ +   D GK  L  S  + +++ D NDN PVF ++F  +S PE+   G  ++ V+ATD D+   N++I Y +      + FS++ R+G + +   LD E     +  ++A D G P  L+ NV V+ ++ D ND  P    + Y  Y+ ENLP    V  I   D D G    V   I D    F   S  G I+  ISFDRE + SYT  + A+D G  S +SS+ + I ++DVNDN P F+ PP      N S      S++  T   +V   D D G N ++ ++      R D+F I+  +G I L       +L  +  + V A+D G P+   S    N+FV        L    V+++I+    P    + + +D+S  +  +  I  +AV    AG + V+++  +TAVV
Sbjct:   30 NCHKCLLSGTYIFAVLLVC-----VVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIP-NKSLTTTMQF-KLVYKTGDVP------LIRIEEDTGEIF-TTGARIDREKLC--------------AGIPR-----DEHCFYEVEVAILP---DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKE----LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDT-NDNHPVFKETEIEVSIPENAPVGTSVTQLH-ATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS--DGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----------QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSG-PNAEINYLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-----YNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTR-DLFAIDQETGNITLMEKCDVTDL-GLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP----NTEIADVSSPTSDYVKILVAAV----AGTITVVVVIFITAVV 866          
BLAST of Protocadherin-1-like vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 176.792 bits (447), Expect = 1.564e-44
Identity = 175/612 (28.59%), Postives = 289/612 (47.22%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDT--LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT------QFFSCS-PYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFF 2305
            D NDN P+F   + NV +      P+ +    ATD+D G N  ++Y + + +    +   +S   +++     A      + P++  I A +  +P  + T  LTI +   N    +L + +QK+    +EEN+ +G  +GRV    ++   P   I+    ++E S    ++  +  G+IKTT  LDRE   ++ ++V A       + +++T+++ + D NDN P        F+KKE  V I E  P  S I+TL   D DE +  T          + IE  ++E  +  D+ G    +L     L R+      V I   D+G   L     + + I D+N + P F  + + +  PE   IG  ++T+ A D D    N++I YSI   ++S  F I+  SGDI ++S LD E      + V ASD   P  L+ +  +   + DIND  PQ    SY   I+E++P+ +    + A D+D G  G V +F++++      Q F      G ++     DRE  +   + I+A+D G PSL+++S I + + DVNDN P F      Q S ++ I+      S +  +  +D DEGDN  I F  F
Sbjct:  367 DVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDA-----KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL-IAAQKM--ITLEENVAIGEEVGRV-YAIDEDSGPNGIIKY---SMEGSEDFIID--EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP-------TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKIT----------YRIEEADREVFSILDI-GDQGAILSVSGELKRQ-DHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRG-DNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPP-LNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-----EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIF 932          

HSP 2 Score: 173.711 bits (439), Expect = 1.364e-43
Identity = 158/552 (28.62%), Postives = 263/552 (47.64%), Query Frame = 2
Query:  860 FSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV--EIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAI-EPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ-FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFIN--SSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEP 2494
            F Q+ Y  ++ E+  + T+I  V+  S+    P +     +    RS  LF  +    G I+    +DRE  ++H ++V A       + +++TV + +LD  DN P       IFEK     EI E+ PI +T+L++F  D D GENG I        ++++ E   K        SG    V+     LDRE  S   + +   DKG     S+  +++ ++D+NDN PVF  + Y ++  E++ I + I TV ATD D   TN ++ YS+  S      +I+  +G++ L   +D +     +  VI +  G   +LS  V +   V DIND  P L      + + EN+ I   V  + A D D+G  G + + +  ++ F      G IKT    DRET + Y++ + A+DMG PSL +S++I + + D+NDN P F      +   N++IS      S++  ++ K +D  ++ KI +   E    +++F I      G I   S   K    K+  +++ A D G  + R    N+F+  V+  P
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVK-ASHASSQPLY-YSMVAPQDSRSQNLFT-LDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSP-------IFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEI--------EYSLGEGNGKNLLAINAKSG----VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFG-TNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSP--ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-----DKKEYNVTISEEMPRGSQI--ITLKAVDNDEDQKITYRIEE--ADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGR-CVVNVFIDDVNSAP 680          

HSP 3 Score: 165.622 bits (418), Expect = 3.968e-41
Identity = 154/548 (28.10%), Postives = 249/548 (45.44%), Query Frame = 2
Query:  602 ATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINP-KFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQN-----DNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS---DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTG---------FGGKVIHFISDTQFFSCSPYGD------IKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            A D+D G N +I Y +    +FI  + S       +++    A Y       S+K+ A +   P  N + TI + + + I ++   F +K Y   + E +  G+ I  ++   N +     ++IE+     +R     L+IG    ++  +G L R++   H V V  +  D   +     V++ I D N     +++P             V+IPE+ PI   ++TL  ED D G+N  I     S   F I+P + +   + DL              DRE  + FSV +   D     L +S  I++ + D+NDN P F  + Y  +  ED+ +G+  L V+A D D    N  + Y + +S +S    LF ++  SG + ++S LD E    IV+ + A DRG P SLS    +  T++D+ND  P   QLSY +YIAEN P+ S V +IVA D+D G         FGG      +D + F      +      I T+  FD E +++     +     +  L+S+  + I + DVNDN P  
Sbjct:  503 AIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARY-------SLKVTARDMGTPSLNTSTTIAVVLKD-INDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEE----ADREVFSILDIGDQGAILSVSGELKRQD---HKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPF-----------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDL--------------DREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDAD-IGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGG------ADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANK--FFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 4 Score: 163.31 bits (412), Expect = 2.516e-40
Identity = 169/664 (25.45%), Postives = 303/664 (45.63%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGP--SSMILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSI---KILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLF-LEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS--DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS 2458
            D  DN P+F + +   +  ++++ P  ++++   A D D G N  I Y L   N  N + I  + SG+      I  AA   L  + LS+    ++A +   P    T  + + + + + ++  +F+   Y   + ENI +  VI  V+  +++      K+     ++  S+G+  L I    G +     +D +      V + A  G    + ST  ++I ++D ND+ P +     I  +K + + EN  I   +  ++  D D G NG I         F I+  +   +TTK              +LDRE ++ +S+ +   D G  SL +S TI + + D+NDN P F K  Y ++  E++  GS I+T+ A D D    + +I Y I +++     +  I ++   + ++  L  +    + + + A+D+G    L G  +V   + D+N         ++V I E+ PI   V ++ A D D G   ++++ I  +QFF   P  GDI      DRE R+++++I+ A D  +P L +S+ I + + D+NDN P+F     +  S   +IS      +   +VS  D D G NG + +   E      I  F ++ +SG + ++S   +     I  L + A D GTP    +S
Sbjct:  262 DVQDNSPIFEKDS--YFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAIN-AKSGV------IQTAAP--LDRETLSLIRLDVIASDKGTPKRESTAMVEITVVD-VNDNAPVFASDSYNVTILENITIPAVIATVK-ATDEDFGTNGKVHY---SMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTL-----IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTK--------------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE---DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG---GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-----TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIV-LPIFARDRGTPSLSAAS 876          

HSP 5 Score: 83.1889 bits (204), Expect = 8.521e-16
Identity = 124/539 (23.01%), Postives = 216/539 (40.07%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKL--LNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLS----GRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD-----IYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIA--ENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIII 2080
            D NDN P F ++  NV +S +    S +I   A D D   +  I Y++   +   F  +     G  LS+     + E       + ++I A  T++        + +FID+    S   F+   +  K+ E+  +G  +  + LK+        + +         +  F  I    G I  +  LDRE++    V V A+      + +++ + + + D NDN P+    S         I E+ P+ ++ L +   D D G NG +            +    E  ++  +      R S  L     LDRE  +   + IF  D+G  SL+++  I L + D+NDN P F +  Y +   E+  +GS + T+ A D D    N+ I + I    ++ LF I E +       I   +  DYE         + +  G    LS  V V   V+D+ND  P L+  + + +   +N+ +   +  I A D D      + +F+ +        Y G I  K  + R    S+   +
Sbjct:  573 DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSV-----SGELKRQDHKVRVEISA--TDQGGLQGRCVVNVFIDDV--NSAPYFNDHPFSVKIPEHSPIGYPV--ITLKAEDHD----RGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS-----YAATISEDIPVGTSFLQVSAIDADIGPNGIV------------DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEG-DNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALK-DFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTCV 1070          
BLAST of Protocadherin-1-like vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 176.407 bits (446), Expect = 1.682e-44
Identity = 175/612 (28.59%), Postives = 289/612 (47.22%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDT--LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT------QFFSCS-PYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFF 2305
            D NDN P+F   + NV +      P+ +    ATD+D G N  ++Y + + +    +   +S   +++     A      + P++  I A +  +P  + T  LTI +   N    +L + +QK+    +EEN+ +G  +GRV    ++   P   I+    ++E S    ++  +  G+IKTT  LDRE   ++ ++V A       + +++T+++ + D NDN P        F+KKE  V I E  P  S I+TL   D DE +  T          + IE  ++E  +  D+ G    +L     L R+      V I   D+G   L     + + I D+N + P F  + + +  PE   IG  ++T+ A D D    N++I YSI   ++S  F I+  SGDI ++S LD E      + V ASD   P  L+ +  +   + DIND  PQ    SY   I+E++P+ +    + A D+D G  G V +F++++      Q F      G ++     DRE  +   + I+A+D G PSL+++S I + + DVNDN P F      Q S ++ I+      S +  +  +D DEGDN  I F  F
Sbjct:    8 DVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDA-----KNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL-IAAQKM--ITLEENVAIGEEVGRV-YAIDEDSGPNGIIKY---SMEGSEDFIID--EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAP-------TFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKIT----------YRIEEADREVFSILDI-GDQGAILSVSGELKRQ-DHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRG-DNARIVYSI---DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPP-LNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF-----EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIF 573          

HSP 2 Score: 165.622 bits (418), Expect = 4.790e-41
Identity = 154/548 (28.10%), Postives = 249/548 (45.44%), Query Frame = 2
Query:  602 ATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINP-KFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQN-----DNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS---DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTG---------FGGKVIHFISDTQFFSCSPYGD------IKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            A D+D G N +I Y +    +FI  + S       +++    A Y       S+K+ A +   P  N + TI + + + I ++   F +K Y   + E +  G+ I  ++   N +     ++IE+     +R     L+IG    ++  +G L R++   H V V  +  D   +     V++ I D N     +++P             V+IPE+ PI   ++TL  ED D G+N  I     S   F I+P + +   + DL              DRE  + FSV +   D     L +S  I++ + D+NDN P F  + Y  +  ED+ +G+  L V+A D D    N  + Y + +S +S    LF ++  SG + ++S LD E    IV+ + A DRG P SLS    +  T++D+ND  P   QLSY +YIAEN P+ S V +IVA D+D G         FGG      +D + F      +      I T+  FD E +++     +     +  L+S+  + I + DVNDN P  
Sbjct:  144 AIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARY-------SLKVTARDMGTPSLNTSTTIAVVLKD-INDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEE----ADREVFSILDIGDQGAILSVSGELKRQD---HKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHPF-----------SVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDL--------------DREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIG-PNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGG------ADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANK--FFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 641          

HSP 3 Score: 155.221 bits (391), Expect = 7.685e-38
Identity = 141/540 (26.11%), Postives = 248/540 (45.93%), Query Frame = 2
Query:  857 LFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLF-LEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS--DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS 2458
            +F+   Y   + ENI +  VI  V+  +++      K+     ++  S+G+  L I    G +     +D +      V + A  G    + ST  ++I ++D ND+ P +     I  +K + + EN  I   +  ++  D D G NG I         F I+  +   +TTK              +LDRE ++ +S+ +   D G  SL +S TI + + D+NDN P F K  Y ++  E++  GS I+T+ A D D    + +I Y I +++     +  I ++   + ++  L  +    + + + A+D+G    L G  +V   + D+N         ++V I E+ PI   V ++ A D D G   ++++ I  +QFF   P  GDI      DRE R+++++I+ A D  +P L +S+ I + + D+NDN P+F     +  S   +IS      +   +VS  D D G NG + +   E      I  F ++ +SG + ++S   +     I  L + A D GTP    +S
Sbjct:   15 VFASDSYNVTILENITIPAVIATVK-ATDEDFGTNGKVHY---SMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTL-----IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTK--------------LLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE---DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG---GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF-----TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIV-LPIFARDRGTPSLSAAS 517          

HSP 4 Score: 118.627 bits (296), Expect = 1.238e-26
Identity = 97/334 (29.04%), Postives = 166/334 (49.70%), Query Frame = 2
Query: 1505 IKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ-FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFIN--SSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEP 2494
            +++ ++D+NDN PVF  + Y ++  E++ I + I TV ATD D   TN ++ YS+  S      +I+  +G++ L   +D +     +  VI +  G   +LS  V +   V DIND  P L      + + EN+ I   V  + A D D+G  G + + +  ++ F      G IKT    DRET + Y++ + A+DMG PSL +S++I + + D+NDN P F      +   N++IS      S++  ++ K +D  ++ KI +   E    +++F I      G I   S   K    K+  +++ A D G  + R    N+F+  V+  P
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFG-TNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSP--ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-----DKKEYNVTISEEMPRGSQI--ITLKAVDNDEDQKITYRIEE--ADREVFSILDIGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGR-CVVNVFIDDVNSAP 321          

HSP 5 Score: 83.1889 bits (204), Expect = 9.354e-16
Identity = 130/560 (23.21%), Postives = 224/560 (40.00%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKL--LNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLS----GRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD-----IYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIA--ENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKIL 2143
            D NDN P F ++  NV +S +    S +I   A D D   +  I Y++   +   F  +     G  LS+     + E       + ++I A  T++        + +FID+    S   F+   +  K+ E+  +G  +  + LK+        + +         +  F  I    G I  +  LDRE++    V V A+      + +++ + + + D NDN P+    S         I E+ P+ ++ L +   D D G NG +            +    E  ++  +      R S  L     LDRE  +   + IF  D+G  SL+++  I L + D+NDN P F +  Y +   E+  +GS + T+ A D D    N+ I + I    ++ LF I E +       I   +  DYE         + +  G    LS  V V   V+D+ND  P L+  + + +   +N+ +   +  I A D D      + +F+ +        Y G I  K  + R    S+   +   D  N     S+  FI +L
Sbjct:  214 DINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSV-----SGELKRQDHKVRVEISA--TDQGGLQGRCVVNVFIDDV--NSAPYFNDHPFSVKIPEHSPIGYPV--ITLKAEDHD----RGDNARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSS-----YAATISEDIPVGTSFLQVSAIDADIGPNGIV------------DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEG-DNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALK-DFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEENDLIEAEKYTGKILVKQEWKRNMDVSFKTCV--SDGANTEC--STCRFIHVL 728          
BLAST of Protocadherin-1-like vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 137.117 bits (344), Expect = 2.807e-32
Identity = 163/674 (24.18%), Postives = 288/674 (42.73%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNL-SIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTI---RLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQ-FAIEPLNKEYQTTKDLS-GRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYT-VYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPY----GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            D NDN P +    I++ L+  + G  ++    A D D+G N  I Y +L+ T  + I      + + + I+ N  +E       +  ++ A +   P  +  L +    L  ++  P+    F + ++  ++ E+  +GT + +V   +++  N K       N  E      L +    G +      D E+Q  +   V+A   + +   STS +SI++ D NDN+P       IF   E  + + E    +  +L +   D D G  G +    LS    F+I P+  E    K L+ GR                  F + +   D G  S  +S  I + ++D +   P F ++ Y+I   ED+  G  I +V A         S++ YSI   +    FSI+E +G IY+T  LD +    +++N+ A+    P   S    V   + D ND  PQ   S   + I E+L +      + A D D    G+V + I  +   S        G + T    D E   +Y + + A D+G P  +S+ ++FI +LDVNDN PEF      +    + +       + + KV  +D D  +NG+I++         + F I+   G +Y   +  +  +  +  + ++A D G P  R S+A+  + ++D+
Sbjct:  433 DINDNAPQWHSSQIHISLNRTQGGSRTL---TAKDPDLGQNGWIRYSVLD-TELVSIDKETGRIFVPNTIDCNIGSE-------IKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQ----FEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEH-----LTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWP-------IFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGR------------------FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM--------SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQAT---LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF-----EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITN---GSEYFGIDEKLGNVYTKRSIDREVISHV-DISIVAEDKGVPP-RSSTASARISVLDV 1038          

HSP 2 Score: 131.339 bits (329), Expect = 1.615e-30
Identity = 104/333 (31.23%), Postives = 166/333 (49.85%), Query Frame = 2
Query: 1517 ILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD-TQFFSC-SPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPER----------RKSSANIFVQ 2476
            I D NDNPP F  +  +IS  EDL++      V A+D D  + N ++ YSI  S       I++ +G +   S LDYE      + V A+D G P   S N+ ++  V D+ND  P+ + S YT+ + EN P ++ V  +VA D D+   G++++ I++ +++F      G++ TK S DRE  S   I I A+D G P  +S++S  I +LDVNDN P  +   P      I +      S+ +  +   D D+G NG ++   +   L+  +F +  S+G +YL       + ++   L VI  D G P +           K SA+I +Q
Sbjct:  827 IEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKK-NGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR-SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITP------IVVPAGSPLSTAIGTIVAMDPDKGLNGSVL---YRAQLQSSLFVVK-SNGDVYLRRQLNASD-ERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQ 1146          

HSP 3 Score: 112.849 bits (281), Expect = 8.240e-25
Identity = 153/548 (27.92%), Postives = 243/548 (44.34%), Query Frame = 2
Query:  860 FSQKIYFFKVEENINVGTVIGRVQLKSNKQINPK----FKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHG------QFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKS---ENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTV-----YIAENLPIQSHVT--SIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISY-REQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            F Q +  F V E+  +GT IG +  K  +   PK    F  E+ S         FL++ +  G I T   LD E++++  +  V      +E   T  + +++ D+NDN P    D  +    ++EI E   + ++       D D G    +    +  G      + A   +N++ Q    ++G+L          DRE    + + I   D GK +    +   + I+D NDN PVF ++ Y  S   ++ IGSH++TV ATD D    NS+I Y I+K+    NS+ F+I++ SG I  T+SL     T+ VI V+ASD G P SLS + +V  TV       P L + + V     ++ EN  + S V   SI     DT         +   Q      Y  +   I  DRET S + +    +  G   +       + I D+NDN P++        S+ I IS  R Q  S    ++ KD D G NG I ++    +L  ++  I+  +G I++ +T    N+      +V A D G+P
Sbjct:   22 FCQCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSK--------FLKVDERSGEISTIAHLDYEKRSKFDIVAVKV----EESGETIDILVEVDDENDNAPSFA-DQVV----KLEISEFAQLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQL----------DREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGE-NSRISYDIKKTSAPSNSN-FAISQ-SGVITTTASL-LPASTHDVI-VVASDHGSP-SLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGI-LDRETASEHHLKFLLEKDGQ--IIIEHPQLLTIGDINDNAPQW-------HSSQIHISLNRTQGGSR--TLTAKDPDLGQNGWIRYS----VLDTELVSIDKETGRIFVPNTI-DCNIGSEIKFRVRAEDGGSP 518          

HSP 4 Score: 110.923 bits (276), Expect = 2.843e-24
Identity = 132/570 (23.16%), Postives = 252/570 (44.21%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPES--LDLFSQKIYFFK-----VEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAA-----IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTG-FGGKVIHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            D NDN P+F +      +S      S +I   ATD DIG NS I+Y +   +      PS+S   +S   +       L +    + ++A +   P  + +  + + +  +   S  LD+    I+  +     + EN  +G+++ RV +    + + K ++   S    +          H  ++   G LDRE  ++H ++ +       I +H ++       + I D NDN P+       +   ++ I  NR    +  TL  +DPD G+NG I        ++++  L+ E  +    +GR+   + N I  D  I S     +   D G  +L++ + +   +LD    PP F K  +Q+  PED  IG+ ++ V A +     +  +I YS++  +  +  +++  SG + +  + D+E        VIA++     S S   ++   + D+ND +P    + Y + + E    +  +  + A D D+G FG    H +S++  FS +P  G++  +       R  + +++ AKD G  S  +S++I I ++D +   P+F
Sbjct:  225 DANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTS-----APSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDI----IWLVESNSAHLMENSTLGSIVARVSIAQQYR-DTKLRLIGSSALCPQQTDQ-----AHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQL-------LTIGDINDNAPQ-------WHSSQIHISLNRTQGGS-RTLTAKDPDLGQNGWI--------RYSV--LDTELVSIDKETGRI--FVPNTI--DCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSK-RIRYSLQNQD--EHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTS---LISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF 741          

HSP 5 Score: 81.2629 bits (199), Expect = 3.978e-15
Identity = 78/270 (28.89%), Postives = 121/270 (44.81%), Query Frame = 2
Query: 1004 GLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQ-FAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPK 1804
            G  +EI +  G + T   LD E    + + V A         S  T+ I +LD NDN P+       FEK    +E+ EN P  + +  +   D D  ENG I     +  + F I+              +L  V   R I DRE+ S+  ++I   DKG    +S+ + ++ +LD+NDNPP    +   I  P    + + I T+ A D D    N  + Y  R    S LF + + +GD+YL   L+     +  ++VI SD+G P+
Sbjct:  882 GSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPE-------FEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDE-------------KLGNVYTKRSI-DREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSC-LSITPIVVPAGSPLSTAIGTIVAMDPDKG-LNGSVLY--RAQLQSSLFVV-KSNGDVYLRRQLNASDERHQRLSVIVSDQGVPR 1125          

HSP 6 Score: 68.9366 bits (167), Expect = 2.115e-11
Identity = 73/264 (27.65%), Postives = 120/264 (45.45%), Query Frame = 2
Query: 1400 VLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ---LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDND-PEF 2170
            V+   + LDREI   +S+ +     G+   T    + +R+ ++NDN P FP +  +   PE+L +GS++ TV A D+D          S    +    F+I++ +G I+LT+ LD+E      + + A+D  F      N+ ++  V+DIND  P         TV  A   P Q     I AHD D    G + + +    +  F  +P  G +  K+      R  Y + + A D G PS ++S  + + I +    D P F
Sbjct: 1881 VIRTNLELDREILERYSLKVIGTGSGQQIGTR---VDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSF--DTFTNLTIF--VSDINDNAPTFSKPLYQTTVSPATFSPGQP-FAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGER--YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGF 2131          

HSP 7 Score: 68.5514 bits (166), Expect = 2.442e-11
Identity = 125/500 (25.00%), Postives = 194/500 (38.80%), Query Frame = 2
Query: 1058 LDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSY--FSVTIFCYDKGKISLTSSVTIKLRILDMNDN-----PPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDT-----------GFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILK 2503
            LDRE   +H + ++   G  +    + TV + + DQNDN P+  LD+S     E+EI E+  +   +      D D G+NG          +F+ E L       +D SG L  V     ++ R +SS   + + +   D G   L   V   L I + N       P  F K  Y  +  E L  G  I  +       T       YSI +      FS++   G I     LD E      + VI +  G  + +   V V   V ++ND  P   +S    + ENL + S+V ++ A D D              G    HF  D QF      G I      D E    +T+ I A D    S  + +++ I + D+NDN P F  P      +  + S          K+   D+D    G + ++  +      IF +   SG +++   P      + + + V A D+G P    +S  + V I + EP  K
Sbjct: 1687 LDREASQEHLLIIILTDGGSRN--DSCTVRVTVADQNDNKPQ--LDAST--PSELEIAESSRVGDVLHRFRASDMDIGQNG----------KFSFELL-------EDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLY--VEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLT-------YSIVEGNIDSAFSVDSE-GVIRTNLELDREILERYSLKVIGTGSG--QQIGTRVDVR--VNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNID-QF-----TGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFS----PGQPFAKIEAHDLDA--RGALTYSLGQG--SSSIFRVAPESGALFMKVLPPA---GERYLVTVTATDNGVPS-FSTSVPVSVIIGEAEPTDK 2128          
BLAST of Protocadherin-1-like vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 110.153 bits (274), Expect = 6.491e-24
Identity = 156/650 (24.00%), Postives = 276/650 (42.46%), Query Frame = 2
Query:  602 ATDKDIGINSVINY---KLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI---DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS-NKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTK-DLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPV--FPKNFYQISYPEDLEIGSHILTVNATDL-DATRTNSQ-IFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRG---FPKSLSGNVI-VYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI-----SDTQFF----SCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFV 2473
            A D+D G N  I Y    +   ++ +      SG      +++K  +  L    + +K+ AI+   P  +   T++L I   +N  P+    F +  Y+ ++ EN   G  I +V     +   N K K     N  E+S+   + I    G++K    LDRE+Q+ H   ++A+        S + ++I + D NDN PK      + +     IPE+ P  + +  +   D D G+N  +        +F    LN E    + D      ++      LD   + +F+++I   D G   L++S  + + ++D+  N     F     + S  E+ EIG+ ++ + A +  D  +  ++ + Y I   +    FSI+++ G +  T  LD ET +   I V A D     +      +V+ V+  + D ND  P  +   Y   +AEN P    +  + A D+D          +      D Q F      S Y         DRE +S + + +   D G P L S+  + + +LD NDN P F         A    S R + + +L ++   D DEG+N ++ +   E   R   F I+++  II   +  G  +    ++L V A DHGTP ++ ++  + +
Sbjct:  632 ANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQ----FDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKF-SLGNNQEKSS--VISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKC-----VVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKL--------KFL---LNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFT-------QAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGDAR---FSIDNNGNIIASEAIHGDES----YALTVQATDHGTPGQQFAATRVVL 1243          

HSP 2 Score: 107.457 bits (267), Expect = 3.592e-23
Identity = 129/469 (27.51%), Postives = 198/469 (42.22%), Query Frame = 2
Query: 1070 EQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDST----ILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDTQF------FSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSS--SELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHD 2428
            E+NQ        I D+ EV     +++ I + NDN PKI     I +  +V I EN P        I  +  ED D  E      D    G F I+          D++G ++ V      LD EI  +F++T+   D          TI + ++D NDN P F K+ Y +   E   IG  +    A+  D    N  I Y ++ S+ +   ++N ++G + L   LD+ET + + + V+A D G P  L     V  +V D ND  P+ +   Y   + EN      V ++ A D D+   G V   +  +S+T        F+ +  GD+    S D E    Y + + AKD G P L S + + I + D ND+ P F          N++   +E  +    L K S  D+D   NG       +    K  F +N    +  LT+   +Y  K  + L VIA D
Sbjct: 2974 EKNQQLEFHRLTIQDNSEV-CKELITVVIENLNDNRPKI-----IEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFG-GLFQID----------DINGVVTVVKP----LDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ---NETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVP-PLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTF-------DDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKS-FKVNEK--LELLTAKKLEYRKKDKYLLTVIAKD 3404          

HSP 3 Score: 104.76 bits (260), Expect = 2.717e-22
Identity = 149/553 (26.94%), Postives = 239/553 (43.22%), Query Frame = 2
Query:  917 IGRVQLKSNKQI-NP------KFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK---EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTK-DLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS--DLFSINERSGDIYLTSSL-----DYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKI-----SFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCK---DIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTST--PGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            IGR+  + N  + NP      ++ +E   + L  +A L   IG  +G+++ +  ++R E+  +  +V+A++    E  +   VSI+ILD ND+ P       +F  K   +  I   +P D  ++ +   D DEGENG I     S     I     E    +    G      +  I L   +S   ++ +  Y  G         I ++  + N + PVF      +   ED  IG+ +  + A D D T  N  I Y I     S  ++ +++E+SG+I + S L     +      + + V A D G P   S   +    + D+N+  PQ  ++SY + I+EN      +  + A+D D G  GK+   + + Q  S     D KT I     S DRE +  +T  I A D G P   S +++ I + DVNDN P+ V        A I      +       VSC    D D G N K+ F        K  F I+  SG I++ +   P  Y+    F+L +   DHG P    +S ++ V++VDI
Sbjct:  398 IGRILYRMNVNVENPDDVSLIRYSLEYSKSDLP-NATLPFAIGSKNGILRVSAKINRSER-VYNFKVIASLHGINEKLAEKDVSIEILDSNDHAP-------VFSAKWMRQTPIVIGKPGD-VLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESE-NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDED-TGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTM-KLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVV---QHSRARIP-----EDLPHGAFVSCMAAFDEDIGQNSKLKFLLNS---EKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDP-ILSTSCHLHVELVDI 925          

HSP 4 Score: 95.1301 bits (235), Expect = 1.947e-19
Identity = 110/441 (24.94%), Postives = 192/441 (43.54%), Query Frame = 2
Query: 1220 VEIPENRPIDSTILTLFPEDPDEGENGTIF-----CDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI-RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYT-VYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQF-FSCSPYGDI----KTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEY-LLRKDIF--FINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGT----PERRKSSANIFVQIVD 2485
            VE+ E+ PI + +  L   D D G NG I          SH    ++  + E     DLS  +   L    +LD ++       +   D G    +S  T+KLRI D+N++ P F +  Y +   E+ + G  I  V A D D    N +I +S+    E S + SI+ ++G + L  SLD E        +IASD GFP  +S   +   +V D+ND  P+  + ++   I E+LP  + V+ + A D D G   K+   ++  +  F    +         +   D      + + I   D G+P L++S  + ++++D+  N     F   ++ +   S+    +  +E+  +  K+   GD  K+     EY ++  D +  F     G +  T    +   K  + + V A D  T      RR+   ++F++I+D
Sbjct:  615 VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLE---VLDVQLK------VSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGG-NNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLT-ISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEA---SVYENSEIGTEVIMIEAKET--GDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDR-ETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILD 1038          

HSP 5 Score: 85.8853 bits (211), Expect = 1.375e-16
Identity = 113/407 (27.76%), Postives = 180/407 (44.23%), Query Frame = 2
Query:  506 DKNDNPPLF--PQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLN--HTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDL--FSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVA-AIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSIN 1705
            D ND PP F  P  + ++  S  KEG + M++ +ATD D   N  I Y LL+   + F  + P    + ++    +KA         LS+ I A ++  P  + T T+ +   N   ES+ +  FS   Y F V E+ +VG VIGRVQ    +    +F I   S   E  + L   + +  G I     LDRE +NQ  + + A A G    V++ +TV++ I D NDN P    D   F      I E+  + +++      D D+  +G I        +F++   N  +   ++ SG L+        LDRE   ++ +     D+G     + +   + + D+ND+PP F K  + I     L   S IL  +  D D +  N   F+ I K     +F I+
Sbjct: 2497 DINDKPPFFVLPFYSTSISES-AKEGDTVMMV-SATDDDE--NDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAG------VTLSLTIKATDSANPPHHATTTVEV---NIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSE--ESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGG---VHAITTVTVDIGDVNDNAPAFHGDYERF-----TISEDAAVGTSVTIFSAMDRDDSPSGRI--------RFSLVEENPYFDLNEN-SGWLTVASQ----LDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQFEKEEFNIDL--HLPSTSPILHFSIKDDDLSPNNVSQFF-IPKGNEEGVFWID 2862          

HSP 6 Score: 81.6481 bits (200), Expect = 2.855e-15
Identity = 154/695 (22.16%), Postives = 278/695 (40.00%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLS---------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTIL--TLFPE-----DPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKG---KISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIV-INVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAEN--LPIQSHVTSIVAHDSDTGFGGKVIHF--ISDTQFFSCSPYGDI--KTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKI----------FSLKVIAHDHGTPERRKSSANIFV 2473
            D+NDN P F   T   ++         +    A DKD G N ++ Y ++            SG   S+  I+  +     ++PL          ++I AI++      D +++ +   N  PE+   F +K+Y   + ++   GT +  + L +       +K+E  C+         F E+    G +    +L +  +++  VE  A +   +     + V  KI+  N + P       IF ++     I EN P  S++L  +L P      D D G NG +       G   + P +++  +    SG     +  ++  D E    +S  +  +D G   + SL  S+ + + ++D ND PP FP N   IS       G  +    A D+D+      + Y I+  + S  FS++ ++GD+ +  S      T +  + V  +D    K  +  V+   T++  N  F   +  Y   + EN  LP  S + S+         G K+ HF  ++  + F   P   +   + I+ DRE  +   +++ AK      + + + + + I ++ND  P F+  P      +I+I + +  +  L +    D DEG                D+  I+S +   Y     GK  L K           F+ K+IA D+G+  R +    I V
Sbjct: 1459 DENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIV------------SGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAK-FDRKVYQTTLYDSTRPGTPV--LVLNALHHGTVSYKLEPNCT---------FFEVHTLSGAVHLATWLTK-LKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSP-------IFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLV-------GYRMLSPKDEQMFSVDQYSG----AIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIV-VTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSV---GSLRYFIK--DQSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDG---KQSASYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSIILSVAT------IGDKLDHFSIVNPHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTP-----YDITIGHSDIGTVVL-EPKVIDNDEG----------------DVVTISSENMPEYFKIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSVHRVEEPVKIRV 2073          

HSP 7 Score: 80.8777 bits (198), Expect = 4.468e-15
Identity = 118/460 (25.65%), Postives = 192/460 (41.74%), Query Frame = 2
Query: 1130 STSTVSIKILDQNDNYPK-IGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQ---FAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPV--FPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSL------DYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTS-------IVAHDSDTGFGGKVIHFI---SDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTS--SSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHD 2428
            S +T S+ I D+NDN P  +G  +  F      + E+  +D  + T+   D D GENG +    +S  +   F I+  + E +  K L   L +V    I+  R I           D    SL   +++ +R  + N+ P    F +  YQ +  +    G+ +L +NA        +  + Y +    N   F ++  SG ++L + L          CT IV     S  G  +     VI     T+ +    + Q+ Y   I EN+P  S V S       + A D D G  G V + +    D Q FS   Y G I+T++SFD E    Y+  + A DMG P   S   S I + ++D ND  P F    PS  S +IS+     +   +   + +D+D             Y ++     F ++S +G + +  + G  ++ K+F L+V   D
Sbjct: 1449 SFATFSVNINDENDNSPYFVGHTAFAF------VDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHV--ESILRIRAI-----------DSAANSLKDEMSLHIR--NSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALH------HGTVSYKLEP--NCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIV----ESTEG--QQDIAKVIAKIIRTNQHSPIFRRQV-YRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRF----PSN-SLDISMILPTANGVSVGGQTAQDMDS-------VGSLRYFIKDQSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTD 1860          

HSP 8 Score: 78.9518 bits (193), Expect = 1.668e-14
Identity = 144/595 (24.20%), Postives = 254/595 (42.69%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTI-NVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNA-----------IPESLD----LFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDR-EEQNQHCVEV---VAAIGDHKEVYST-STVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTS---SLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDC-----FPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV------IHFISDTQF--FSCSPYGDIKTKISFDRETRSSYTIIIYAKD-----MGNPSLTSSSSIFIKILDVNDNDP 2164
            D ND+ P+F  + +    + + K G   ++  +ATD+D G N  I YK    T+ + ++ + +   ++++ + K      +S P +  + AI+   P    +    +F  N            I ES +    +FS      +V E+  +GTV+ ++Q          F I    + +  S+   L + +  G I     L +  ++    ++V   V+AI     V S+  T+ ++I D N++ P+   + S +    + I EN      I  +   D D G NG I        +F++   N+E  +   +  +   V + +  LDRE     +  I   D+G     S   + + + D+NDNPP       +   PEDL  G+ +  + A D D  + NS++ + +   +    F I+  SG I++ +    LDY    +  +++  +D G P  LS +  ++  + DI        F  +    +VY  EN  I + V  I A   +TG   KV         I    +  FS    G ++T    DRET+S+Y I + A+D       +P       +FI+ILD ND+ P
Sbjct:  484 DSNDHAPVFSAKWMRQTPIVIGKPG-DVLVKVDATDQDEGENGKIVYKF---TSELPLEINANTGEITLVEVPKKG----NSWPAT--VWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGF-IRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFD-EVSYY----LRISENEKPGKDIFKVTANDFDGGNNGKI--------KFSLGN-NQEKSSVISIDAKTGIVKLLK-SLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQ-NSKLKFLLNSEKVP--FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDP-ILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVY--ENSEIGTEVIMIEA--KETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP 1044          

HSP 9 Score: 76.2554 bits (186), Expect = 1.310e-13
Identity = 95/390 (24.36%), Postives = 164/390 (42.05%), Query Frame = 2
Query: 1001 AGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIF-YSIRKSENSDL----FSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGK--VIHFISD-TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIK 2137
             GLF +I   +GV+     LD E      + VVA+ G   E    +T+ + ++DQNDN P        FEK    +++ E+  I   +        D+ E  TI        ++ ++P   +  +  +L+ +   + + +  LD E  S   +T+   D G   L +   +++ ++D NDN P F K  Y     E+ + G  +LTV A D+D+    +  +   I     +D     F+IN  +GD+ ++ S+DYE      + VIA D G P  L    ++   V D ND  P     + T  + E   I   +      D D    G    +    D  + F  +   ++ T    +   +  Y + + AKD+   +     +IFI+
Sbjct: 3056 GGLF-QIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAP-------TFEKSTYSMKVMESESIGYELAHFRASGGDQNE--TI--------EYYLKP--SDVTSFVNLNAQTGILTLAKP-LDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINS-NGDVLISQSIDYEKIKKYNLKVIAKDGGRP-PLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIR 3419          

HSP 10 Score: 70.4774 bits (171), Expect = 7.534e-12
Identity = 114/483 (23.60%), Postives = 188/483 (38.92%), Query Frame = 2
Query: 1013 LEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQ---FAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNA--TDLDATRTNSQIFYSIRKSENSDLF---SINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVY-IAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHD 2428
            + I +  G I  +  L+     ++ + +V      +  +ST T+S+  +D ND  P       +       I E+     T++ +   D DE  N TI    L   +   F++ P        K L  +    L              S+TI   D       ++ T+++ I   +   P F  + Y  S  ED ++G+ I  V    T++D  R     F  +  SE SD F   S+   +G I + SSLD E      + + A   G   +++    V   + D+ND  P     Y  + I+E+  + + VT   A D D    G++    + +  +F  +   G +      DRE    Y +I  A D G     +     I + DVND+ P+F            +I     S+S +   S KD D   N    F F      + +F+I+S++ +  L   P     K  + LKV A D
Sbjct: 2450 VAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLTLSV--IDINDKPPFF-----VLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTL--------------SLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIR-----FTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAIT---TVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQF-------EKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQF-FIPKGNEEGVFWIDSNNDL--LLKRPEIVENKMQYQLKVTAFD 2889          

HSP 11 Score: 64.3142 bits (155), Expect = 5.813e-10
Identity = 83/330 (25.15%), Postives = 138/330 (41.82%), Query Frame = 2
Query: 1505 IKLRILDMNDNPPVFPKNFYQISYPEDL----EIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD-TQFFSCSPYGDIKTKIS-FDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTF---FEYLLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS 2458
            I + I ++NDN P   +   ++S  E+L    +   +I  + A D D      ++       +   LF I++ +G + +   LD E   +  + V+ASD  F    +    +  TV D ND  P  + S Y++ + E+  I   +    A   D     +     SD T F + +    I T     D ET S+  + + AKD G P L + + + I ++D NDN P+F      +      +    +S  ++  V   D+D    G + +      E      +  F INS+  +  L S    Y   K ++LKVIA D G P  R  +
Sbjct: 2997 ITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMV-----DDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKAT----ILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF-----EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDV--LISQSIDYEKIKKYNLKVIAKDGGRPPLRSEA 3310          

HSP 12 Score: 56.6102 bits (135), Expect = 1.123e-7
Identity = 50/173 (28.90%), Postives = 77/173 (44.51%), Query Frame = 2
Query: 1541 PVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETR 2059
            PVF K  Y  S PE   IG  +LT+ AT  D    N  I YS+  S++     I+  +GD+ +T  LDYE      + ++A+  G  K +S        + D+ND  P+              I+S V++ +   SD+   G+ I  +S T         D+ T  S D E++
Sbjct: 2184 PVFEKLKYTASTPESTSIGQRLLTIKATTSDE---NDTIEYSLSGSKD---IEIHPETGDVTITGQLDYEKTQKYDLKLVATSSG--KQVSSEAEFIVLIEDVNDEMPEF-------------IRSDVSAKI---SDSAITGQFITIMSAT---------DMDTTNSLDEESQ 2323          
BLAST of Protocadherin-1-like vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 100.523 bits (249), Expect = 5.237e-21
Identity = 141/541 (26.06%), Postives = 233/541 (43.07%), Query Frame = 2
Query: 1010 FLEIGKHDGVIKTTGFLDREEQ---NQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSG--RLSYVLMNRIILDREISSYFSVTIFCYDKGK-ISLTSSVTIKLRILDMNDNPPVF-PKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI-----RKSENSDLFSINERSGDIYL---TSSLDY-ETCTYIVINVIASDRG----FP-KSLSGNVIVYFTVTDINDCFPQL----QLSYTVYIAENL--PIQSHVTSIVAHDSDTGFGGKVIH------------FISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTF-------FEYLLRKDIF-FINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            +  I    G+I  T  LD ++      H ++V A   D++E  S   ++I+I D NDN P        F +     ++ E+ P++ TIL +   D D G+N  I         ++++  N    +  ++S   RL    +N    +R     F+VT    D G+ +SL+SS  I +R  + ND   VF P + Y     ED + G+ ++ + A D D      ++ YS      R ++  +LFSI+E +G + L    S+ D  E    I + VI  D G    +P K+ +    +   + D+N+  P+     + S    I E         +  + A D D+   G +++            F+ D Q    +P       + FDRETR    + + A D G+  L       ++++D+NDN P+F  P     S   S+S  E   + +  V   D D   N +I ++         E+    D F  +N  SG I L         K IF+  VIA D+G PE  +SSA + + ++D
Sbjct:  584 WFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAR-EDNRE--SHVDLTIRIDDVNDNVP-------TFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRI--------TYSVDNHNFSINSNGEISAKVRLDADQLN----ERHFVYRFNVT--ARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD----RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTP----SPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP-----SYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFN--VIADDNGIPEALQSSAQVTLNVLD 1085          

HSP 2 Score: 92.4337 bits (228), Expect = 1.399e-18
Identity = 151/616 (24.51%), Postives = 246/616 (39.94%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEG---PSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSG-LNLSIININKAAEYFL---------HSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIK-----TTGFLDREEQNQHCVEVVAAIGD-----HKEVYSTSTVSIKILDQNDN---YPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTI-----FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMN--RIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI--------RKSENSDLFS-INERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS----YTVYIAENLPIQS------HVTSIVAHDSDT--------GFGGKV-IHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            D NDN P F   T  +Y +  +E      +++   A DKD G NS I Y + NH   I      S  + L    +N+   +F+         H +P+S+   A+            I +  +N   ES        Y   V E+   GT + ++Q +   +    +     +    +   LF  I +H G++K     +   L   E   +   +V   G       K   S +T+ I I D N+N   +P     S I +  E     + P   TI+ +   D D   NG I     +    S   F I+              R + VL     ++ DRE      VT+   D+G   L       + ++D+NDN P F +  Y+ S      +G+ ++TV A D DA   N++I YS+            + D F  +N RSG+I L   +  +T  +I  NVIA D G P++L  +  V   V D     P+ Q S      + + EN+ +         V+S  + +SD         G G K    F    +F + + + ++      D E  ++YT+ + A DM    + S+ +  +++ DVND  P+F
Sbjct:  634 DVNDNVPTF---TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNE--RHFVYRFNVTARDHGEPVSLSSSAM------------IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLF-SIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP---TIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVID--------------RQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAH-NAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQF 1211          

HSP 3 Score: 89.3521 bits (220), Expect = 1.103e-17
Identity = 124/486 (25.51%), Postives = 201/486 (41.36%), Query Frame = 2
Query:  800 NDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGL----FLEIGKHDGVIKTTGFLDREEQNQ--HCVEVVAAIGDHKE-VYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVE-IPENR-PIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSY--FSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLF-------SINERSGDIYLTSSLDYETCTY---IVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQF-FSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPE-FVFPPP 2185
            N T  + + I++    +     QK     +EE++++  V+  V      Q       EK S  + R  G        IGK+ G I+    LDR+          VV AI D    +   + V + + D NDN P       IF ++    I ENR PI S  +        + ++ T     + +G    + +N E     D +    + + +   LDREISS   F + +   D+G  S      + +++ DMNDN P F K  Y+ S  E   IG+ +++ +A D D    ++   Y +  SE SD F       S     G + +   LDYE  T      + +  SD            V+  + D ND  P +  +    + E++P  + +    A D D G   +  I+  SD +  F+    G ++   + DRE  + Y +II A D  N       +++++  DVNDN PE +  P P
Sbjct: 1417 NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQD------EKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP-------IFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRS---LDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQL--SEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD----GRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQ--DVNDNGPEPYTVPRP 1878          

HSP 4 Score: 81.6481 bits (200), Expect = 2.558e-15
Identity = 162/722 (22.44%), Postives = 294/722 (40.72%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIY--------------------FFKVEENINVGTVIGRVQLKSN---KQINPKFKIEKCSNTLERSAGLFLEIGKHDG------VIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLD---SSIFEK----KEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTK--DLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSS-------VTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDL-FSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL--QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ----FFSCSPY-GDIKTKISFDRETRS---SYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDE--GDNGKIIFTFFEYLL--RKDIFFINSSSGIIY-LTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            D NDN P F + +    +S  +   +S+I   A D D   N+ I Y L    +    +   + L+   +   ++ E  L      IK + + T+K  FN      +  DN IPE+L   +Q                          V+EN+ +  VI R +  S+   +  +  +K+        ++   F +  K +       V+   G LD E+ N + + + A     + V ST T  +++ D ND  P+  +D    +I E+    + +E    +PI    +     D D  +N         H +   E   +E +  +  +L+G +          DRE    + +T+   D+   +L  +       V +++ I D+NDN P F +  Y     E    G  ++T+ A DLD    +S + Y +  +    + F +   SG I++   LD+E      + +IASD       +    VY  + D+ND  PQ   Q   T  I E++ I   + ++ A D+D       I +  + Q     F    Y G I+   + DR+  +   S+  ++ A D     L   + + + + D+NDN P  +FP    G    +             V  +D D+   +N  I +      L   + +F I+ ++G I+ + S   + + ++ F ++V A+D G P  R+  AN+ +++ D+
Sbjct:  971 DINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL--EIDTTAGEEHQNDLDFFELVNRRSGEITL------IKPIPMKTQKFIFN-----VIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEG-LDYEQVNNYTLTLTATDMTSR-VASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPI--VTVKAIDTDSDGPQNEV-------HYRIVGEANGEETKHFRIDELTGEI----FPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK---HSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD----GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPS-REGFANVTIKVTDM 1654          

HSP 5 Score: 81.6481 bits (200), Expect = 2.624e-15
Identity = 87/358 (24.30%), Postives = 161/358 (44.97%), Query Frame = 2
Query: 1490 TSSVTIKLRILDM--NDNPPVFPKNFYQISYPEDLEIGSHILTVNAT---DLDATRTNSQIFYSIRKSENSD---LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFD----RETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRK----DIFFINSSSGIIYLTSTPGKYNLKKI---FSLKVIAHDHGT----PERRKSS-ANIFVQIVDI 2488
            T+S   ++ IL++  ++ PP F K  Y+++  ED  +   ++ V A      +  R+   I YS+      D    F I+  +G I+LT  LD++      ++ +        +   +V +   + D+ND  P      YT  + E++P+   +  + A D DTG   ++ + + D   FS +  G+I  K+  D     E    Y   + A+D G P ++ SSS  I I   N ND   VF P SQ +A   ++   Q  + + ++  +D    D  ++ ++F +   R     ++F I+  +G++ L       +L +     +L VI  D G+    P +  +S A + + I D+
Sbjct:  509 TTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKV-TAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV-DNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEP-VSLSSSAMIHIRTENTNDESAVFLPTSQYTA--FVAEDAQGGTPVIQIQARD---ADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDV 858          
BLAST of Protocadherin-1-like vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 186.422 bits (472), Expect = 2.369e-47
Identity = 197/749 (26.30%), Postives = 344/749 (45.93%), Query Frame = 2
Query:  353 FESKSHNSKIC-----QCKRKTPFHDPICST-VFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSS-----MILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLS-IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSH---GQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFY------------SIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIH-FISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKD-----IFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            FE +S + +IC       +R++ +  P+ +T    ++ +  I  Q+           D NDN P+F  R   V L    +  S      ++   ATD D G    ++Y+++  N     +I  S        I + +     + +QP+  + I A +      N    + L I +A+ +   +F +  Y + V+E+I  GTV+G V + ++  +  +  +     + +     +  I  + G I+    LD E ++Q  + + A +G+   VY  + V+I++ D NDN P+   ++S+     + +PE+  + + +      D D G +G +    +     G FAI+              R  ++++++  LD E S   ++ +   D G  SL++++TI + + D+NDNPPVF K+ Y ++  E   I + I+ VNA+DLD T  N++I Y            SI  S+ S  F I   SG IYL + LD ET     + V+A+D G P + +   ++   V D ND  P+ Q S Y   I ENL   S V  + A D D G    + +  +     F   P  G+I T+   DRE R  Y +++ A+D G P  ++   + I + DVNDN PE   P        +S+   +   +E+ +V   D D G N  I ++  +    +D     +F I+ +SG+I  T     +  + I+ L V A D G P  R++   + V+++D+
Sbjct:  660 FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT----------DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGE-----IFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAM-QRPPIFEKARYNYYVKEDIPRGTVVGSV-IAASGDVAHRSPVRYSIYSGDPDG--YFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGE-PPVYGHTQVNIEVEDVNDNAPE--FEASMVR---ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID-------------ARSGHLILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLD-TGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV----VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK---GRDSDGHGLFSIDPTSGVIR-TRVVLDHEERSIYRLGVAASDGGNPP-RETVRMLRVEVLDL 1358          

HSP 2 Score: 181.415 bits (459), Expect = 8.687e-46
Identity = 191/679 (28.13%), Postives = 312/679 (45.95%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQP---LSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV--EIPENRPIDSTILTLFPEDPD---EGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKS--ENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD-----TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQ-SSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKK--IFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            D+NDN P FPQ ++++             L  A D D+   +   Y +++       + S       ++ ++     FL  +     S+ I A++   P     +T+ + I + + ++  +F+Q  YF  V EN  VGT + +V   S+   +    +E   N  +        I    G I     LD E +  H + VVA     + + +T+ VSI++ D NDN P I +   IF   +   +I E+      +  +   DPD   E  N  +  +    G FA+        TT+D S    Y+++  + LDREI S +++++   DKG   L +S +I LRI D+NDNPP F ++ Y  +  E  + G+ +L V A D D    NS + YS+ ++   ++  F I+ ++G I   S +D ET     + V+A D G P  LS    V  T+ D+ND  P    S Y V +AEN P+   +  + A D D G    V + I +     T+F   S  G+I      D E RSSY   + A D G   L++++ I +++ DVNDN P F +P   + S   S     Q SS+ +  V   D D G+ G++ +          IF I+ S+G I++   P   +++   +  L + A D G   R  + A +F+ I+D
Sbjct:  166 DENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQD-VNDNQPIFNQSRYFATVPENATVGTSVLQV-YASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINV---IFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFAL--------TTRDNS---IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEG-LNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAG-NEAGIFRIDRSTGEIFVVR-PDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIID 819          

HSP 3 Score: 136.732 bits (343), Expect = 4.954e-32
Identity = 158/578 (27.34%), Postives = 251/578 (43.43%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPN--ATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDT---LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRL-----SYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ--LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI-----SDTQ-FFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            D    PP+F +   N Y+  K++ P   ++ +  A   D+   S + Y +   +   +  I+      N   I I K  ++   SQ L + I A   E P +  T   + +    DNA PE    F   +    V E+  +G  +       +K      ++   S   E   GLF  I    G +  +  LD E   +H + V A  G    + +  T+ + + D NDN P       +FEK E  V + E+R I++ I+ +   D D G N  I    +  G   ++ +     ++ D+S        S  +  R  LDRE    + +T+   D G  +  +   + +R+LD NDN P F K+ Y+    E+L  GS +  V A+DLD    N+ I YS+    +S  F ++  +G+I     LD E      + V A D+G P   S  V V   V+D+ND  P++       V + E  P  + V  + A D D G    + + I     SD    FS  P  G I+T++  D E RS Y + + A D GNP   +   + +++LD+NDN P F
Sbjct:  819 DAMQRPPIFEKARYNYYV--KEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIET-----NSGNIRIAKPLDHEAKSQVL-LNIQATLGEPPVYGHTQVNIEVEDVNDNA-PE----FEASMVRISVPESAELGAPLYAAH-AHDKDSGSSGQVTY-SLVKESGKGLF-AIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP-------VFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAG---VDNVTNSISSS-DVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE-NAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 4 Score: 133.65 bits (335), Expect = 5.099e-31
Identity = 180/732 (24.59%), Postives = 300/732 (40.98%), Query Frame = 2
Query:  506 DKNDNPPLF--PQRTINVYLSLKKEGP--SSMILPNATDKDIGINSVINYKLLNHTN-----FIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDL------FSQKIYFFKVEENINVGTVIGRVQLKSN------KQINPKFKIEKCSNTLERSAGLFLE----IGKHDGVIKTTGFLDREEQNQHCVEVVA--AIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDL--SGRLSYVLMNRIILDREISSYFSVTIFCYDKGK---ISLTSSVTIKLRILDMNDNPPVF--PKN----FYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSL-----DYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHD----SDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSS-----------------------SIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT-KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            D NDN P    PQ  +   +S+++E P  + ++   A D+D G N+ I Y ++   +        I P+   +   ++         L  +  SI  L +           T+R+       E LDL      F+     F+V E+  +G V+G +             +   F+  + + TL       +E    I +H G +     LDRE Q++  +E+ A      +    S  TV I++ D NDN P+   D       ++++ E  P+ + I      D D G NG +    + +       LN+  +    L     L+  L  +  LD E    + + +   D+       L +SVT++LRILD ND+ P F  P +       +   +   IG  +  + A D D+   N Q+ Y I        F IN ++G I L  SL     D E      + + A D G P+    ++ ++  V   ++  P+ LQ  Y   I EN+P  S V  + A       +     ++   +++  F      G I T+  FDRE+++SY + +Y +D    S  SSS                       +I+I + DVNDN PEF      +  +   +S  E S   +   V   D+DEG N  +I++     L  + F I+SSSG   L++ P        ++L++ A D G P+ R+   NI + + D
Sbjct: 1248 DVNDNAPEIADPQEDV---VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV---------LDHEERSIYRLGVAASDGGNPPRETVRMLR----VEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI-----DLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRY----FPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF------RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNL-GNKFSIDSSSG--ELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVED 1944          

HSP 5 Score: 130.568 bits (327), Expect = 3.762e-30
Identity = 116/378 (30.69%), Postives = 179/378 (47.35%), Query Frame = 2
Query: 1400 VLMNRIILDREISSYFSVTIFCYDKGKISLTSS-----------------------VTIKLRILDMNDNPPVF-PKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSS-SIFIKILDVNDNDPEFV-FPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTF-FEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            ++  R   DRE  + + + ++  D  + S  SS                        TI + + D+NDN P F P + Y +S PE+ E G  I TV A+DLD    N+ + YSI      + FSI+  SG++     LD E  +   + + ASDRG PKS  G+  +   V D ND  P+ +LS YT  + E+ P+ + V  I A D+D G   ++++ +++    QF      G I T    DRE ++SY  ++ A D G   + S++  + I +LD+NDN P F  +P   Q  A I      Q    L KV   D D G N +I+++   E       F IN S+G +  + +    +  K+  L+V+A D G P
Sbjct: 1775 IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEG-PNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALI------QPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASES-GKLLHLEVVARDKGNP 2142          

HSP 6 Score: 113.235 bits (282), Expect = 8.131e-25
Identity = 153/663 (23.08%), Postives = 281/663 (42.38%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFP-EDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKIS--LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI---------RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRG--FPKSLSGNVIVYFTVTDINDCFPQL-------QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS----DTQFFSCSPYGDIKTKISF-----DRETRSSYTIIIYAKDMGNPSLTSSS-SIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYN 2389
            D NDN P F +      +       S + +  A+D D+G N+ I Y LL   +  Q+ P    ++       +  E +       + + A +   P  +  + +R+ + +    + ++   +     V E    GT + RV+ +  +   N                GLF  I    GVI+T   LD EE++ + + V A+ G +    +   + +++LD NDN P     S +F      + E+  +   + ++ P E P +    ++   F D      + + PL K+         R S  L+   +LDRE+ S F + I   D    +   +S++T+K+ + D+NDN P +P++   +   E   +G+ I    ATD D T TN  + Y +          + +   LF ++  +G + L + LD+E     ++ V A D+     + L  +V V   + D ND  P           + +++I++   I   V  IVA D D+G  G++ + I+    + +F   S  G I+   S      D E    + +II AKD G P    SS ++ + +   ++N P F+     Q     +I     S S + +V+ K +   +N  + +      +  D+F ++   GII   +T G+++
Sbjct: 1145 DANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELY------DLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLF-SIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFR-----VREDAALGHVVGSISPIERPADVVRNSVEESFEDL--RVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFL-----QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYE-IPAGVANDLFHVDWQRGII---TTRGQFD 1783          

HSP 7 Score: 109.383 bits (272), Expect = 1.278e-23
Identity = 111/393 (28.24%), Postives = 177/393 (45.04%), Query Frame = 2
Query: 1058 LDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFY-----SIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ----------LSYTVYIAENLPIQSHVTSIVAHDSDT-GFGGKVIHFISDTQ-FFSCSPY-GDIKTKISFDRETRSS---YTIIIYAKDMGNPSLTSSSSIFIKILDVNDN 2158
            L   + N+  V +VA   D   + S + + I++ D+NDN PK       F +K+    + E     + +  +   D D G N  +     D      F IEP               S ++   I+LDREI   + + I   D+G   +T + TI+++I+D+NDN P FP N   ++  E  E+G+ I +++A D+D   T   + Y     S    EN  +F+++  SG + L   LDYE      ++VIASD     +     ++   V D ND  P             L     I+E+L +   + ++ A D+D+ G   KVI+ I   Q  FS  P  G +   +S  +   SS   Y + I AKD G P+L SS+ + ++    NDN
Sbjct: 2280 LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPK-------FSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEP-------------AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD---TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDN 2641          

HSP 8 Score: 102.064 bits (253), Expect = 2.398e-21
Identity = 108/380 (28.42%), Postives = 167/380 (43.95%), Query Frame = 2
Query: 1403 LMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSIN---ERSGDIYL----TSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS-----DTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLR--KDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            +  ++ LDRE  + +S+         I +   VT+K    D NDN P FP+    I +PE+         + A DLD    N+Q  Y+I     +D F ++   ER G +YL    +  LD ET     + + A D G P  L G + V  T+ D+ND  P   Q  Y   + EN  + + V  + A D+D    G V + I+       Q F   P  G I    + D ET+  + +++ AKD G   L +++ + I++ DVNDN P       S   A+  IS   Q    + ++S  D D     K  +      L      F + +    IYL     P    +   ++L V+A D GTP    +S +IF++I D+
Sbjct:  132 IRTKVKLDRETRASYSLVAIPLSGRNIRVL--VTVK----DENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTP-PLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD-DASPKISESAQPGEFVARISVHDPDS----KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLH-ASKSIFLRITDV 497          

HSP 9 Score: 93.2041 bits (230), Expect = 1.175e-18
Identity = 82/306 (26.80%), Postives = 148/306 (48.37%), Query Frame = 2
Query: 1058 LDREEQNQHCVEVVAA-IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTS-SVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDL---FSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL---SYTVYIAENLPIQSHVTSIVAHDSD 1951
            LDRE+ +++ +++ A+  G  K       ++I + DQNDN P+  L      K    + E+ P+ ++++ +   D D G N  +           +  L  E Q    + G+ S ++     LDRE+ + ++  +   D G+  + S +V +++ +LD+NDN P+F +  Y    P  ++ G  +L V A D D    N++I YS+  +ENS +   F IN  +G +  + SL  E+   + + V+A D+G P   S  +I    + +     P L+    +Y V + EN P  + +  +VA  SD
Sbjct: 1909 LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL-----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARL-----------VYSLANETQWQFAIDGQ-SGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLG-ANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLI-ELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 10 Score: 92.8189 bits (229), Expect = 1.357e-18
Identity = 157/692 (22.69%), Postives = 296/692 (42.77%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE-----------VEIPENRPIDSTILTLFPEDPD-EGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYE-TCTYIVINVIASDRGFP----KSLSGNVIVYFTVTDINDCFPQLQLS--YTVYIAENLPIQSHVTSIVAHDSD--TGFGGKVIHFIS---DTQFFSCSPYGD---IKTKISFDRETRSSYTIIIYAKDMGNPS-LTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKD---IFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQI 2479
            D+NDN P F Q+     +S      + +   +A D D G N+ + Y ++  NH N   I+P+ SG+  + I +++            +KI+A +   P    T TIR+ I + + ++   F        V E   +G VI  +   ++    P         +T++        + ++ G +     LD E Q ++ ++V+A+   H+   + + +++++ D+NDN P       +F  ++            EI E+  +D  +LT+   D D EG N  +         + IEP  + +      S  +  V M+R+      S  + V I   D GK +L SS  ++++  D       F +N Y+    E   +GS +L +    LD      Q    I  +E S    +  ++  I L   LD E    Y +  V++   G P     + S  + V  T+ D ND FP    S  Y   I+E  P++  +  + A D+D       +V++ I+   D   F+         +  ++ +D   + SY +II A D  +   L S     +++ D NDN+P+F    P     +  ++  E   S + +    D+D+G  G++ ++       +    +F ++S SG++  ++    Y  ++ + ++++A D G    +K+S  + V+I
Sbjct: 2314 DENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIR-----DIYKLKIIATDEGVPQMTGTATIRVQIVD-VNDNQPTFPPN-NLVTVSEATELGAVITSIS-ANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAP-------VFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVI--------YIIEPAQEGFSVHP--SNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD------QSLAIIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHF-LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV-TSAFVFDYEQRQRYDMELLASDMGG---KKASVAVRVEI 2959          

HSP 11 Score: 85.5001 bits (210), Expect = 2.589e-16
Identity = 136/525 (25.90%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLK------KEGPS---SMILPNATDKDI-GINSVINYKLLNHTNFIQIKPSHS--GLNLSIIN--INKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI-DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAA------IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE---KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD----LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL---QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS 1987
            D+NDN P+F  +    Y ++        E  S    ++  NATD D  G NS + Y +        + PS+    +N+S +   ++ + +YF       ++I+A +  KP    +  +R+   DN    S   F Q  Y  ++ E   +G+V+  +QL  +  ++    I   +   E SA   L+       I     LDRE  + + + +V +      +       S  +V I ILD NDN+P       IF+   K E EI E  P+  +I  L   D D+           S   + I   N E+  T DL   + +V  NR+  D    SY  +   C    +  L S    +L + D NDN P FP   Y     E+  +GS +   +A+DLD      Q+ YSI  + + +    +F ++  SG +      DYE      + ++ASD G  K+   +V V   +   ++  PQ       + +  A  LP    V  + A DSD+G  G+V++ +S
Sbjct: 2524 DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYF-------VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQ--FLQNQYRAQISEAAPLGSVV--LQLGQDA-LDQSLAIIAGN---EESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP-------IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPN------SEVVYDITSGNDEHMFTIDLVTGVLFV-NNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKG-PFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKA---SVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLS 3011          

HSP 12 Score: 85.1149 bits (209), Expect = 2.964e-16
Identity = 127/514 (24.71%), Postives = 217/514 (42.22%), Query Frame = 2
Query:  743 HSQPLSIKILAI--NTEKPFFND--TLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDE--------GENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVF----PKNFYQI-----SYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIY---------LTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTI-IIYAKDMGNP-----SLTSSSSIFIKILDVNDNDPEF 2170
            +SQP  I+++ +    + PF      L I L  +N   ++   FSQK +   V E  N GT + +V    S+   N + +        + +   F+      G+++T   LDRE ++ + ++++A      ++  T+T+ ++I+D NDN P    ++       V + E   + + I ++   D D         G   T+  D  +   FA++            SG+L  VL  R  LD E+   + + +   D    + T    + +R+ D NDN PVF    P  ++ I        E L +   +LTVNATD D+   NS++ Y I  ++    FS++  +G +          ++SS DY       + +IA D G P +L  + ++     D      Q LQ  Y   I+E  P+ S V  +     D      +I    ++ F        +  K   DRE    Y + ++ +   G P     + +S  S+ I ILD NDN P F
Sbjct: 2282 NSQPNEIRVVLVARTADAPFLASYAELVIELEDEN---DNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA---FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTV--DIENMSIFALD----------RYSGKL--VLKRR--LDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDY------FVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA--IIAGNEESAFELLQSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          
BLAST of Protocadherin-1-like vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 186.422 bits (472), Expect = 2.369e-47
Identity = 197/749 (26.30%), Postives = 344/749 (45.93%), Query Frame = 2
Query:  353 FESKSHNSKIC-----QCKRKTPFHDPICST-VFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSS-----MILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLS-IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSH---GQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFY------------SIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIH-FISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKD-----IFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            FE +S + +IC       +R++ +  P+ +T    ++ +  I  Q+           D NDN P+F  R   V L    +  S      ++   ATD D G    ++Y+++  N     +I  S        I + +     + +QP+  + I A +      N    + L I +A+ +   +F +  Y + V+E+I  GTV+G V + ++  +  +  +     + +     +  I  + G I+    LD E ++Q  + + A +G+   VY  + V+I++ D NDN P+   ++S+     + +PE+  + + +      D D G +G +    +     G FAI+              R  ++++++  LD E S   ++ +   D G  SL++++TI + + D+NDNPPVF K+ Y ++  E   I + I+ VNA+DLD T  N++I Y            SI  S+ S  F I   SG IYL + LD ET     + V+A+D G P + +   ++   V D ND  P+ Q S Y   I ENL   S V  + A D D G    + +  +     F   P  G+I T+   DRE R  Y +++ A+D G P  ++   + I + DVNDN PE   P        +S+   +   +E+ +V   D D G N  I ++  +    +D     +F I+ +SG+I  T     +  + I+ L V A D G P  R++   + V+++D+
Sbjct:  660 FEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT----------DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGE-----IFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAM-QRPPIFEKARYNYYVKEDIPRGTVVGSV-IAASGDVAHRSPVRYSIYSGDPDG--YFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGE-PPVYGHTQVNIEVEDVNDNAPE--FEASMVR---ISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID-------------ARSGHLILSQH-LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLD-TGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV----VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVK---GRDSDGHGLFSIDPTSGVIR-TRVVLDHEERSIYRLGVAASDGGNPP-RETVRMLRVEVLDL 1358          

HSP 2 Score: 181.415 bits (459), Expect = 8.687e-46
Identity = 191/679 (28.13%), Postives = 312/679 (45.95%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQP---LSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV--EIPENRPIDSTILTLFPEDPD---EGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKS--ENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD-----TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQ-SSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKK--IFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            D+NDN P FPQ ++++             L  A D D+   +   Y +++       + S       ++ ++     FL  +     S+ I A++   P     +T+ + I + + ++  +F+Q  YF  V EN  VGT + +V   S+   +    +E   N  +        I    G I     LD E +  H + VVA     + + +T+ VSI++ D NDN P I +   IF   +   +I E+      +  +   DPD   E  N  +  +    G FA+        TT+D S    Y+++  + LDREI S +++++   DKG   L +S +I LRI D+NDNPP F ++ Y  +  E  + G+ +L V A D D    NS + YS+ ++   ++  F I+ ++G I   S +D ET     + V+A D G P  LS    V  T+ D+ND  P    S Y V +AEN P+   +  + A D D G    V + I +     T+F   S  G+I      D E RSSY   + A D G   L++++ I +++ DVNDN P F +P   + S   S     Q SS+ +  V   D D G+ G++ +          IF I+ S+G I++   P   +++   +  L + A D G   R  + A +F+ I+D
Sbjct:  166 DENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQD-VNDNQPIFNQSRYFATVPENATVGTSVLQV-YASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINV---IFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFAL--------TTRDNS---IYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEG-LNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVF-YPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAG-NEAGIFRIDRSTGEIFVVR-PDMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIID 819          

HSP 3 Score: 136.732 bits (343), Expect = 4.954e-32
Identity = 158/578 (27.34%), Postives = 251/578 (43.43%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPN--ATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDT---LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRL-----SYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ--LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI-----SDTQ-FFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            D    PP+F +   N Y+  K++ P   ++ +  A   D+   S + Y +   +   +  I+      N   I I K  ++   SQ L + I A   E P +  T   + +    DNA PE    F   +    V E+  +G  +       +K      ++   S   E   GLF  I    G +  +  LD E   +H + V A  G    + +  T+ + + D NDN P       +FEK E  V + E+R I++ I+ +   D D G N  I    +  G   ++ +     ++ D+S        S  +  R  LDRE    + +T+   D G  +  +   + +R+LD NDN P F K+ Y+    E+L  GS +  V A+DLD    N+ I YS+    +S  F ++  +G+I     LD E      + V A D+G P   S  V V   V+D+ND  P++       V + E  P  + V  + A D D G    + + I     SD    FS  P  G I+T++  D E RS Y + + A D GNP   +   + +++LD+NDN P F
Sbjct:  819 DAMQRPPIFEKARYNYYV--KEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIET-----NSGNIRIAKPLDHEAKSQVL-LNIQATLGEPPVYGHTQVNIEVEDVNDNA-PE----FEASMVRISVPESAELGAPLYAAH-AHDKDSGSSGQVTY-SLVKESGKGLF-AIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP-------VFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAG---VDNVTNSISSS-DVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGE-NAAIRYSLLPINSS--FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 4 Score: 133.65 bits (335), Expect = 5.099e-31
Identity = 180/732 (24.59%), Postives = 300/732 (40.98%), Query Frame = 2
Query:  506 DKNDNPPLF--PQRTINVYLSLKKEGP--SSMILPNATDKDIGINSVINYKLLNHTN-----FIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDL------FSQKIYFFKVEENINVGTVIGRVQLKSN------KQINPKFKIEKCSNTLERSAGLFLE----IGKHDGVIKTTGFLDREEQNQHCVEVVA--AIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDL--SGRLSYVLMNRIILDREISSYFSVTIFCYDKGK---ISLTSSVTIKLRILDMNDNPPVF--PKN----FYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSL-----DYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHD----SDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSS-----------------------SIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT-KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            D NDN P    PQ  +   +S+++E P  + ++   A D+D G N+ I Y ++   +        I P+   +   ++         L  +  SI  L +           T+R+       E LDL      F+     F+V E+  +G V+G +             +   F+  + + TL       +E    I +H G +     LDRE Q++  +E+ A      +    S  TV I++ D NDN P+   D       ++++ E  P+ + I      D D G NG +    + +       LN+  +    L     L+  L  +  LD E    + + +   D+       L +SVT++LRILD ND+ P F  P +       +   +   IG  +  + A D D+   N Q+ Y I        F IN ++G I L  SL     D E      + + A D G P+    ++ ++  V   ++  P+ LQ  Y   I EN+P  S V  + A       +     ++   +++  F      G I T+  FDRE+++SY + +Y +D    S  SSS                       +I+I + DVNDN PEF      +  +   +S  E S   +   V   D+DEG N  +I++     L  + F I+SSSG   L++ P        ++L++ A D G P+ R+   NI + + D
Sbjct: 1248 DVNDNAPEIADPQEDV---VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV---------LDHEERSIYRLGVAASDGGNPPRETVRMLR----VEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI-----DLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRY----FPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG-DNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF------RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNL-GNKFSIDSSSG--ELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVED 1944          

HSP 5 Score: 130.568 bits (327), Expect = 3.762e-30
Identity = 116/378 (30.69%), Postives = 179/378 (47.35%), Query Frame = 2
Query: 1400 VLMNRIILDREISSYFSVTIFCYDKGKISLTSS-----------------------VTIKLRILDMNDNPPVF-PKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSS-SIFIKILDVNDNDPEFV-FPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTF-FEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            ++  R   DRE  + + + ++  D  + S  SS                        TI + + D+NDN P F P + Y +S PE+ E G  I TV A+DLD    N+ + YSI      + FSI+  SG++     LD E  +   + + ASDRG PKS  G+  +   V D ND  P+ +LS YT  + E+ P+ + V  I A D+D G   ++++ +++    QF      G I T    DRE ++SY  ++ A D G   + S++  + I +LD+NDN P F  +P   Q  A I      Q    L KV   D D G N +I+++   E       F IN S+G +  + +    +  K+  L+V+A D G P
Sbjct: 1775 IITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEG-PNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALI------QPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASES-GKLLHLEVVARDKGNP 2142          

HSP 6 Score: 113.235 bits (282), Expect = 8.131e-25
Identity = 153/663 (23.08%), Postives = 281/663 (42.38%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFP-EDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKIS--LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI---------RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRG--FPKSLSGNVIVYFTVTDINDCFPQL-------QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS----DTQFFSCSPYGDIKTKISF-----DRETRSSYTIIIYAKDMGNPSLTSSS-SIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYN 2389
            D NDN P F +      +       S + +  A+D D+G N+ I Y LL   +  Q+ P    ++       +  E +       + + A +   P  +  + +R+ + +    + ++   +     V E    GT + RV+ +  +   N                GLF  I    GVI+T   LD EE++ + + V A+ G +    +   + +++LD NDN P     S +F      + E+  +   + ++ P E P +    ++   F D      + + PL K+         R S  L+   +LDRE+ S F + I   D    +   +S++T+K+ + D+NDN P +P++   +   E   +G+ I    ATD D T TN  + Y +          + +   LF ++  +G + L + LD+E     ++ V A D+     + L  +V V   + D ND  P           + +++I++   I   V  IVA D D+G  G++ + I+    + +F   S  G I+   S      D E    + +II AKD G P    SS ++ + +   ++N P F+     Q     +I     S S + +V+ K +   +N  + +      +  D+F ++   GII   +T G+++
Sbjct: 1145 DANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELY------DLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLF-SIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFR-----VREDAALGHVVGSISPIERPADVVRNSVEESFEDL--RVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDAD-TGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFL-----QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYE-IPAGVANDLFHVDWQRGII---TTRGQFD 1783          

HSP 7 Score: 109.383 bits (272), Expect = 1.278e-23
Identity = 111/393 (28.24%), Postives = 177/393 (45.04%), Query Frame = 2
Query: 1058 LDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFY-----SIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ----------LSYTVYIAENLPIQSHVTSIVAHDSDT-GFGGKVIHFISDTQ-FFSCSPY-GDIKTKISFDRETRSS---YTIIIYAKDMGNPSLTSSSSIFIKILDVNDN 2158
            L   + N+  V +VA   D   + S + + I++ D+NDN PK       F +K+    + E     + +  +   D D G N  +     D      F IEP               S ++   I+LDREI   + + I   D+G   +T + TI+++I+D+NDN P FP N   ++  E  E+G+ I +++A D+D   T   + Y     S    EN  +F+++  SG + L   LDYE      ++VIASD     +     ++   V D ND  P             L     I+E+L +   + ++ A D+D+ G   KVI+ I   Q  FS  P  G +   +S  +   SS   Y + I AKD G P+L SS+ + ++    NDN
Sbjct: 2280 LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPK-------FSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEP-------------AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVD---TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD----AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ---ANDN 2641          

HSP 8 Score: 102.064 bits (253), Expect = 2.398e-21
Identity = 108/380 (28.42%), Postives = 167/380 (43.95%), Query Frame = 2
Query: 1403 LMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSIN---ERSGDIYL----TSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS-----DTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLR--KDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            +  ++ LDRE  + +S+         I +   VT+K    D NDN P FP+    I +PE+         + A DLD    N+Q  Y+I     +D F ++   ER G +YL    +  LD ET     + + A D G P  L G + V  T+ D+ND  P   Q  Y   + EN  + + V  + A D+D    G V + I+       Q F   P  G I    + D ET+  + +++ AKD G   L +++ + I++ DVNDN P       S   A+  IS   Q    + ++S  D D     K  +      L      F + +    IYL     P    +   ++L V+A D GTP    +S +IF++I D+
Sbjct:  132 IRTKVKLDRETRASYSLVAIPLSGRNIRVL--VTVK----DENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTP-PLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD-DASPKISESAQPGEFVARISVHDPDS----KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLH-ASKSIFLRITDV 497          

HSP 9 Score: 93.2041 bits (230), Expect = 1.175e-18
Identity = 82/306 (26.80%), Postives = 148/306 (48.37%), Query Frame = 2
Query: 1058 LDREEQNQHCVEVVAA-IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTS-SVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDL---FSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL---SYTVYIAENLPIQSHVTSIVAHDSD 1951
            LDRE+ +++ +++ A+  G  K       ++I + DQNDN P+  L      K    + E+ P+ ++++ +   D D G N  +           +  L  E Q    + G+ S ++     LDRE+ + ++  +   D G+  + S +V +++ +LD+NDN P+F +  Y    P  ++ G  +L V A D D    N++I YS+  +ENS +   F IN  +G +  + SL  E+   + + V+A D+G P   S  +I    + +     P L+    +Y V + EN P  + +  +VA  SD
Sbjct: 1909 LDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL-----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARL-----------VYSLANETQWQFAIDGQ-SGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLG-ANAEIVYSL-NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLI-ELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 10 Score: 92.8189 bits (229), Expect = 1.357e-18
Identity = 157/692 (22.69%), Postives = 296/692 (42.77%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE-----------VEIPENRPIDSTILTLFPEDPD-EGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYE-TCTYIVINVIASDRGFP----KSLSGNVIVYFTVTDINDCFPQLQLS--YTVYIAENLPIQSHVTSIVAHDSD--TGFGGKVIHFIS---DTQFFSCSPYGD---IKTKISFDRETRSSYTIIIYAKDMGNPS-LTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKD---IFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQI 2479
            D+NDN P F Q+     +S      + +   +A D D G N+ + Y ++  NH N   I+P+ SG+  + I +++            +KI+A +   P    T TIR+ I + + ++   F        V E   +G VI  +   ++    P         +T++        + ++ G +     LD E Q ++ ++V+A+   H+   + + +++++ D+NDN P       +F  ++            EI E+  +D  +LT+   D D EG N  +         + IEP  + +      S  +  V M+R+      S  + V I   D GK +L SS  ++++  D       F +N Y+    E   +GS +L +    LD      Q    I  +E S    +  ++  I L   LD E    Y +  V++   G P     + S  + V  T+ D ND FP    S  Y   I+E  P++  +  + A D+D       +V++ I+   D   F+         +  ++ +D   + SY +II A D  +   L S     +++ D NDN+P+F    P     +  ++  E   S + +    D+D+G  G++ ++       +    +F ++S SG++  ++    Y  ++ + ++++A D G    +K+S  + V+I
Sbjct: 2314 DENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIR-----DIYKLKIIATDEGVPQMTGTATIRVQIVD-VNDNQPTFPPN-NLVTVSEATELGAVITSIS-ANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE---ARTVLTVRVNDENDNAP-------VFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVI--------YIIEPAQEGFSVHP--SNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD------QSLAIIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF----PLTEYVHF-LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLV-TSAFVFDYEQRQRYDMELLASDMGG---KKASVAVRVEI 2959          

HSP 11 Score: 85.5001 bits (210), Expect = 2.589e-16
Identity = 136/525 (25.90%), Postives = 222/525 (42.29%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLK------KEGPS---SMILPNATDKDI-GINSVINYKLLNHTNFIQIKPSHS--GLNLSIIN--INKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI-DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAA------IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE---KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD----LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL---QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS 1987
            D+NDN P+F  +    Y ++        E  S    ++  NATD D  G NS + Y +        + PS+    +N+S +   ++ + +YF       ++I+A +  KP    +  +R+   DN    S   F Q  Y  ++ E   +G+V+  +QL  +  ++    I   +   E SA   L+       I     LDRE  + + + +V +      +       S  +V I ILD NDN+P       IF+   K E EI E  P+  +I  L   D D+           S   + I   N E+  T DL   + +V  NR+  D    SY  +   C    +  L S    +L + D NDN P FP   Y     E+  +GS +   +A+DLD      Q+ YSI  + + +    +F ++  SG +      DYE      + ++ASD G  K+   +V V   +   ++  PQ       + +  A  LP    V  + A DSD+G  G+V++ +S
Sbjct: 2524 DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYF-------VRIIAKDAGKPALKSSTLLRVQANDNGSGRSQ--FLQNQYRAQISEAAPLGSVV--LQLGQDA-LDQSLAIIAGN---EESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP-------IFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPN------SEVVYDITSGNDEHMFTIDLVTGVLFV-NNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKG-PFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKA---SVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLS 3011          

HSP 12 Score: 85.1149 bits (209), Expect = 2.964e-16
Identity = 127/514 (24.71%), Postives = 217/514 (42.22%), Query Frame = 2
Query:  743 HSQPLSIKILAI--NTEKPFFND--TLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDE--------GENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVF----PKNFYQI-----SYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIY---------LTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTI-IIYAKDMGNP-----SLTSSSSIFIKILDVNDNDPEF 2170
            +SQP  I+++ +    + PF      L I L  +N   ++   FSQK +   V E  N GT + +V    S+   N + +        + +   F+      G+++T   LDRE ++ + ++++A      ++  T+T+ ++I+D NDN P    ++       V + E   + + I ++   D D         G   T+  D  +   FA++            SG+L  VL  R  LD E+   + + +   D    + T    + +R+ D NDN PVF    P  ++ I        E L +   +LTVNATD D+   NS++ Y I  ++    FS++  +G +          ++SS DY       + +IA D G P +L  + ++     D      Q LQ  Y   I+E  P+ S V  +     D      +I    ++ F        +  K   DRE    Y + ++ +   G P     + +S  S+ I ILD NDN P F
Sbjct: 2282 NSQPNEIRVVLVARTADAPFLASYAELVIELEDEN---DNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNA---FVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTV--DIENMSIFALD----------RYSGKL--VLKRR--LDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDY------FVRIIAKDAGKP-ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA--IIAGNEESAFELLQSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          
BLAST of Protocadherin-1-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 174.866 bits (442), Expect = 8.915e-44
Identity = 174/689 (25.25%), Postives = 299/689 (43.40%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKP----------SHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGT---VIGRVQLKSNKQINP---KFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD--IYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQF--------FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQI 2479
            D ND+ P F        +       S++I   ATD+DIG N+ I Y +   T+   +            S SG+  +  ++++      H    +  + +  +E+     ++ +++  DN   ++   FS++ Y  +V E+   GT    +  ++     Q N    ++ I    NT  +       I    G +     LD E    + + + A  G      +T+ + + ++D NDN P+    +S F++    + EN P+   I+ +   D DEG N  I     +   +   A++P     QT K               LDRE    F+  +   D G    ++S ++ + + D+NDN P F   +Y+ +  ED   G+ + TV ATD D    +S++ Y I        F+I  ++G   I +  SLDY+     ++ V A+D G     S    V+  +TD N+  P  +   Y+  + E+ P+ + V  + A DSD G   ++ + +++           FS +P  G I T    DRET S Y + + AKD GNPSL+ ++ + I + DVNDN P F  P         SI       + + +V+  D D G NG+I +   +  +    F I+ +SG I       + ++  +F L  IA D G+P     S+ + VQI
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDN---DNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR--FYTSQFQES---VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP--------------LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG---GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP-----LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESV-AVFHLTAIAVDKGSP---PLSSTVEVQI 1101          

HSP 2 Score: 172.94 bits (437), Expect = 3.083e-43
Identity = 167/584 (28.60%), Postives = 257/584 (44.01%), Query Frame = 2
Query:  797 FNDT---LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRL------SYVLMNRIILDREISSYFSVTIFCYDKGKIS---LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSH---ILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQF-FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLT-STPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            FNDT     +R  + N  P     F Q +Y   V E    G  +  V+ +  +     + +    ++  RS  LF ++    GV+ T+  LDRE  + H   VVA          T+T+ + +LD ND+ P         E+ E  I E   + ST++TL   D D G+N  I        ++ IE +       +D    +      S V+  R  LDRE S  + + +   D         T++ ++++++LD NDN P F +  Y +  PED   G+    +  + ATD D    N+ I Y+I        FSI+  SGD+ L   LDYE+     + + A D G P S S    +   V D ND  P+   S +   + EN+P+  ++  + A+DSD G   ++ + IS  D  F  +  P  G ++T    DRE +  +   + AKD G P  ++SSS+ I + DVNDNDP F    P    AN+     +   + +T V+  D DE        T      R   F I S +G   +T +    Y  +K F L V A D G    R  +A + + I D
Sbjct:  339 FNDTDIARRVRRELRNQSP----YFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDS--RSQSLF-KVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEA-----EQFEASIREGATVGSTVITLRATDQDIGKNAEI--------EYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN---PKYYEANVGED--QPPGTPVTTVTATDPDEDSRLHYEITTGNTRGR---FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG---RSDTATVHINITD 889          

HSP 3 Score: 127.872 bits (320), Expect = 2.596e-29
Identity = 150/573 (26.18%), Postives = 248/573 (43.28%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSS--MILPNATDKDIGINSVINYKLLNHT-NFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI----SDTQFFSC-----SPYGDIKTKISFDRE-TRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP 2164
            D NDN P F   T     S+ +  P    +I   A D D G N+ I Y +     NF       +G   +I  +++  +        + +++A +   P  + + ++ + + + + ++   F+ K Y   V E+   GT +  V   ++   + +   E  +        +  + G+  G+I     LD +++ +  + V A   D      T+TV I I D N+  P       IFE       + E+ P+ +T+L +   D D G N  I     +   +G  + +P +   QT           ++    LDRE +S + +T+   D G  SL+ +  +++ + D+NDN P F    YQ S  ED  +G+ ++ V A+D D    N +I Y +   +  D  F I+  SG I     LD E+     +  IA D+G P  LS  V V   + D+ND  P       T+Y+ EN P+ S V  I AHD D G    V+H+      D+  FS      S    + T    D E TR  + +++ A    +P L + + I I + DVNDN P
Sbjct:  681 DANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQ-----GRFAFQVVAKDGGVPPKSASSSVVITVQD-VNDNDPAFNPKYYEANVGEDQPPGTPVTTV-TATDPDEDSRLHYEITTGNTRGRFAITSQNGR--GLITIAQSLDYKQEKRFLLTVAAT--DSGGRSDTATVHINITDANNFAP-------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG---------AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP-LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA-VVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 4 Score: 125.946 bits (315), Expect = 1.064e-28
Identity = 108/386 (27.98%), Postives = 182/386 (47.15%), Query Frame = 2
Query: 1400 VLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIR---------KSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKS--LSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSH---VTSIVAHDSDTGFGGKVIHFI----SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSA--NISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIF--FINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            V+     LDRE+       +   D      + + T+++ +LD ND+ P F    ++ S  E   +GS ++T+ ATD D  + N++I Y I          + +   +F I+ RSG I   SSLD ET     + V A+D    +S   +    V   V D ND +PQ  + +YTV + E+    +    V  I A D+D G    + + I    + +QF   S  GD+      D E+  SY ++I A+D G+PS ++++ + + ++D NDN P F +    Q S   N+ + Y       + +V   D DEG N +I ++  E   R D F   ++  +G +  T  P     +  F+ +V+A D G P +  SS+ + + + D+
Sbjct:  415 VVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF-YTSQFQESVLENVPVGY------NIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQ-TIKPLDREEQGRFAFQVVAKDGGVPPKSASSS-VVITVQDV 787          
BLAST of Protocadherin-1-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 174.481 bits (441), Expect = 9.955e-44
Identity = 174/689 (25.25%), Postives = 299/689 (43.40%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKP----------SHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGT---VIGRVQLKSNKQINP---KFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD--IYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQF--------FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQI 2479
            D ND+ P F        +       S++I   ATD+DIG N+ I Y +   T+   +            S SG+  +  ++++      H    +  + +  +E+     ++ +++  DN   ++   FS++ Y  +V E+   GT    +  ++     Q N    ++ I    NT  +       I    G +     LD E    + + + A  G      +T+ + + ++D NDN P+    +S F++    + EN P+   I+ +   D DEG N  I     +   +   A++P     QT K               LDRE    F+  +   D G    ++S ++ + + D+NDN P F   +Y+ +  ED   G+ + TV ATD D    +S++ Y I        F+I  ++G   I +  SLDY+     ++ V A+D G     S    V+  +TD N+  P  +   Y+  + E+ P+ + V  + A DSD G   ++ + +++           FS +P  G I T    DRET S Y + + AKD GNPSL+ ++ + I + DVNDN P F  P         SI       + + +V+  D D G NG+I +   +  +    F I+ +SG I       + ++  +F L  IA D G+P     S+ + VQI
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDN---DNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR--FYTSQFQES---VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP--------------LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG---GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP-----LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESV-AVFHLTAIAVDKGSP---PLSSTVEVQI 1101          

HSP 2 Score: 172.94 bits (437), Expect = 3.051e-43
Identity = 167/584 (28.60%), Postives = 257/584 (44.01%), Query Frame = 2
Query:  797 FNDT---LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRL------SYVLMNRIILDREISSYFSVTIFCYDKGKIS---LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSH---ILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQF-FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLT-STPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            FNDT     +R  + N  P     F Q +Y   V E    G  +  V+ +  +     + +    ++  RS  LF ++    GV+ T+  LDRE  + H   VVA          T+T+ + +LD ND+ P         E+ E  I E   + ST++TL   D D G+N  I        ++ IE +       +D    +      S V+  R  LDRE S  + + +   D         T++ ++++++LD NDN P F +  Y +  PED   G+    +  + ATD D    N+ I Y+I        FSI+  SGD+ L   LDYE+     + + A D G P S S    +   V D ND  P+   S +   + EN+P+  ++  + A+DSD G   ++ + IS  D  F  +  P  G ++T    DRE +  +   + AKD G P  ++SSS+ I + DVNDNDP F    P    AN+     +   + +T V+  D DE        T      R   F I S +G   +T +    Y  +K F L V A D G    R  +A + + I D
Sbjct:  339 FNDTDIARRVRRELRNQSP----YFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDS--RSQSLF-KVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEA-----EQFEASIREGATVGSTVITLRATDQDIGKNAEI--------EYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN---PKYYEANVGED--QPPGTPVTTVTATDPDEDSRLHYEITTGNTRGR---FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG---RSDTATVHINITD 889          

HSP 3 Score: 127.872 bits (320), Expect = 2.706e-29
Identity = 150/573 (26.18%), Postives = 248/573 (43.28%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSS--MILPNATDKDIGINSVINYKLLNHT-NFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI----SDTQFFSC-----SPYGDIKTKISFDRE-TRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP 2164
            D NDN P F   T     S+ +  P    +I   A D D G N+ I Y +     NF       +G   +I  +++  +        + +++A +   P  + + ++ + + + + ++   F+ K Y   V E+   GT +  V   ++   + +   E  +        +  + G+  G+I     LD +++ +  + V A   D      T+TV I I D N+  P       IFE       + E+ P+ +T+L +   D D G N  I     +   +G  + +P +   QT           ++    LDRE +S + +T+   D G  SL+ +  +++ + D+NDN P F    YQ S  ED  +G+ ++ V A+D D    N +I Y +   +  D  F I+  SG I     LD E+     +  IA D+G P  LS  V V   + D+ND  P       T+Y+ EN P+ S V  I AHD D G    V+H+      D+  FS      S    + T    D E TR  + +++ A    +P L + + I I + DVNDN P
Sbjct:  681 DANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQ-----GRFAFQVVAKDGGVPPKSASSSVVITVQD-VNDNDPAFNPKYYEANVGEDQPPGTPVTTV-TATDPDEDSRLHYEITTGNTRGRFAITSQNGR--GLITIAQSLDYKQEKRFLLTVAAT--DSGGRSDTATVHINITDANNFAP-------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG---------AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP-LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA-VVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 4 Score: 125.946 bits (315), Expect = 1.071e-28
Identity = 108/386 (27.98%), Postives = 182/386 (47.15%), Query Frame = 2
Query: 1400 VLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIR---------KSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKS--LSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSH---VTSIVAHDSDTGFGGKVIHFI----SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSA--NISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIF--FINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            V+     LDRE+       +   D      + + T+++ +LD ND+ P F    ++ S  E   +GS ++T+ ATD D  + N++I Y I          + +   +F I+ RSG I   SSLD ET     + V A+D    +S   +    V   V D ND +PQ  + +YTV + E+    +    V  I A D+D G    + + I    + +QF   S  GD+      D E+  SY ++I A+D G+PS ++++ + + ++D NDN P F +    Q S   N+ + Y       + +V   D DEG N +I ++  E   R D F   ++  +G +  T  P     +  F+ +V+A D G P +  SS+ + + + D+
Sbjct:  415 VVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF-YTSQFQESVLENVPVGY------NIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQ-TIKPLDREEQGRFAFQVVAKDGGVPPKSASSS-VVITVQDV 787          
BLAST of Protocadherin-1-like vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 174.481 bits (441), Expect = 9.955e-44
Identity = 174/689 (25.25%), Postives = 299/689 (43.40%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKP----------SHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGT---VIGRVQLKSNKQINP---KFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD--IYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQF--------FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQI 2479
            D ND+ P F        +       S++I   ATD+DIG N+ I Y +   T+   +            S SG+  +  ++++      H    +  + +  +E+     ++ +++  DN   ++   FS++ Y  +V E+   GT    +  ++     Q N    ++ I    NT  +       I    G +     LD E    + + + A  G      +T+ + + ++D NDN P+    +S F++    + EN P+   I+ +   D DEG N  I     +   +   A++P     QT K               LDRE    F+  +   D G    ++S ++ + + D+NDN P F   +Y+ +  ED   G+ + TV ATD D    +S++ Y I        F+I  ++G   I +  SLDY+     ++ V A+D G     S    V+  +TD N+  P  +   Y+  + E+ P+ + V  + A DSD G   ++ + +++           FS +P  G I T    DRET S Y + + AKD GNPSL+ ++ + I + DVNDN P F  P         SI       + + +V+  D D G NG+I +   +  +    F I+ +SG I       + ++  +F L  IA D G+P     S+ + VQI
Sbjct:  456 DCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDN---DNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQ-----FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPR--FYTSQFQES---VLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP--------------LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG---GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSP-----LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESV-AVFHLTAIAVDKGSP---PLSSTVEVQI 1101          

HSP 2 Score: 172.94 bits (437), Expect = 3.051e-43
Identity = 167/584 (28.60%), Postives = 257/584 (44.01%), Query Frame = 2
Query:  797 FNDT---LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRL------SYVLMNRIILDREISSYFSVTIFCYDKGKIS---LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSH---ILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQF-FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLT-STPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            FNDT     +R  + N  P     F Q +Y   V E    G  +  V+ +  +     + +    ++  RS  LF ++    GV+ T+  LDRE  + H   VVA          T+T+ + +LD ND+ P         E+ E  I E   + ST++TL   D D G+N  I        ++ IE +       +D    +      S V+  R  LDRE S  + + +   D         T++ ++++++LD NDN P F +  Y +  PED   G+    +  + ATD D    N+ I Y+I        FSI+  SGD+ L   LDYE+     + + A D G P S S    +   V D ND  P+   S +   + EN+P+  ++  + A+DSD G   ++ + IS  D  F  +  P  G ++T    DRE +  +   + AKD G P  ++SSS+ I + DVNDNDP F    P    AN+     +   + +T V+  D DE        T      R   F I S +G   +T +    Y  +K F L V A D G    R  +A + + I D
Sbjct:  339 FNDTDIARRVRRELRNQSP----YFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDS--RSQSLF-KVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEA-----EQFEASIREGATVGSTVITLRATDQDIGKNAEI--------EYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN---PKYYEANVGED--QPPGTPVTTVTATDPDEDSRLHYEITTGNTRGR---FAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG---RSDTATVHINITD 889          

HSP 3 Score: 127.872 bits (320), Expect = 2.706e-29
Identity = 150/573 (26.18%), Postives = 248/573 (43.28%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSS--MILPNATDKDIGINSVINYKLLNHT-NFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI----SDTQFFSC-----SPYGDIKTKISFDRE-TRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP 2164
            D NDN P F   T     S+ +  P    +I   A D D G N+ I Y +     NF       +G   +I  +++  +        + +++A +   P  + + ++ + + + + ++   F+ K Y   V E+   GT +  V   ++   + +   E  +        +  + G+  G+I     LD +++ +  + V A   D      T+TV I I D N+  P       IFE       + E+ P+ +T+L +   D D G N  I     +   +G  + +P +   QT           ++    LDRE +S + +T+   D G  SL+ +  +++ + D+NDN P F    YQ S  ED  +G+ ++ V A+D D    N +I Y +   +  D  F I+  SG I     LD E+     +  IA D+G P  LS  V V   + D+ND  P       T+Y+ EN P+ S V  I AHD D G    V+H+      D+  FS      S    + T    D E TR  + +++ A    +P L + + I I + DVNDN P
Sbjct:  681 DANDNAPRF--YTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQ-----GRFAFQVVAKDGGVPPKSASSSVVITVQD-VNDNDPAFNPKYYEANVGEDQPPGTPVTTV-TATDPDEDSRLHYEITTGNTRGRFAITSQNGR--GLITIAQSLDYKQEKRFLLTVAAT--DSGGRSDTATVHINITDANNFAP-------IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTG---------AIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVG-LNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPP-LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNA-VVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 4 Score: 125.946 bits (315), Expect = 1.071e-28
Identity = 108/386 (27.98%), Postives = 182/386 (47.15%), Query Frame = 2
Query: 1400 VLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIR---------KSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKS--LSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSH---VTSIVAHDSDTGFGGKVIHFI----SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSA--NISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIF--FINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            V+     LDRE+       +   D      + + T+++ +LD ND+ P F    ++ S  E   +GS ++T+ ATD D  + N++I Y I          + +   +F I+ RSG I   SSLD ET     + V A+D    +S   +    V   V D ND +PQ  + +YTV + E+    +    V  I A D+D G    + + I    + +QF   S  GD+      D E+  SY ++I A+D G+PS ++++ + + ++D NDN P F +    Q S   N+ + Y       + +V   D DEG N +I ++  E   R D F   ++  +G +  T  P     +  F+ +V+A D G P +  SS+ + + + D+
Sbjct:  415 VVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGK-NAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRF-YTSQFQESVLENVPVGY------NIIRVQAYDSDEGANAEITYSISE---RDDNFPLAVDPRTGWVQ-TIKPLDREEQGRFAFQVVAKDGGVPPKSASSS-VVITVQDV 787          
BLAST of Protocadherin-1-like vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 219.164 bits (557), Expect = 2.709e-58
Identity = 199/703 (28.31%), Postives = 313/703 (44.52%), Query Frame = 2
Query:  377 KICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFI-----QIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYS-IRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPER 2446
            K C+ K K       C   F ++++  I +Q   L+   + + D NDN P FP   + + +       +   +P ATDKD   N V +Y L      +     Q+          +I +         S  L+IK  A++   P    +  +R+ I +A  ++   F +  Y  +V EN  +G  +  +Q+K+N   + P  +IE   +         L I +  G+I   G LDREE N     VVA         S + VSI + DQNDN P +   G+           I E+ P+ + +  +   D DEGEN  + C       F + P      +   +  +  Y L     LD E    + V I   D G  +L+S+ ++K+++ D NDN P+F    +++ + E+ + G  ++ V A+D D+  TN+++ YS I  S    LF I+  SG++   S LD E        V A+D+G P S  G   V   V D ND  P+  LS Y+  + EN+P  S V  +   D D G   +V   +     +F   +  G I + ISFDRE  SSYT  + A D G+P  +S   + I +LD NDN P    P     S+ I +S      S +  V  +DID G N +++++        D+F+I+ S+G I LT    + +   +  L +   D G P R
Sbjct:   86 KDCRNKGKP------CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIK--AVDGGNPPRYSSALLRVVIADAN-DNAPKFEKSSYEAEVAENSPIGHSV--LQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP-----ASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSG-TNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVP-SHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP---SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPH-DLFYISPSNGEITLTKELTRKH-SGLHRLVIKVSDRGKPSR 765          
BLAST of Protocadherin-1-like vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 219.164 bits (557), Expect = 5.089e-58
Identity = 199/703 (28.31%), Postives = 313/703 (44.52%), Query Frame = 2
Query:  377 KICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFI-----QIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYS-IRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPER 2446
            K C+ K K       C   F ++++  I +Q   L+   + + D NDN P FP   + + +       +   +P ATDKD   N V +Y L      +     Q+          +I +         S  L+IK  A++   P    +  +R+ I +A  ++   F +  Y  +V EN  +G  +  +Q+K+N   + P  +IE   +         L I +  G+I   G LDREE N     VVA         S + VSI + DQNDN P +   G+           I E+ P+ + +  +   D DEGEN  + C       F + P      +   +  +  Y L     LD E    + V I   D G  +L+S+ ++K+++ D NDN P+F    +++ + E+ + G  ++ V A+D D+  TN+++ YS I  S    LF I+  SG++   S LD E        V A+D+G P S  G   V   V D ND  P+  LS Y+  + EN+P  S V  +   D D G   +V   +     +F   +  G I + ISFDRE  SSYT  + A D G+P  +S   + I +LD NDN P    P     S+ I +S      S +  V  +DID G N +++++        D+F+I+ S+G I LT    + +   +  L +   D G P R
Sbjct:   86 KDCRNKGKP------CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIK--AVDGGNPPRYSSALLRVVIADAN-DNAPKFEKSSYEAEVAENSPIGHSV--LQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP-----ASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSG-TNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVP-SHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP---SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPH-DLFYISPSNGEITLTKELTRKH-SGLHRLVIKVSDRGKPSR 765          
BLAST of Protocadherin-1-like vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 215.698 bits (548), Expect = 3.261e-57
Identity = 231/823 (28.07%), Postives = 355/823 (43.13%), Query Frame = 2
Query:   38 MIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKY--FGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSI-FEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANIS---ISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHG 2434
            +++ LF C    FL+       Y ++EEQ  ++ +GNL  D        N N      L   + F   +P  K     L+   +   E  L T +RIDRE++C      S   N K C  + +      +   +F +    F+               D NDN PLF    IN+ +       S   +P+A D DIGIN + +Y+L+          S S   L II   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F        V EN  +GT +  +      L SN QI+  F     SN +  S      I    G+I     LDRE    H + V+A+  D     S +TV + + D NDN P I     +      V + EN P+++ I  +   D D   NG + C       F ++P+  +            ++L     LD E +  +++ I   D GK  L +S  + ++I D NDN PVFP+   Q+S PE+ + G+ ++ ++ATD D+  +N+ I YS+   +  D F+I+ RSG + +   LD E        VIA D G    L  NV V   V D ND  P      Y  Y+ ENLP+   V  I   D+D G    V +  I+    F   P  G IK  I+FDRE +SSYT ++ A D G    TS + + I ++DVNDN P FV P     S+N S   +       S +T+V   D D G N ++ ++     LR  +F I+ ++G I L               K++A D G
Sbjct:    9 VLVVLFTC---LFLMCRAQEKDYTVKEEQPENVRIGNLRKDL-------NLNLDPDIKLSSALQF---KPVYKTGDVPLVKVEASTGE-ILTTANRIDREKLC------SGVFNEKRCYYEIEVAV---LPDEIFRLVKIRFLIE-------------DINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVK---------SVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSD-VNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSF-----SNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLAS--DGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFND-----------QFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSG-SNALIIYSL-GPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGT-TPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIP-----SSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRG-LFTIDKTTGNITLQE-------------KIVAADQG 745          
BLAST of Protocadherin-1-like vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 216.083 bits (549), Expect = 3.857e-57
Identity = 231/823 (28.07%), Postives = 355/823 (43.13%), Query Frame = 2
Query:   38 MIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKY--FGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSI-FEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANIS---ISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHG 2434
            +++ LF C    FL+       Y ++EEQ  ++ +GNL  D        N N      L   + F   +P  K     L+   +   E  L T +RIDRE++C      S   N K C  + +      +   +F +    F+               D NDN PLF    IN+ +       S   +P+A D DIGIN + +Y+L+          S S   L II   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F        V EN  +GT +  +      L SN QI+  F     SN +  S      I    G+I     LDRE    H + V+A+  D     S +TV + + D NDN P I     +      V + EN P+++ I  +   D D   NG + C       F ++P+  +            ++L     LD E +  +++ I   D GK  L +S  + ++I D NDN PVFP+   Q+S PE+ + G+ ++ ++ATD D+  +N+ I YS+   +  D F+I+ RSG + +   LD E        VIA D G    L  NV V   V D ND  P      Y  Y+ ENLP+   V  I   D+D G    V +  I+    F   P  G IK  I+FDRE +SSYT ++ A D G    TS + + I ++DVNDN P FV P     S+N S   +       S +T+V   D D G N ++ ++     LR  +F I+ ++G I L               K++A D G
Sbjct:    9 VLVVLFTC---LFLMCRAQEKDYTVKEEQPENVRIGNLRKDL-------NLNLDPDIKLSSALQF---KPVYKTGDVPLVKVEASTGE-ILTTANRIDREKLC------SGVFNEKRCYYEIEVAV---LPDEIFRLVKIRFLIE-------------DINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVK---------SVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSD-VNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSF-----SNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLAS--DGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHDVPFRLKPVFND-----------QFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSG-SNALIIYSL-GPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGT-TPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIP-----SSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSLRG-LFTIDKTTGNITLQE-------------KIVAADQG 745          
BLAST of Protocadherin-1-like vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 208.764 bits (530), Expect = 7.216e-55
Identity = 249/949 (26.24%), Postives = 419/949 (44.15%), Query Frame = 2
Query:   35 MMIIGLFLCKNYYFLIFHNVS-------VTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYF------GLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHIT-LSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIK----------PSHSGLNL--------SIININKAAEYFLHSQPLSIKILAINTEK---------------PFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS-NKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLD--SSIFEKKEV-EIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ-FFSC-SPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFP--------PPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLK--KIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTM-VLAGILIVIIMSILTAVVYVCH 2686
            M   G+    +Y FLI   +S       + YR+ EE    + VGN+ +D  I    A  + ++           + +   +YF      G +ST+            RIDRE               K+ QC+    F +  C   F ++ + P        L   +V+I+D NDN P FP   + + +   +   +  +LP ATD+D G N +  Y+L+       ++           SHSG           S+  +  A       QP  I   A++ E+               P  +    +R+ I + + ++   F + +Y   + EN + G  I  +QLK+ +  +    +IE        S    L + +  G +     +DRE+ +Q    V+A           +TV I I D+NDN P I +     IF K  V  + E+  +D+ I  +   D D+G NG + C  +    F ++P +   +   D++ +  Y L     LD E    ++V I   D G  SL+S+ ++ +++ DMNDNPPVF K+  ++S+PE+   G  ++TV A D D+ + N++I YS+  S N  +FSI+  +GDI + + LD E        VIA D+G P  L G+  V   V D ND  P+ +Q  +T YI ENL   S V  I   D+D G    +  +I + +  FS  +  G I + ++FDRE R++Y+  + A D G+P  ++++++ + ++DVNDN P  +FP        PP   S+NI    R         VS  D D G N  + +        K +F +++ +G+I L    GK   K   +  L V  +D G P +   S    V I   E +     TI  +++  S      +D++    +    +  ++ + V++GI+ VI++ ++  +   C 
Sbjct:    1 MRTTGIVDYLSYCFLILQLLSQPAAKQVLRYRLAEEGPADVRVGNVAADLGI---TAGMDVTF-----------TLESGSEYFKIDNMTGDLSTNER----------RIDRE---------------KLPQCQMI--FDENECFIDFEVSVIGP--AQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITD-VNDNTPRFEKSVYEADLPENSSPGAPI--LQLKAGDTDVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPAS---EVEGDMNKK-KYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSGK-NAEISYSLDSSVNG-IFSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMP-VLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGMITVMDADKGQNADMSLYIEEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTLLPP---SSNIRTVVR--------TVSATDTDTGVNANLSYRIVGGNPFK-LFDMDAWTGVISLV---GKLEQKHFGLHRLVVQVNDSGVPSQ---STTTLVHIYVNETLF--NSTIVEAQVAKSLSTPLNADIAGDPNYDLGKQRLSIAIGVVSGIMTVILIILVVVMARYCR 876          
BLAST of Protocadherin-1-like vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 209.149 bits (531), Expect = 7.902e-55
Identity = 219/799 (27.41%), Postives = 352/799 (44.06%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPE 2443
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C      + S NS   +C              F + +   + +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+A D D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  +GT + ++      + SN +I   F  +  S T          +    G+I     LDREE   H + V+A   D     + +TV+I + D NDN P I L   I      V + E  PI++ I  +   D D   N  + C       F ++ +               Y+L    +LD E    FS  I   D GK SL  +  +++ + D NDNPP+F +   ++S  E+   G ++ TV+A+D D+ + NS I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I A DSD G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I I+D NDN P  V  PPS  S  + +       S + +V   D D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGSSTSL-VYRLVSKAGDSP------LVKVSSSTGEIF-TTSTRIDREKLC------AGSSNSDENEC-------------FFELEVV-ILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKR-----LFALNNTTGLITVQRPLDREETAVHKLTVLAT--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHLKAVYDN-----------QYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGK-NSDIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPSAADV-GLHRLVVNISDLGYPK 762          

HSP 2 Score: 88.1965 bits (217), Expect = 5.091e-17
Identity = 91/342 (26.61%), Postives = 156/342 (45.61%), Query Frame = 2
Query: 1499 VTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSIN-------ERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYT-VYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPY--------GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP----EFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSS 2458
            + IK+ + D NDN P+FP     IS PE+  I S     +A D D T  N    Y +   ++  +F ++       E+   + +  +LD E     V+ +   D G P+  S   I+  TV+D+ND  P  + S   V+I EN PI + V  + A D+D G   + I +I   Q  S +          G I  +   DRE  + + + + A D    S  + +++ I + DVNDN P     ++  P    +  + +S ++  ++++  ++  D D   N K+I     ++ R+  F + +     YL  TS+   Y   K FS K++A D G P   +++
Sbjct:  126 IKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPD-TGFNGVQHYELLNGQS--VFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQK-SSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAE-IKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGS--STPARATVTINVTDVNDNPPNIDLRYIISPI---NGTVYLSEKDPINTKIALITVSDKDTDVNSKVIC----FIEREVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTA 453          
BLAST of Protocadherin-1-like vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 204.142 bits (518), Expect = 3.528e-53
Identity = 231/849 (27.21%), Postives = 380/849 (44.76%), Query Frame = 2
Query:   23 SLKLMMIIGLFLCKNYYF----LIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMI--LPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPK--FKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS-DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISY---REQSSSELTKVSCKDIDEGDNGKIIFTF-----FEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLK---VIAHDHGTPERRKSS 2458
            SLKL M      C  + F    ++  +  V YR+ EEQ  +I +G+L SD+              K+L +L       P  +  G         + Y  T + IDRE                + +C+   P     C   F ++++  + S +  LL  ++ I+D NDN P F    I   LS+ +     M+  +P ATD+D G+N V +Y+L+          +Q+          +I +         S  L+IK+    T  P    +  +R+ I    DNA P+    F +  Y  ++ EN  +G  + +V+   S++ +N +  +   + S+T+ R     L + +  G+I   G +DRE+       VVA         + + V+I I D NDN P I   G      +     I E+ P+++ +  +   D DEG N  + C       F ++ ++     +K       Y L     LD E    +++ I   D G   L+S+ ++K+++ D+NDN PVF ++  ++ +PE+ +I   ++ V+ATD D+   NSQ+ YSI    ++  +FSIN  SG I + + LD E   +   +V+A D+G P SL G   V  TV D ND  P+  L  Y   + EN+P  S V  +   D+D G     IH   +    +F   +  G I + ISFDRE +S+YT  + A D G+P  +S   + I +LD NDN P  V P      +NIS  Y   +    + +  V  +D+D G N ++ ++      FE      +F I+ ++G + L     K  ++K + L    V   D G P R  ++
Sbjct:   40 SLKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPD---------SKHLYKLEL---GHPYLRVDG------KTGDIY-TTETSIDRE---------------SLRECQNLEPGEK--CFLEFEVSMTDLM-SPVPRLLDGQIEIMDINDNTPNFNSPVIT--LSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGT--PARASSALLRISILDTNDNA-PK----FEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR----LLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK-----KYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAH-IHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP------SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE------LFQISHNNGEVTLE----KAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 93.2041 bits (230), Expect = 1.508e-18
Identity = 96/350 (27.43%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 1508 KLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSI------NERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP-----EFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGK---IIFTFFEYLLRKDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            ++ I+D+NDN P F      +S PE+  IG       ATD D+       +  I   E  DLF +      +E+   + +   LD E      + +   D G P   S + ++  ++ D ND  P+ + ++Y   + EN P+   V  + A+DSD G   ++    H  SDT           G I  +   DRE   +    + AKD G    T+ + + I I D NDN P      F       G ANIS     ++   L +VS  DIDEG N     ++     + L K +    S S   Y   T+T   Y   K ++++++A D G P    S+ ++ VQ+ D+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARAS-SALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVS--DIDEGVNAAVTCVVAGDVPFQL-KQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPP-LSSTNSLKVQVTDV 507          
BLAST of Protocadherin-1-like vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 202.986 bits (515), Expect = 6.524e-53
Identity = 231/849 (27.21%), Postives = 380/849 (44.76%), Query Frame = 2
Query:   23 SLKLMMIIGLFLCKNYYF----LIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMI--LPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPK--FKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS-DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISY---REQSSSELTKVSCKDIDEGDNGKIIFTF-----FEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLK---VIAHDHGTPERRKSS 2458
            SLKL M      C  + F    ++  +  V YR+ EEQ  +I +G+L SD+              K+L +L       P  +  G         + Y  T + IDRE                + +C+   P     C   F ++++  + S +  LL  ++ I+D NDN P F    I   LS+ +     M+  +P ATD+D G+N V +Y+L+          +Q+          +I +         S  L+IK+    T  P    +  +R+ I    DNA P+    F +  Y  ++ EN  +G  + +V+   S++ +N +  +   + S+T+ R     L + +  G+I   G +DRE+       VVA         + + V+I I D NDN P I   G      +     I E+ P+++ +  +   D DEG N  + C       F ++ ++     +K       Y L     LD E    +++ I   D G   L+S+ ++K+++ D+NDN PVF ++  ++ +PE+ +I   ++ V+ATD D+   NSQ+ YSI    ++  +FSIN  SG I + + LD E   +   +V+A D+G P SL G   V  TV D ND  P+  L  Y   + EN+P  S V  +   D+D G     IH   +    +F   +  G I + ISFDRE +S+YT  + A D G+P  +S   + I +LD NDN P  V P      +NIS  Y   +    + +  V  +D+D G N ++ ++      FE      +F I+ ++G + L     K  ++K + L    V   D G P R  ++
Sbjct:   40 SLKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPD---------SKHLYKLEL---GHPYLRVDG------KTGDIY-TTETSIDRE---------------SLRECQNLEPGEK--CFLEFEVSMTDLM-SPVPRLLDGQIEIMDINDNTPNFNSPVIT--LSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGT--PARASSALLRISILDTNDNA-PK----FEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR----LLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK-----KYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAH-IHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP------SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE------LFQISHNNGEVTLE----KAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 92.8189 bits (229), Expect = 2.030e-18
Identity = 96/350 (27.43%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 1508 KLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSI------NERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP-----EFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGK---IIFTFFEYLLRKDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            ++ I+D+NDN P F      +S PE+  IG       ATD D+       +  I   E  DLF +      +E+   + +   LD E      + +   D G P   S + ++  ++ D ND  P+ + ++Y   + EN P+   V  + A+DSD G   ++    H  SDT           G I  +   DRE   +    + AKD G    T+ + + I I D NDN P      F       G ANIS     ++   L +VS  DIDEG N     ++     + L K +    S S   Y   T+T   Y   K ++++++A D G P    S+ ++ VQ+ D+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARAS-SALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVS--DIDEGVNAAVTCVVAGDVPFQL-KQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPP-LSSTNSLKVQVTDV 507          
BLAST of Protocadherin-1-like vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 203.371 bits (516), Expect = 7.664e-53
Identity = 231/849 (27.21%), Postives = 380/849 (44.76%), Query Frame = 2
Query:   23 SLKLMMIIGLFLCKNYYF----LIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMI--LPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPK--FKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS-DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISY---REQSSSELTKVSCKDIDEGDNGKIIFTF-----FEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLK---VIAHDHGTPERRKSS 2458
            SLKL M      C  + F    ++  +  V YR+ EEQ  +I +G+L SD+              K+L +L       P  +  G         + Y  T + IDRE                + +C+   P     C   F ++++  + S +  LL  ++ I+D NDN P F    I   LS+ +     M+  +P ATD+D G+N V +Y+L+          +Q+          +I +         S  L+IK+    T  P    +  +R+ I    DNA P+    F +  Y  ++ EN  +G  + +V+   S++ +N +  +   + S+T+ R     L + +  G+I   G +DRE+       VVA         + + V+I I D NDN P I   G      +     I E+ P+++ +  +   D DEG N  + C       F ++ ++     +K       Y L     LD E    +++ I   D G   L+S+ ++K+++ D+NDN PVF ++  ++ +PE+ +I   ++ V+ATD D+   NSQ+ YSI    ++  +FSIN  SG I + + LD E   +   +V+A D+G P SL G   V  TV D ND  P+  L  Y   + EN+P  S V  +   D+D G     IH   +    +F   +  G I + ISFDRE +S+YT  + A D G+P  +S   + I +LD NDN P  V P      +NIS  Y   +    + +  V  +D+D G N ++ ++      FE      +F I+ ++G + L     K  ++K + L    V   D G P R  ++
Sbjct:   40 SLKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPD---------SKHLYKLEL---GHPYLRVDGKTG------DIY-TTETSIDRE---------------SLRECQNLEPGEK--CFLEFEVSMTDLM-SPVPRLLDGQIEIMDINDNTPNFNSPVIT--LSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGT--PARASSALLRISILDTNDNA-PK----FEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR----LLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK-----KYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAH-IHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP------SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE------LFQISHNNGEVTLE----KAIIRKHYGLHRLVVKVTDKGKPSRHGTA 814          

HSP 2 Score: 92.8189 bits (229), Expect = 2.197e-18
Identity = 96/350 (27.43%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 1508 KLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSI------NERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP-----EFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGK---IIFTFFEYLLRKDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            ++ I+D+NDN P F      +S PE+  IG       ATD D+       +  I   E  DLF +      +E+   + +   LD E      + +   D G P   S + ++  ++ D ND  P+ + ++Y   + EN P+   V  + A+DSD G   ++    H  SDT           G I  +   DRE   +    + AKD G    T+ + + I I D NDN P      F       G ANIS     ++   L +VS  DIDEG N     ++     + L K +    S S   Y   T+T   Y   K ++++++A D G P    S+ ++ VQ+ D+
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARAS-SALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVS--DIDEGVNAAVTCVVAGDVPFQL-KQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPP-LSSTNSLKVQVTDV 507          
BLAST of Protocadherin-1-like vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 202.601 bits (514), Expect = 1.531e-52
Identity = 226/845 (26.75%), Postives = 374/845 (44.26%), Query Frame = 2
Query:   23 SLKLMMIIGLFLCKNYYF----LIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMI--LPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPK--FKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS-DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISY---REQSSSELTKVSCKDIDEGDNGKIIFTF-----FEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLK---VIAHDHGTPERRKSS 2458
            SLKL M      C  + F    ++  +  V YR+ EEQ  +I +G+L SD+              K+L +L       P  +  G              T + IDRE                + +C+   P     C   F ++++  + S +  LL  ++ I+D NDN P F    I   LS+ +     M+  +P ATD+D G+N V +Y+L+          +Q+          +I +         S  L+IK+    T     +  L I +   N   ++   F +  Y  ++ EN  +G  + +V+   S++ +N +  +   + S+T+ R     L + +  G+I   G +DRE+       VVA         + + V+I I D NDN P I   G      +     I E+ P+++ +  +   D DEG N  + C       F ++ ++     +K       Y L     LD E    +++ I   D G   L+S+ ++K+++ D+NDN PVF ++  ++ +PE+ +I   ++ V+ATD D+   NSQ+ YSI    ++  +FSIN  SG I + + LD E   +   +V+A D+G P SL G   V  TV D ND  P+  L  Y   + EN+P  S V  +   D+D G     IH   +    +F   +  G I + ISFDRE +S+YT  + A D G+P  +S   + I +LD NDN P  V P      +NIS  Y   +    + +  V  +D+D G N ++ ++      FE      +F I+ ++G + L     K  ++K + L    V   D G P R  ++
Sbjct:   32 SLKLAMKRTATACFLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPD---------SKHLYKLEL---GHPYLRVDGKTGD-------IYTTETSIDRE---------------SLRECQNLEPGEK--CFLEFEVSMTDLM-SPVPRLLDGQIEIMDINDNTPNFNSPVIT--LSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTN---DNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRR----LLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKK-----KYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG-PNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIP-SLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAH-IHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVP------SNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFE------LFQISHNNGEVTLE----KAIIRKHYGLHRLVVKVTDKGKPSRHGTA 806          

HSP 2 Score: 92.4337 bits (228), Expect = 2.745e-18
Identity = 96/350 (27.43%), Postives = 151/350 (43.14%), Query Frame = 2
Query: 1508 KLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSI------NERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP-----EFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGK---IIFTFFEYLLRKDIFFINSSSGIIYL--TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            ++ I+D+NDN P F      +S PE+  IG       ATD D+       +  I   E  DLF +      +E+   + +   LD E      + +   D G P   S + ++  ++ D ND  P+ + ++Y   + EN P+   V  + A+DSD G   ++    H  SDT           G I  +   DRE   +    + AKD G    T+ + + I I D NDN P      F       G ANIS     ++   L +VS  DIDEG N     ++     + L K +    S S   Y   T+T   Y   K ++++++A D G P    S+ ++ VQ+ D+
Sbjct:  155 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARAS-SALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVS--DIDEGVNAAVTCVVAGDVPFQL-KQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPP-LSSTNSLKVQVTDV 499          
BLAST of Protocadherin-1-like vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 213.386 bits (542), Expect = 7.892e-57
Identity = 217/813 (26.69%), Postives = 359/813 (44.16%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +               Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   + E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D D G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   DID G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDN-----------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKALHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 212.616 bits (540), Expect = 7.160e-56
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   + E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D D G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   DID G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKALHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 212.616 bits (540), Expect = 8.433e-56
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   + E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D D G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   DID G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKALHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 212.616 bits (540), Expect = 8.433e-56
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   + E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D D G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   DID G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKALHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 211.846 bits (538), Expect = 1.115e-55
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   + E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D D G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   DID G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKALHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 4.644e-55
Identity = 218/813 (26.81%), Postives = 360/813 (44.28%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            Y I EE   ++ +GN+  D  I  I A    S    + +L+      P      L+  SS   E +  T +RIDRE++C    +  ++                  C     + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G N V +Y+LLN           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  VGT + ++      + SN +I   F  +    T          +    G+I     LDREE   H V V+A+  D     + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +   Y           Y+L    +LD E +  FS  I   D GK SL  +  +++++ D NDNPP+F +   ++S  E+   G ++ T++ATD D+ + N+ I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   D+D G    V +  ++D   F   PY G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  V  PPS  S  + +       S + +V   D+D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:   28 YTIREELPENVPIGNIPKDLNISHINAATGTSASL-VYRLVSKAGDAP------LVKVSSSTGEIF-TTSNRIDREKLCAGASYAEENE-----------------CFFELEVVILP---NDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLN---------GQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSD-VNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKR-----LFALNNTTGLITVQRSLDREETAIHKVTVLAS--DGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAV---YDN--------QYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGK-NADIVYQL--GPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPP-LQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSP-VVISPPSNTSFKL-VPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDV-GLHRLVVNISDLGYPKSLHTLVLVFLYVND 776          
BLAST of Protocadherin-1-like vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.341e-53
Identity = 241/910 (26.48%), Postives = 397/910 (43.63%), Query Frame = 2
Query:   11 NCHMSL--KLMMIIGLFLCKNYYFLIFHNVSV--TYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF--IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEK---PFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE-VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT---KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS--ANIFVQIVDIEPIL---KVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVV 2674
            NCH  L     +   L +C     ++FH+ +    Y I EE   ++ +GNL  D  +  I  N++ +      +L++     P      LI       E +  T +RIDRE++C                  R     D  C     + + P    +IF L+ +  +I D NDN PLFP   IN+ +       S   LP A D D+GIN V NY+L+   N   + +  +  G  +  + + K     L  +     ++ +  E    P  + T  +++ + +   ++  +F +      + EN  VGT + ++   ++  I    KI    SN +   A     +    G+I     LDREE   H + V+A+  D   + + + V + + D NDN P I +   +    + V + EN P+++ I  +   D D   NG + C       F + P+               ++L N   LD E +  +++ +   D GK  L  S  + +++ D NDN PVF ++F  +S PE+   G  ++ V+ATD D+   N++I Y +      + FS++ R+G + +   LD E     +  ++A D G P  L+ NV V+ ++ D ND  P    + Y  Y+ ENLP    V  I   D D G    V   I D    F   S  G I+  ISFDRE + SYT  + A+D G  S +SS+ + I ++DVNDN P F+ PP      N S      S++  T   +V   D D G N ++ ++      R D+F I+  +G I L       +L  +  + V A+D G P+   S    N+FV        L    V+++I+    P +      S  S++ +             +AG + V+++  +TAVV
Sbjct:   30 NCHKCLLSGTYIFAVLLVC-----VVFHSGAQEKNYTIREEIPENVLIGNLLKDLNLSLIP-NKSLTTTMQF-KLVYKTGDVP------LIRIEEDTGEIF-TTGARIDREKLC--------------AGIPR-----DEHCFYEVEVAILP---DEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKE----LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTN-DNHPVFKETEIEVSIPENAPVGTSVTQLH-ATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS--DGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----------QFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSG-PNAEINYLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP-LTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-----YNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTR-DLFAIDQETGNITLMEKCDVTDL-GLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTPNTEIADVSSPTSDYVKIL--------VAAVAGTITVVVVIFITAVV 866          
BLAST of Protocadherin-1-like vs. UniProt/SwissProt
Match: sp|O35161|CELR1_MOUSE (Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3)

HSP 1 Score: 207.223 bits (526), Expect = 5.963e-53
Identity = 189/680 (27.79%), Postives = 317/680 (46.62%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGL--NLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQI-NPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKE-VYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSH--GQFAIEPLNKEYQ-----TTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD--IYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            D ND+ P+F Q      +    E    ++   ATD D   N+ + Y+LL     +    + SG+    ++++  +AAEY      L ++           + + T+ + +++   ++   FS+K Y  +V E++ V T + RVQ     Q  N        S  L+   G F  +    G +     LD E   ++ + + A  G     + S+  VS+++LD NDN P     SS F+     + EN P+  ++L +   D D GEN  +     D  S   G  +++  N            + SG ++        LDRE   ++S  +   D G  +++SS ++ + +LD+NDN P+F +  Y++   ED  +GS +LT+ A D DA   NS I Y +      + F+++ +SG   I L   LDY+     V+ V ASD     + S    V+  VTD N   P  Q S YTV ++E+ P+ + + +I A D DTG   ++ + + D   QF      G I T    D E +++YT+ I A+D G P  + ++S+ I ILD NDN P F+     +     S+      S+ + +VS  D D G NG++++TF         F+I  +SG+I       + N+  +++L  +A D G+P    +S  I V ++DI
Sbjct:  360 DTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAGGVFEIDARSGVVRTRAVVDREEAAEY-----QLLVEANDQGRNPGPLSASATVHIVVEDEN-DNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGNLK---GQFY-LHSLSGSLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPI--FVSSPFQ---AAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAE----LDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA---NSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASD----GTRSHTAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARITYVLEDPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFL-----RDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENV-AVYNLWALAVDRGSPNPLSASVGIQVSVLDI 1007          

HSP 2 Score: 158.303 bits (399), Expect = 1.040e-37
Identity = 139/526 (26.43%), Postives = 232/526 (44.11%), Query Frame = 2
Query:  992 ERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVE--IPENRPIDSTILTLFPEDPDEGENGTIFCDCL--SHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGK--ISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ---------------------FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            ERS G FL I    G + T   LDRE ++ H ++V A         + + +++ + D ND+ P       +FE+ E    I EN  +   +LT+   D D   N  +    L  + G F I+                S V+  R ++DRE ++ + + +   D+G+    L++S T+ + + D NDN P F +  Y +  PED+ + + +L V ATD D  + N+ I YSI        F ++  SG + + + LD+E      + + A D G P  ++ + +V   V D+ND  P    S +   + EN+P+   V  I A D+D G   ++ + + DT                      F   +  G I      DRE    Y+  + A D G+P+++SS+S+ I +LDVNDNDP F  P          +   E ++   + ++ +  D   N  I +       R      + S G +   + P  Y  ++ + L V A D GT   R  +A +F+ + D
Sbjct:  305 ERSNGYFL-IDAATGAVTTARSLDRETKDTHVLKVSAVDHGSPRRSAATYLTVTVSDTNDHSP-------VFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAGGVFEID--------------ARSGVVRTRAVVDREEAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQ-NAAIHYSIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQP-------VYELRLNEDAAVGSSVLTLRARDRDANSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASD-GT---RSHTAQVFINVTD 796          

HSP 3 Score: 146.747 bits (369), Expect = 3.597e-34
Identity = 143/583 (24.53%), Postives = 259/583 (44.43%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFI-------------------QIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDL-FSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT---QFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            D NDN P+F        +        S++   A D D G N+ + Y+L++  + I                   QI  S   + +      +  E++      S  + A++   P  + + ++ + + + + ++  +F+Q +Y  ++ E+  VG+ +  ++ + ++  N     +    NT  R A   L      G+I     LD +++ Q+ + V A+ G       T+ V I + D N + P       +F+     V + E+RP+ ++I T+   D D GEN  I         + +E    +++   D        +     LD E  + +++ I   D G    + + ++++ ILD NDN P F ++FYQ S  ED    + +L V+ATD D+   N ++ Y+ +  ++ D  F I   SG I     LD E      +  +A DRG P  LS +V +  +V DIND  P  +     +++ EN P+ S V  I A+D D G   ++++ I +    + F      GD++  +  D E R  Y +++ A       L S +++ I++LD NDN PE 
Sbjct:  572 DVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHY------SFGVEAVDHGSPAMSSSASVSITVLD-VNDNDPMFTQPVYELRLNEDAAVGSSVLTLRAR-DRDANSVITYQLTGGNTRNRFA---LSSQSGGGLITLALPLDYKQERQYVLAVTASDGTRSH---TAQVFINVTDANTHRP-------VFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARI--------TYVLEDPVPQFRIDPDTG-----TIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSG-PNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYMLVVQATSA---PLVSRATVHIRLLDQNDNPPEL 1116          

HSP 4 Score: 145.976 bits (367), Expect = 7.688e-34
Identity = 123/454 (27.09%), Postives = 208/454 (45.81%), Query Frame = 2
Query: 1217 EVEIPENRPIDSTILTLFPEDPDEGENGTI------FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGF-PKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD----TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIF-IKILDVNDNDPEFVFPPPSQGS-ANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEY---------------LLRKDI-FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            +V +PEN P  + ++ L   DPDEG+ G +        D  S+G F I+       T +               LDRE      + +   D G    +++  + + + D ND+ PVF ++ Y+    E+LE+G  +LT+ ATD DA  +N+ + Y + +     +F I+ RSG +   + +D E      + V A+D+G  P  LS +  V+  V D ND +PQ  +  Y V + E++ + + V  + A D D G    + + I       QF+  S  G +      D E    YT+ I A+D G P L +SS +  +++LDVNDN P FV  P       N+ + +       +  +   D D G+N ++ +   +                    D  F I++SSG I + +   +  ++  +S  V A DHG+P    SSA++ + ++D+
Sbjct:  266 QVSVPENEPAGTAVIELRAHDPDEGDAGRLSYQMEALFDERSNGYFLIDAATGAVTTARS--------------LDRETKDTHVLKVSAVDHGSPRRSAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAP-SNANMRYRLLEGAGG-VFEIDARSGVVRTRAVVDREEAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGH------SVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEH-YSFGVEAVDHGSPA-MSSSASVSITVLDV 695          

HSP 5 Score: 138.658 bits (348), Expect = 1.281e-31
Identity = 158/641 (24.65%), Postives = 283/641 (44.15%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHS--------QPL--------SIKILAINTEK-PFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ---LKSNKQINPKFKIEKCSNTL----------ERSAGLF-LEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS-----DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPS-LTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFE 2308
            D+NDN P F ++   V +       ++++   ATD+D G N+ I+Y                    SI++ N   +++LHS         PL        +++I A +  + P  N +  + + + + + ++  +F    +   V EN+ +G  +  +Q     + +    ++++   ++T+            SA  F  +I    G I     LDREE   +   V A       + S+++VSI +LD NDN P       +F +   E+ + E+  + S++LTL   D D     ++    L+ G       N+   +++   G ++  L     LD +    + + +   D G  S T+ V I   + D N + PVF  + Y +S  ED  +G+ I T++ATD D T  N++I Y +   +    F I+  +G IY  + LDYE      + + A D G P+  S    +   + D ND  P+ L+  Y   + E+ P  + V  + A D D+G  G++++        D  F+     G I+T+   DRE  + Y +   A D G+P+ L++S  I + +LD+NDN P F      +    + +       S + ++   D DEG N +I++   E
Sbjct:  466 DENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHY--------------------SIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLD-VNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDP-------MFTQPVYELRLNEDAAVGSSVLTLRARDRDA---NSVITYQLTGGNTR----NRFALSSQSGGGLITLALP----LDYKQERQYVLAVTASD-GTRSHTAQVFIN--VTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDED-TGENARITYVLE--DPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQK-SDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVF-----EKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVE 1055          

HSP 6 Score: 111.309 bits (277), Expect = 3.497e-23
Identity = 132/498 (26.51%), Postives = 215/498 (43.17%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLD---SSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIF----CDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKIS-LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL---QLSYTVYI---AENLPIQSHVTSIVAHDSD 1951
            D NDN P+F Q    + L+      SS++   A D+D   NSVI Y+L   N  N   +     G    +I +    +Y    Q     +LA+       + T  + + + +A      +F    Y   V E+  VGT I  +   +++      +I   +  LE     F  I    G I T   LD E+Q  + + + A      +   T+++ I ILD NDN P+   D    S+FE        + P  +++L +   D D G NG +           G F IEP               S V+  +  LDRE  + +++     D+G  + L++SV I++ +LD+NDNPPVF K+  ++   E+  +GS +  + A D D    N+QI Y I +    ++F ++  SGD+     LD+E     ++ V A+       L     V+  + D ND  P+L   Q+ +  Y+   + + P    +  I AHD D
Sbjct:  694 DVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDA--NSVITYQLTGGNTRNRFALSSQSGG---GLITLALPLDYKQERQ----YVLAVTASDGTRSHTAQVFINVTDANTHR-PVFQSSHYTVSVSEDRPVGTSIATIS-ATDEDTGENARI---TYVLEDPVPQF-RIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFE--------DAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPT--------------SGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEG-PNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYMLVVQATS----APLVSRATVHIRLLDQNDNPPELPDFQILFNNYVTNKSNSFP-SGVIGRIPAHDPD 1148          

HSP 7 Score: 106.686 bits (265), Expect = 7.334e-22
Identity = 93/325 (28.62%), Postives = 157/325 (48.31%), Query Frame = 2
Query: 1541 PVFPKNFYQISYPEDLEIGSHILTVNATD---LDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI---SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMG-NPS-LTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            P FP   YQ+S PE+   G+ ++ + A D    DA R + Q+     +  N   F I+  +G +    SLD ET    V+ V A D G P+  S    +  TV+D ND  P  + S Y   I ENL +   V +I A D D      + + +   +   F   +  G ++T+   DRE  + Y +++ A D G NP  L++S+++ I + D NDN P+F     S+    + +      ++ + +V   D D+G N  I ++     L K  F+++S SG + + + P  +   + ++L++ A D G P    SS  + VQ++D+
Sbjct:  258 PQFPLPSYQVSVPENEPAGTAVIELRAHDPDEGDAGRLSYQMEALFDERSNG-YFLIDAATGAVTTARSLDRETKDTHVLKVSAVDHGSPRR-SAATYLTVTVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRLLEGAGGVFEIDARSGVVRTRAVVDREEAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQF-----SEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGNL-KGQFYLHSLSGSLDVIN-PLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDV 573          
BLAST of Protocadherin-1-like vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.037e-51
Identity = 232/886 (26.19%), Postives = 389/886 (43.91%), Query Frame = 2
Query:   77 LIFHNVSV--TYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF--IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEK---PFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE-VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT---KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS--ANIFVQIVDIEPIL---KVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVV 2674
            ++FH+ +    Y I EE   ++ +G+L  D  +  I  N++ +      +L++     P      LI       E +  T +RIDRE++C         H    C  + +      +   +F +    F+               D NDN PLFP   IN+ +       S   LP A D D+GIN V NY+L+   N   + +  +  G  +  + + K     L  +     ++ +  E    P  + T  +++ + +   ++  +F +      + EN  VGT + ++   ++  I    KI    SN +   A     +    G+I     LDREE   H + V+A+  D   + + + V + + D NDN P I +   +    + V + EN P+++ I  +   D D   NG + C       F + P+               ++L     LD E +  +++ +   D GK  L  S  + +++ D NDN PVF ++F  +S PE+   G  +  V+ATD D+   N++I Y +      + FS++ R+G + +   LD E     +  ++A D G P  L+ NV V+ ++ D ND  P    + Y  Y+ ENLP    V  I   D D G    V   I D    F   S  G I+  ISFDRE + SYT  + A+D G  S +SS+ + I ++DVNDN P F+ PP     +N S      S++  T   +V   D D G N ++ ++      R D+F I+  +G I L       +L  +  + V A+D G P+   S    N+FV        L    V+++I+    P    + + +D+S  +  +  I  +AV    AG + V+++  +TAVV
Sbjct:   17 VVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIP-NKSLTTAMQF-KLVYKTGDVP------LIRIEEDTGEIF-TTGARIDREKLCAG--IPRDEH----CFYEVEVAI---LPDEIFRLVKIRFLIE-------------DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKE----LDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTN-DNHPVFKETEIEVSIPENAPVGTSVTQLH-ATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS--DGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----------QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSG-PNAEINYLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP-LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-----SNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTR-DLFAIDQETGNITLMEKCDVTDL-GLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP----NTEIADVSSPTNDYVKILVAAV----AGTITVVVVIFITAVV 834          
BLAST of Protocadherin-1-like vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 8.012e-51
Identity = 230/883 (26.05%), Postives = 386/883 (43.71%), Query Frame = 2
Query:   77 LIFHNVSV--TYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF--IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEK---PFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE-VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT---KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS--ANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVV 2674
            ++FH+ +    Y I EE   ++ +G+L  D  +  I  N++ +      +L++     P      LI       E +  T +RIDRE++C         H    C  + +      +   +F +    F+               D NDN PLFP   IN+ +       S   LP A D D+G N V NY+L+   N   + +  +  G  +  + + K     L  +     ++ +  E    P  + T  +++ + +   ++  +F +      + EN  VGT + ++   ++  I    KI    SN +   A     +    G+I     LDREE   H + V+A+  D   + + + V + + D NDN P I +   +    + V + EN P+++ I  +   D D   NG + C       F + P+               ++L     LD E +  +++ +   D GK  L  S  + +++ D NDN PVF ++F  +S PE+   G  +  V+ATD D+   N++I Y +      + FS++ R+G + +   LD E     +  ++A D G P  L+ NV V+ ++ D ND  P    + Y  Y+ ENLP    V  I   D D G    V   I D    F   S  G I+  ISFDRE + SYT  + A+D G  S +SS+ + I ++DVNDN P F+ PP     +N S      S++  T   +V   D D G N ++ ++      R D+F I+  +G I L       +L  +  + V A+D G P+   S    N+FV        L  +     +  PV+  + + +D+S  +  +  I  +AV    AG + V+++  +TAVV
Sbjct:   17 VVFHSGAQEKNYTIREEMPENVLIGDLLKDLNLSLIP-NKSLTTAMQF-KLVYKTGDVP------LIRIEEDTGEIF-TTGARIDREKLCAG--IPRDEH----CFYEVEVAI---LPDEIFRLVKIRFLIE-------------DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKE----LDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTN-DNHPVFKETEIEVSIPENAPVGTSVTQLH-ATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS--DGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSN-----------QFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSG-PNAEINYLLGPDAPPE-FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPP-LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP-----SNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTR-DLFAIDQETGNITLMEKCDVTDL-GLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLINELVRKSTEAPVT-PNTEIADVSSPTSDYVKILVAAV----AGTITVVVVIFITAVV 834          
BLAST of Protocadherin-1-like vs. TrEMBL
Match: A0A267GT96 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000203g1 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 3.998e-64
Identity = 227/823 (27.58%), Postives = 374/823 (45.44%), Query Frame = 2
Query:   95 SVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETY---LVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILA---INTEKPFFNDT-LTIRLFIDNAIPESLD---LFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFC--DCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSE---NSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDE-GDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAH--DHGTPERRKSSANIFVQIVDIEPILKVK 2509
            +++Y + EE      +G+L  D  + +  ++ N + ++    + F  +S     +F +      A  T    L+ + R+DRE +C D    S+ + +  C  K   P+ DPI       T+  F+              +D NDN P+F      V  S      S   +P+A D D G N+ + Y L   +N  ++              ++   Y   + PL  + +A   +N     F D  LT  L +   + ++ D   +F ++ Y  KV EN     V+       +   N + K +  S+TL R    F+E+G  DG +     +DREE      +V A  G      S +TV +++LD ND  P+I L +     +   + ENR   + +L+   +D D G NG++ C  D  +  +F +    KEY    D   RL + ++ R  LDRE    +SV I C D G +     +TI +   D ND+ P F +     S PE+  +G  I  ++ATD D    N  I Y I++      ++ F +    G + ++  LD E  + + + V A D G     S    +Y  + D+ND  P L  S    + EN P    +  + A D DT  GG++  +  D   F+ +  G +  K SFDRET++SY + ++A+D G PSLTSS+   +KI+D ND  P+F+FP     S N S+S  EQ    + K   KD DE GDN +I +   +   +  +F ++  +G + + +      L  + S ++I H  D G P R ++S +I++ + D  P L+ +
Sbjct:   37 NISYSVLEETDGPALIGDLAGDLNLLRFYSSDNLAKKR----VEFLRTSPDYNSHFRVRIVPGKAGGTVRHELMLVKRLDRELVCKDSALASECYLALSCSVK---PYDDPI----LLFTVRIFV--------------LDVNDNAPVFDPAQNTVQFSEADLVGSRKPIPHAADADSGPNARVAYALATPSNHFRVDSD-----------SQTQVYLTLASPLDRETVASYSLNVSATDFGDVPLTGYLQLSVVVTDTNDCFPVFDRESYHAKVVENSMPKPVLTVHATDGDIGENGRVKYQLASDTLSR-VHRFVEVGLEDGAVSLRRPIDREELAVLEFQVRAVDGGSPAKTSVATVQLRVLDLNDCPPRIELPA-----RRTGVFENRQPGTVVLSFTVKDDDLGINGSVQCKLDQGARSEFEV----KEY----DRKLRL-FQILTRDELDREAKDTYSVVIRCTDGGGMESREGLTIFVE--DENDHQPRFVQTTLFRSVPENCALGHVIANLSATDGDINE-NGLISYYIQRDPAVPETNSFDVTRHGGTVTVSKRLDREARSSLTLFVEARDNGKIYQFSATATLYIEIKDVNDVAPILPPSVDFSVEENGPPGIKLGPVRATDPDTDDGGRIAFYGGDKDSFAVTEDGYLVAKQSFDRETKASYVVQVFARDFGKPSLTSSTLATVKIMDRNDCQPQFIFP---YSSDNFSVSVHEQPGYLILKAVAKDADEAGDNSRIRYRLEQ---KSGLFSVSEDTGKLQVNA---PMRLSDLGSHRLIIHAADCGVP-RLETSVSIYITLQDT-PALEQR 794          
BLAST of Protocadherin-1-like vs. TrEMBL
Match: A0A2I0LQM7 (Protocadherin gamma-B1 OS=Columba livia OX=8932 GN=A306_00012408 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.313e-60
Identity = 214/810 (26.42%), Postives = 361/810 (44.57%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQL-----KSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS--DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVY-IAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFF----SCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIF----FINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIV 2482
            Y I EE      VG L  D  +       + S +K    L    +++   +YF +       +   L    R+DREE+C           +  C    +    +P+   VF + +                VI D NDN P F +  +++ +       +   L  A D D+G NS++ Y+L  +  F + IK S  G     + + KA +    S    + + A++   P  + T+ IR+ + +A  ++  +FS+ +Y  +V EN+  G+++ RV+       SN  ++  F      N  +    LF  +    G +KT G LD EE++++   + A   D   +     V I + D NDN P+I + S         + E+ P  + +  L   D D GENG + C+       ++          K   G  SY ++    LDRE ++   VT+   D+G+ SL+SS  + L + D+NDN PVF +  Y +  PED+ +GS ++TV ATD D    N  + YS++K+ +   D+F ++  +G I L  SLDYE      + V   D G    L     V  TVTD+ND  P++ +S  V  I+E+ P  + V  +   D D+G  G+V   +     F    S   Y  +      DRE  S Y + + A D G+P+L SS+ + +++LDVNDN P F     ++   +  +     + + + +V   D D G N ++ +   E  +R         + + +G +Y   +     ++++  L V A D G P     S+N+ V++V
Sbjct:   32 YTIPEELGRGSLVGPLARDLGLSPA----DLSARK----LRLASAAKRQLQYFTV-----SGENGNLYVSERLDREEMC---------GEAASCSVSFEALVQNPL--NVFDVEV----------------VIQDVNDNSPTFSKAALDLEIGEWIPPGARFPLEMARDADVGSNSLLTYQLTGNPAFTLSIKESSDGSKQPELVLEKALDREKQSS-FQLVLTAVDGGDPVRSGTVQIRINVTDA-NDNAPVFSKSVYVARVRENVPAGSLVLRVRATDVDAGSNGWVSYSF-----GNVPDSVRALF-SVDSESGEVKTVGSLDFEEKSKYSFGLEAR--DGGGLTGHCKVQINVTDANDNAPEITMLSV-----SSPVSEDAPAGTVVALLKVRDRDSGENGEVSCELSDEAPLSL---------VKSSGG--SYKVVTASALDREQAAEHRVTVVARDQGRPSLSSSTALVLEVSDVNDNAPVFDQAEYTVRVPEDVPVGSTLVTVTATDADEG-PNGHLKYSLKKATDMALDIFRLDAETGAITLVRSLDYEKDDSYEMEVQTHDGG---GLFDKTKVTITVTDVNDNPPEITVSSAVSEISEDAPPGTMVALLYVQDRDSGANGEVRCSLEGAVPFRLQSSRGSYYSVVIARELDREQVSEYNLTVQAADGGSPALWSSAVLRLRVLDVNDNAPVF-----AEARYSARVPENNAAGALVLRVRAWDADWGQNARVRYWLGEGRVRGAPLSSSVSVEAETGALYALRSFDYEEVREV-GLWVRAEDGGAP---ALSSNVSVRLV 762          

HSP 2 Score: 121.709 bits (304), Expect = 2.609e-24
Identity = 137/582 (23.54%), Postives = 254/582 (43.64%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEG--PSSMILP-NATDKDIGINSVINYKLLNHTNFIQI---KPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-----SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIY---LTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSC---------SPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFV 2173
            D NDN P+F +   +VY++  +E     S++L   ATD D G N  ++Y   N  + ++      S SG   ++ +++     F      S  + A +      +  + I +   N     + + S       V E+   GTV+  ++++      N +++ +   E   + ++ S G +         + T   LDRE+  +H V VVA       + S++ + +++ D NDN P       +F++ E  V +PE+ P+ ST++T+   D DEG NG +          A++    + +T     G ++ V      LD E    + + +  +D G +   + VTI   + D+NDNPP    +       ED   G+ +  +   D D+   N ++  S+   E +  F +    G  Y   +   LD E  +   + V A+D G P +L  + ++   V D+ND  P   +  Y+  + EN    + V  + A D+D G   +V +++ + +             +  G +    SFD E      + + A+D G P+L+S+ S+ + I+D  DN P+ +
Sbjct:  235 DANDNAPVFSK---SVYVARVRENVPAGSLVLRVRATDVDAGSNGWVSYSFGNVPDSVRALFSVDSESGEVKTVGSLD-----FEEKSKYSFGLEARDGGGLTGHCKVQINVTDANDNAPEITMLS---VSSPVSEDAPAGTVVALLKVRDRDSGENGEVSCELSDEAPLSLVKSSGGSYK--------VVTASALDREQAAEHRVTVVARDQGRPSLSSSTALVLEVSDVNDNAP-------VFDQAEYTVRVPEDVPVGSTLVTVTATDADEGPNGHLKYSLKKATDMALDIFRLDAET-----GAITLVRS----LDYEKDDSYEMEVQTHDGGGLFDKTKVTIT--VTDVNDNPPEITVSSAVSEISEDAPPGTMVALLYVQDRDSG-ANGEVRCSL---EGAVPFRLQSSRGSYYSVVIARELDREQVSEYNLTVQAADGGSP-ALWSSAVLRLRVLDVNDNAPVFAEARYSARVPENNAAGALVLRVRAWDADWGQNARVRYWLGEGRVRGAPLSSSVSVEAETGALYALRSFDYEEVREVGLWVRAEDGGAPALSSNVSVRLVIVDQKDNAPQVL 774          

HSP 3 Score: 89.3521 bits (220), Expect = 2.778e-14
Identity = 94/342 (27.49%), Postives = 149/342 (43.57%), Query Frame = 2
Query: 1505 IKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSG-----DIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT-----QFFSC-SPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFS--LKVIAHDHGTPERRKSSANIFVQIVDI 2488
            +++ I D+NDN P F K    +   E +  G+      A D D   +NS + Y +  +    L SI E S      ++ L  +LD E  +   + + A D G P   SG V +   VTD ND  P    S Y   + EN+P  S V  + A D D G  G V +   +        FS  S  G++KT  S D E +S Y+  + A+D G   LT    + I + D NDN PE         S +  +S    + + +  +  +D D G+NG++     +    +    +  SSG  Y   T    + ++     + V+A D G P    S+A + +++ D+
Sbjct:  120 VEVVIQDVNDNSPTFSKAALDLEIGEWIPPGARFPLEMARDADVG-SNSLLTYQLTGNPAFTL-SIKESSDGSKQPELVLEKALDREKQSSFQLVLTAVDGGDPVR-SGTVQIRINVTDANDNAPVFSKSVYVARVRENVPAGSLVLRVRATDVDAGSNGWVSYSFGNVPDSVRALFSVDSESGEVKTVGSLDFEEKSKYSFGLEARDGGG--LTGHCKVQINVTDANDNAPEITML-----SVSSPVSEDAPAGTVVALLKVRDRDSGENGEVSCELSD----EAPLSLVKSSGGSYKVVTASALDREQAAEHRVTVVARDQGRPSLSSSTA-LVLEVSDV 446          
BLAST of Protocadherin-1-like vs. TrEMBL
Match: A0A3Q2P136 (Uncharacterized protein OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.274e-56
Identity = 227/836 (27.15%), Postives = 383/836 (45.81%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMI-LPNATDKDIGINSVINYKLLNHTNF-IQIKPSHSGLNLSIININKAAEYFLHSQPL---SIK-----ILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQL-----KSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDS-----------SIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQ-FAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS---DLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSP------YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKD--------IFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKS-SANIFV 2473
            Y + EE S    VGN+  D  +++          K     + + S++P    F +        +  L    +IDREEIC            K+C    KT   +P+   + H+ +                   D ND+ P+FPQ+  N+    +   P +   L  A D D G  SV  YKL N+ +F +++K             ++     +  +PL   S+K     + A++  KP  +  +TI + + + + ++  +FSQ++Y   ++EN   GT + RV        SN ++   F  +  +   ER       +    GVI   G +D EE +++ ++V A+      + +  +V I I+D+NDN P+I + S              ++K +EI E+    +        DPD G+  TI    +SH + F IE  ++          ++ ++++ +  LDRE++    + +   D GK + +  V I + +LD+NDN PVF K  Y  +  E++  G+ ++ VNATDLD    NS+I YS     +S   +LFSI+E +G+I +T  +DYE      I++ ASD+G P  L+ +  V  +V D+ND  P++++ S++  I E+  I + V  I   D D+G  GKVI  I +   FS +P      Y  + TK   DRE    Y   I AKD G+P   +  ++ + + DVNDN P+F+  P +       I+      + +  V   D D+GDN  I +    Y+LR +           IN+ +GI+    +   +   K F  +V+A D GTP    + + N+F+
Sbjct:   35 YSVPEEVSEGTFVGNIAKDLGLDRATV-------KERGIRIVYGSTEPP---FAV-----RQDDGVLYVKGKIDREEIC---------ERRKVCATDLKTVLQNPL--EIHHVVVEIL----------------DVNDHSPIFPQKE-NILEVYESALPGAKFQLQAARDADSGSFSVQQYKLSNNGHFRLEVKDRGE---------DRKTPSLILEKPLDRESVKSHVLLLTALDGGKPPRSGNMTIIVNVSD-VNDNPPVFSQELYTVSLKENSPAGTTVIRVNATDLDEGSNGEVIYSFGNDVDARIRER-----FSLNPVTGVIVVAGVIDFEESSRYEIDVQASDKGTATLNTEKSVIINIVDENDNEPEIEVTSFSHALPEDSKPGTTKEKRIEIYESALPGARFQLQAARDPDVGQ-FTIQQYKISHNEHFRIEVKDRGEDR------KVPFLVLQKQ-LDREMAGRHKLRLTAVDGGKPAKSGDVEIIVEVLDVNDNSPVFTKETYSTTIDENIPTGTVVIQVNATDLDQG-ANSEIIYSFGNEVDSKLKELFSIDENTGEIKVTGQIDYEKSKVYEIDIQASDKG-PVPLTRDKSVMISVADVNDNPPEIEVTSFSSLIREDSKIGTTVALISVKDLDSGINGKVICTIKEEVPFSLTPSLQENMYA-VVTKSHLDREIIPQYEFTISAKDAGDPPFLTEKTMRVAVSDVNDNVPDFLSSPYT-----FYITENNSPGASVFSVKAIDRDDGDNALISY----YILRDNGKNNKLTSFLNINAENGIVVALKS-FDFETLKTFQFQVVASDSGTPSLSSNVTVNVFI 791          

HSP 2 Score: 145.591 bits (366), Expect = 1.586e-31
Identity = 174/653 (26.65%), Postives = 272/653 (41.65%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLN--------LSIININKAAEYFLHSQPLSIKILAINTEKPFF------NDT---LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQI--------------NPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIF------CDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLF-SINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI--------SDTQFFSCSPYGDIKTKI-SFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANI--SISYREQSSSELTKVSCKDIDEGDNGKIIFTFFE 2308
            D NDNPP+F Q    V L       +++I  NATD D G N  + Y   N  +  +I+   S LN          +I+  +++ Y +  Q        +NTEK         ND    + +  F  +A+PE     + K    ++ E+   G    R QL++ +                N  F+IE      +R    FL + K          LDRE   +H + + A  G          + +++LD NDN P       +F K+     I EN P  + ++ +   D D+G N  I        D      F+I+    E + T    G++ Y          E S  + + I   DKG + LT   ++ + + D+NDNPP      +     ED +IG+ +  ++  DLD+   N ++  +I++     L  S+ E    +   S LD E        + A D G P  L+   +    V+D+ND  P  L   YT YI EN    + V S+ A D D G    + ++I          T F + +    I   + SFD ET  ++   + A D G PSL+S+ ++ + ILD NDN P  ++P  S GSA     I     +   +TKV   D D G NG ++F+  E
Sbjct:  236 DVNDNPPVFSQELYTVSLKENSPAGTTVIRVNATDLDEGSNGEVIYSFGNDVD-ARIRERFS-LNPVTGVIVVAGVIDFEESSRYEIDVQASDKGTATLNTEKSVIINIVDENDNEPEIEVTSF-SHALPEDSKPGTTKEKRIEIYESALPG---ARFQLQAARDPDVGQFTIQQYKISHNEHFRIEVKDRGEDRKVP-FLVLQKQ---------LDREMAGRHKLRLTAVDGGKPAKSGDVEIIVEVLDVNDNSP-------VFTKETYSTTIDENIPTGTVVIQVNATDLDQGANSEIIYSFGNEVDSKLKELFSIDENTGEIKVT----GQIDY----------EKSKVYEIDIQASDKGPVPLTRDKSVMISVADVNDNPPEIEVTSFSSLIREDSKIGTTVALISVKDLDSG-INGKVICTIKEEVPFSLTPSLQENMYAVVTKSHLDREIIPQYEFTISAKDAGDPPFLTEKTM-RVAVSDVNDNVPDFLSSPYTFYITENNSPGASVFSVKAIDRDDGDNALISYYILRDNGKNNKLTSFLNINAENGIVVALKSFDFETLKTFQFQVVASDSGTPSLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQE 849          
BLAST of Protocadherin-1-like vs. TrEMBL
Match: A0A1A8H3W1 (Protocadherin 1a (Fragment) OS=Nothobranchius korthausae OX=1143690 GN=PCDH1A PE=4 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.741e-56
Identity = 242/903 (26.80%), Postives = 396/903 (43.85%), Query Frame = 2
Query:   50 LFLCKNYYFLIFH----NVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI-RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDT-QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFF---EYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS-ANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQ 2695
            +F    ++  + H      S+ YR++EEQ  +  +G+L         AA++      +L +L       P  +  G         E +   I  IDRE +             + C+   K       C   F ++++  I +Q   L+   + + D NDN P FP   + + +       +   +P ATD+D   N V +Y L    +      +Q+     G    +I +         S  L+IK  A++   P    +  +R+ + +A  ++   F +  Y  +V EN   G  I  +Q+K+N   + P  +IE   +         L+I +  G+I   G LDREE N     VVA     +   S + V+I++ DQNDN P +   G+      +    I E+ P+ + +  +   D DEGEN  + C       F + P      +T D   +  Y L     LD E    + V I   D G  +L+S+ ++K+++ D+NDN P+F    +++ + E+ + G  +L V A+D D+  TN+++FY+I   S    LF I+  +G++   + LD E        V A+D+G P    G   V   V D ND  P+  LS Y+  + EN+P  S V  +   D D G   +V +    D+ +F   +  G I + ISFDRE  SSYT  + A D G P  +S   + I +LD NDNDP  V   PS  S    +S      S +  V  +D+D G N +++F       Y L    F I+ SSG I L     + +   +  L V   D G P+R  ++  +I+V    I  +  V+  +  S       D      S F+    NI   ++  V AG++++I++     VV++ H+IQ
Sbjct:    4 IFQAVLFWVAVLHCGSVEGSILYRVQEEQPPNTLIGSL---------AADQGLPDSGHLYKLEV---GAPYLRVDG------KTGEIFTTEIP-IDRETL-------------RDCRSMAKGK----PCYLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPTSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVANDRGGKLPQLIVLGNLDRELKDSYDLTIK--AVDGGNPQRYSSALLRVVVTDAN-DNAPKFEKSTYEAEVSENSPEGHSI--LQVKANDSDMGPNGEIEYTLHQAVDPVPRLLQIDRPTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAG---DSTTD--NKRKYFLQTTTPLDFERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIFSPTLFEVDFAEENQPGEKVLDVTASDADSG-TNAELFYNIVADSFIKGLFEIDPNTGEVRARTPLDREHKERYEFRVTAADKGSPVH-KGTATVVVKVHDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDKGENARVHLSVEPDSGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDAGEPPRSSYVGVTINVLDENDNDP--VITKPSNSSFR-RLSPLASPDSHVEIVEAEDLDSGPNAELVFNIAGGNPYQL----FRISPSSGEITLAKEMTRKH-SGLHRLVVRVSDRGKPQRHATALVHIYVNET-ISNVSLVEGLVGHSLYTPLDRDIAGDPDSGFAAHRSNILFGSLAGV-AGVVMLILV-----VVFIRHRIQ 843          
BLAST of Protocadherin-1-like vs. TrEMBL
Match: A0A1A7WNY8 (Protocadherin 1a OS=Iconisemion striatum OX=60296 GN=PCDH1A PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 4.765e-56
Identity = 241/913 (26.40%), Postives = 398/913 (43.59%), Query Frame = 2
Query:   20 MSLKLMMIIGLFLCKNYYFLIFH----NVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI-RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDT-QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFF---EYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS-ANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQ 2695
            M L L  ++       ++  + H      S+ YR++EEQ  +  +G+L         AA++      +L +L       P  +  G              T   IDRE +             + C+   K       C   F ++++  I +Q   L+   + ++D NDN P FP   + + +       +   +P ATD+D   N V +Y L    +      +Q+     G    +I +         S  L+IK  A++   P    +  +R+ + +A  ++   F +  Y  +V EN  VG  +  +Q+K+N   + P  +IE   +         L I +  G+I   G LDREE N     VVA     +   S + V+I++ DQNDN P +   G+      +    I E+ P+ + +  +   D DEGEN  + C       F + P +    +T D   +  Y L     LD E    + V I   D G  +L+S+ ++K+++ D+NDN P+F    +++ + E+ + G  +L V A+D D+  TN+++FY+I   S    LF I+  +G++   + LD E        V A+D+G P    G   V   V D ND  P+  LS Y+  + EN+P  S V  +   D D G   +V +    D+ +F   +  G I + ISFDRE  SSYT  + A D G P  +S   + I +LD NDNDP    P     S+   +S      S +  V  +D+D G N +++F       Y L    F I+ SSG I L     + +   +  L V   D G P+R  ++  +I+V    I  +  V+  +  S       D      S F+    NI   ++  V AG++++I++     VV++ H+IQ
Sbjct:    1 MELNLQAVL-------FWVAVLHCGSVEGSILYRVQEEQPPNTLIGSL---------AADQGLPDSGHLYKLEV---GAPYLRVDGKTGD-------IFTTEIPIDRETL-------------RDCRSMAKGK----PCYLEFEVSVTDLIQNQSPRLIEGRIEVLDINDNTPQFPSSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIK--AVDGGNPQRYSSALLRVVVTDAN-DNAPKFEKSTYEAEVSENSPVGHSV--LQVKANDSDMGPNGEIEYTLHQAVDPVPRLLRIDRPTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAS---DSTTD--NKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPIFSPTLFEVDFAEENQPGEKVLDVTASDADSG-TNAELFYNIVADSFIKGLFEIDPNTGEVRARTPLDREHKERYEFRVTAADKGSPVH-KGTATVVVKVHDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDKGENARVHLSVEPDSGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDAGEPPRSSYVGVTINVLDENDNDPVITKP---SNSSFRRLSPLASPDSHVEIVEAEDLDSGPNAELVFNIAGGNPYQL----FRISPSSGEITLAKEMTRKH-SGLHRLVVRVSDRGKPQRHATALVHIYVNET-ISNVSLVEGLVGHSLYTPLDRDIAGDPDSGFAAHRSNILFGSLAGV-AGVVMLILV-----VVFIRHRIQ 843          
BLAST of Protocadherin-1-like vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 215.312 bits (547), Expect = 4.011e-57
Identity = 200/709 (28.21%), Postives = 310/709 (43.72%), Query Frame = 2
Query:  377 KICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLH-----------SQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYS-IRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPER 2446
            K C+ K K       C   F ++++  I +Q   L+   + + D NDN P FP   + + +       ++  +P ATD+D   N V+ Y L          P  S L  S+   N   E                    + I A++   P    +  +R+ I +A  ++   F +  Y  +V EN  VG  +  +Q+K+N   + P  +IE   +         L+I +  G+I   G LDREE +     V+A         ST+ VSI++ DQNDN P +   G+           I E+ P+ + +  +   D DEGEN  + C       F + P          +  +  Y L     LD E    + V I   D G  +L+S+ ++++++ D NDN P+F    +++ + E+ + G  +L V A D D+  TN+++ YS I  S    LF I+  SG++   S LD E        V A+D+G P S  G   V   V D ND  P+  L SY+  + EN+P  S V  +   D D G   +V   +      F   +  G I + ISFDRE  SSYT  + A D G P  +S   + I +LD NDN P  V   PS  S    +S      S +  V  +DID G N +++++        ++F+I+ S G I LT    + +   +  L V   D G P R
Sbjct:   86 KDCRIKGKP------CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL-------SAGPEASAL-FSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDAN-DNAPQFEKSSYEAEVSENSPVGYSV--LQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGD-----SSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSG-TNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVP-SHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAP--VVTKPSNSSFR-RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPH-ELFYISPSDGEIKLTKELTRKH-GGLHRLVVKVSDRGKPSR 765          
BLAST of Protocadherin-1-like vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 216.083 bits (549), Expect = 4.918e-57
Identity = 198/709 (27.93%), Postives = 309/709 (43.58%), Query Frame = 2
Query:  377 KICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLH-----------SQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYS-IRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPER 2446
            K C+ K K       C   F ++++  I +Q   L+   + + D NDN P FP   + + +       ++  +P ATD+D   N V+ Y L          P  S L  S+   N   E                    + I A++   P    +  +R+ I +A  ++   F +  Y  +V EN  VG  +  +Q+K+N   + P  +IE   +         L+I +  G+I   G LDREE +     V+A         ST+ VSI++ DQNDN P +   G+           I E+ P+ + +  +   D DEGEN  + C       F + P          +  +  Y L     LD E    + V I   D G  +L+S+ ++++++ D NDN P+F    +++ + E+ + G  +L V A D D+  TN+++ YS I  S    LF I+  SG++   S LD E        V A+D+G P S  G   V   V D ND  P+  L SY+  + EN+P  S V  +   D D G   +V   +      F   +  G I + ISFDRE  SSYT  + A D G P  +S   + I +LD NDN P    P     S+   +S      S +  V  +DID G N +++++        ++F+I+ S G I LT    + +   +  L V   D G P R
Sbjct:  122 KDCRIKGKP------CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDL-------SAGPEASAL-FSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDAN-DNAPQFEKSSYEAEVSENSPVGYSV--LQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGD-----SSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSG-TNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVP-SHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP---SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPH-ELFYISPSDGEIKLTKELTRKH-GGLHRLVVKVSDRGKPSR 801          
BLAST of Protocadherin-1-like vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 213.772 bits (543), Expect = 1.253e-56
Identity = 219/823 (26.61%), Postives = 361/823 (43.86%), Query Frame = 2
Query:   92 VSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYS-IRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI--SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT---KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLK--------VIAHDHGTPERRKSS-ANIFV 2473
             S+TY++ EEQ  +  VG+L         AA++      +L +L       P  +  G         + Y   +  IDRE +             K C    +  F    C   F ++++  +      L+   + I D+NDN P FP   + + +       +   +P A DKD G N + +YKL + ++      +Q+  +       +I +         +  LSIK++   T   + +  L I +   N   +++  F +  Y  ++ EN  VG  + +V+     L +N Q+   +   + S  ++R     L I  + G+I+  G +DREE       V A     +   S + V+I + D+NDN P I   G      E     + E+ P+ + +  +   D DEGEN  + C       F +        +  D + +  Y L     LD E    + + I   D G  +L+S+ ++K+++ DMNDN PVF  + Y++ + E+ + G  +L V ATD D+  TN+++ YS I  S    LF IN  +G++ + + LD E       +V A+D+G P SL G   V   V D ND  P+  L  Y+  + EN+P  S V  +   D+D G    V   +   + +F   +  G I + ISFDRE  S+YT  + A D G+P  +S   I I +LD NDN P    P      +N S  + +  +S  T   KV  +DID G N +++++              +  G+  ++ST G+  L K F+ K        V   D G P R  ++  +IFV
Sbjct:   33 ASITYQLREEQPPNTLVGSL---------AADQGLPDTGHLYKLEV---GGPYLRVDG------KTGDIYTTDVP-IDRETL-------------KDC----RNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTN---DNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVT--YSFHQPSPNVQR----LLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLR-----SASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSG-TNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVP-SLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKP------SNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAELVYSITG----------GNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFV 787          
BLAST of Protocadherin-1-like vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 210.305 bits (534), Expect = 2.321e-55
Identity = 224/810 (27.65%), Postives = 352/810 (43.46%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKY--FGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANIS---ISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSA 2461
            Y ++EEQ  ++ +GNL +D  +       N      L   + F   +P  K     L+   +   E +  T +RIDRE +C      S   N K C  + +      +   +F +    F+               D NDN PLF    IN+ +       +   +P+A D D+GIN + +Y+L+          S S   L II   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F        V EN  +GT + ++      L SN QI+  F     SN +  +      I    G+I     LDRE    H + V+A+  D     S +TV + + D NDN P I     +      V + EN P+++ I  +   D D   NG + C       F ++P+  +            ++L     LD E +  +++ I   D GK  L +S  + ++I D NDN PVFP+   Q+S PE+ + G+ ++ + ATD D+  +N+ I YS+   +  D F+I+ RSG + ++  LD E        VIA D G    L  NV V   V D ND  P      Y  Y+ ENLP+   V  I   D+D G    V +  I+    F   P  G IK  I+FDRE +SSYT ++ A D G    TS + + I ++DVNDN P FV P     S+N S   + +     S +T+V   D D G N ++ ++      R  +F I+ ++G I L       + + +  L V   D G PE   S A
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDL-------NLDPNIKLSSALQF---KPVYKTGDVPLVRVEASTGEIF-TTANRIDRERLC------SGVFNEKRCFYEIEVAV---LPDEIFRLVKIRFLIE-------------DINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVK---------SVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSD-VNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSF-----SNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLAS--DGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFND-----------QFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSG-SNALIIYSL-GPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGS-NPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIP-----SSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRG-LFAIDKTTGNITLQEKIANAD-QGLHRLVVKVKDLGQPESLHSIA 806          
BLAST of Protocadherin-1-like vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 208.379 bits (529), Expect = 7.163e-55
Identity = 211/812 (25.99%), Postives = 363/812 (44.70%), Query Frame = 2
Query:  104 YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLC-QLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQ-----LKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQI 2479
            Y I EE   ++ +GN+  D  I  +  N       NL  +L+      P      L+   S+  E +  T +RIDRE++C    +E                  D  CS    + + P   +  F L+ +++V+ D NDN P+FP   IN+ +       S   +P+ATD D+G NSV  Y+L+N           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + E+  VGT + ++Q     + +N +I   F  +    T          +    G+I     LDREE   H + V+A+ G      + +TV+I + D NDN P I L   I      V + E  P+++ I  +   D D   NG + C       F ++ +               Y+L    +LD E +  +   I   D GK SL  +  +++R+ D NDNPP+F +   +++  E+ +   ++ T+ ATD D+ R N++I Y +    N+  F ++ ++G +  +   D E     +  V A D G  ++L     V  T+ D ND  P+   + +  +++ENLP  S V  I   D+D G    V +  ++D + F   PY G IK+ +SFDRE +SSYT  + A D G+P  +S++ + I ++DVNDN P  ++PP +     + +S      S + +V   D D G N ++ +T       K +F I+  +G I L   P + +   +  L V   D G P+   +   +F+ +
Sbjct:   28 YPIREELQENVLIGNIPKDLNISHM--NTATGASNNLVYRLVSKAGDNP------LLRVMSNTGEIF-TTSNRIDREKLCPGPSYE------------------DSECSFEIEVVILP---NDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVN---------GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTD-VNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRR-----LFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSS--ARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN-----------QYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGR-NAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGT-RALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLS--AIPGSVVAEVFAVDGDTGMNAELKYTIVNG-NNKGLFRIDPVTGNITLEEKPTEAD-SGLHRLVVNISDLGYPKSLHTLVLVFLYV 773          
BLAST of Protocadherin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 1.343e-51
Identity = 191/665 (28.72%), Postives = 313/665 (47.07%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSM---ILPNATDKDIGINSVINYKLL---NHTNFIQIKPSHSGLNLSIININKAAEY-FLHSQPLSIKILAINTEKPFFNDTLT--IRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYST--STVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDRE------ISSYFSVTIFCYDKGKI--SLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYT-VYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS----DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMG--NPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIA 2422
            D NDN P+F QR  + Y+   +E  +S+   +   ATD+D   N+ I Y +L    ++++  I  S       ++ + +A +Y  +    +S+ I+A++   P  N T+T  + +F +N   ++  +F +  Y   + ENI  G  +  V      Q +P++       +LE S      I    G I +T  LDRE  +Q+ + V A  G       T  +TV+I +LD NDN P     +       V I EN P  + I T+   DPD  ENGT+         +AI+P N  Y+     SG++    +    LDRE       +S  S+ +   D+G      T+S T+ + + D+NDN P F    Y +   E L   S +  V ATD D    N  + YS+  +     F ++  +G I     LD E      + ++A+DRG P +LS    +   V D+ND  P    + + V + E++   S V S+   D+D+G   ++  FI+    D QF      G ++T +S DRET++SY+++I A D G      T ++++ + +LDVNDN P F+     +GS  +S+       + + +V   DIDEG NG++ +         + F +N SSG+I   +TP       + +L+V A
Sbjct:  123 DVNDNTPVF-QR--DSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSG---GYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDEN---DNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQ-SPEYGQLSLIYSLEGSTQF--RINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDP-----AWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLV--------YAIDPPNPFYRINA-ASGKIRTTGLQ---LDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEG-ANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTP-ALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFL-----EGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGN-FLVNVSSGLISRGATPLDRETVALHALQVEA 750          

HSP 2 Score: 169.088 bits (427), Expect = 1.207e-42
Identity = 190/705 (26.95%), Postives = 317/705 (44.96%), Query Frame = 2
Query:  506 DKNDNPPLF--PQRTINVYLSLKKEGPSSMILPNATDKDIGI--NSVINYKLLNHTNFIQIKPSHSGLNLSI--ININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRV---QLKSNKQINPKFKI------EKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTST------VSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVF-PKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLT--SSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKI----SFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEY--LLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI---EPILKV 2506
            D NDN P F    +T +V  +    G +S+I+  A D+D+G+     + Y + +  N        +GL +++  I+     EY L        ++A +   PF   +  +R+ + N + E L  FS   Y   + E    GTV+ RV   Q+K+  ++     I      E   +  + S    L I    G I T   LDRE  + + + V++  G  +E  +  T      V + + D+NDN P+    S+      VE+ E+    + +  L   D D G NGT+     +H    I P   +Y         ++ V + +     + S +    I   D G    +++  + + +LD+NDN P+F     Y +S  E    G+ + +V ATD DA   N Q+ + I +S   D  SI    G I +   +++D ET     + V+A DRG P  LSG+ IV   V D+ND  P  L    TV + E+L + S V ++ A ++  G   K  + I+      F+      + T      S++R     + +   A D G P L   + +++++LDVND+ P FV PP   G+  ++I+        + +V   D DEG NG + ++F     +  +D   F IN++SGII  T+       + ++SL ++A D G P   +S+  + V + DI   EP+  V
Sbjct: 1602 DVNDNTPTFNVTSQTAHVLENSPAVG-TSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLL-------MVVATDQAPPFHTASCELRVSLQNELDEKLS-FSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAEL-IAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATL----VEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPP---QYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAG-PNGQVTFRI-ESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPP-LSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYER-----FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPP--NGTV-VNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIIS-TARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIV 2277          

HSP 3 Score: 166.777 bits (421), Expect = 5.579e-42
Identity = 159/549 (28.96%), Postives = 255/549 (46.45%), Query Frame = 2
Query:  857 LFSQKIYFFKVEENINVGTVIGRV---QLKSN--KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREI-SSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQ--IFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSL-SGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFS--CSPYGDIK-TKISFDRET------RSSYTIIIYAKDMGNP--SLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            +FS  +Y   V EN  +GT + +V    L +    Q++  F  +    +L+ ++GL          I     LD E   +  V V+A  G  +E  +   V I +LD NDN P    DS +   +E     N    + ++ +   D D   N  I    L    ++       +  T  +SG    V + R +   +I     S+TI   D G   L S+VT  + + D NDN P+F +N Y I+ PE++  G+ +L VNATD D +    Q  + YS+   E S  F IN RSGDI  T+ LD E  +  ++ V A D G      +G   V  T+ D+ND  P  + L Y V I EN P  + + ++ A D D    G +++ I     F    +  G I+ T +  DRE        S  +I++   D G+P    T+S+++ + + DVNDN+P FV  P +     + +     ++S L +V+  D DEG NG + ++    L R D F +++++G+I       +  +   + L+++A D GTP
Sbjct:   29 IFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGL----------ISVAAALDFEATPRFTVTVMARDGGGQE--TAGRVRINLLDVNDNTPVFQRDSYVGTARE-----NDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYS-----SYFSIT--VSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSL---EGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYA-----LQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD-FQLDAATGLITTLVQLDREAVAA-YQLRLVATDRGTP 543          

HSP 4 Score: 145.976 bits (367), Expect = 1.769e-35
Identity = 174/685 (25.40%), Postives = 307/685 (44.82%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQP-LSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIE-KCSNTLERSAGLFLEIGKHDGVIKTTGFLDREE--QNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKIS--LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTS-SLDYETCTYIV------INVIASDRGFP-KSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS------DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHG-TPERRKSSANIFVQIVDI 2488
            ++NDN P+F     NV +       +S++   ATD D G+   ++Y   + ++   + P+ SGL      I+ AA     + P  ++ ++A +         + I L   N   ++  +F +  Y     EN N  T + RV+  +++   P  +I      T   S+   + +    GV+     LD E+       + ++A  G    + ST T  +++ D+NDN P       IF++    + IPEN    +T+L +   D D+            +GQ ++   + E  T   ++ R S  + +  +LDRE  S + + +   D G  +   T   T+ + +LD+NDN P +    Y ++  E+   G+ I TV+A D D    N  + Y+I     +  + IN  SG I  T   LD E    I       I V  +DRG P +  + +  V   + D+ND  P  + L Y + + E LP  S +  + A D D G  G V + ++      D Q  + +  G I T +  DRE  ++Y + + A D G P+L+S++++ + +LDVNDN P F    P++ +  +S+       S +  ++C D D G N ++ F F     +   F +    G++    +  +   K  +SL + A D+G    RR  +  + V ++D+
Sbjct:   22 NENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPA-SGL------ISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVN---DNTPVFQRDSYVGTARENDNSLTPVVRVR-ATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP-------IFDRNSYSIAIPENILAGATVLYVNATDGDQSPE---------YGQLSLI-YSLEGSTQFRINAR-SGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNE-NGTLVYAIDPP--NPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAAT--GLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF---HPARSA--VSLMESVARDSVVISLNCTDADSGLNAELSF-FITGGNQDGQFSVGFRDGLVRTVVSLDR-ETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDV 665          

HSP 5 Score: 123.25 bits (308), Expect = 1.725e-28
Identity = 148/580 (25.52%), Postives = 254/580 (43.79%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKD----IGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPL---------------SIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGF-LDREEQN----QHCVEVVAAIGDH----KEVYSTSTVSIKILDQNDNYPK-IGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKS-LSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI----SDTQFFSCSPYGDI-KTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIK 2137
            D+NDN P+F + + ++ +       ++++  NATD D     G  S+I Y L   T F     S    + ++++    ++Y L  + +               +I +L +N   P + D       ++N  P   D+F+       + EN   GT++  +        NP ++I   S                 G I+TTG  LDRE+ N         +V +  D     +   +++TV++ + D NDN P  +GL  ++      ++ E  P +ST+  +   DPDEG NG +     ++   A  P   ++Q   D +  L   L+    LDRE  + + + +   D+G  +L+S+ T+ L +LD+NDN P F      +S  E +   S ++++N TD D+   N+++ + I        FS+  R G +    SLD ET     + + A D G   S  +G   +   V D+ND  P  L+ SY V + EN+   + +  + A D D G  G+V + I     D  F      G I +     DRET + + + + A    N S+  SS I ++
Sbjct:  233 DENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENT-PGGTDIFTVSAADPDLNEN---GTLVYAIDPP-----NPFYRINAAS-----------------GKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYAL------QVLEGLPANSTLFQVTATDPDEGANGNV-----TYSMTAALP-RPDFQL--DAATGLITTLVQ---LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSG-LNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEA--FNNDSVGLSSVIRVR 765          

HSP 6 Score: 122.094 bits (305), Expect = 3.047e-28
Identity = 95/336 (28.27%), Postives = 163/336 (48.51%), Query Frame = 2
Query: 1403 LMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEI-GSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCT--YIVINVIASD--RGFPKSLSGNVIVYFTVTDINDCFPQLQLSYT--VYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD----TQFFSCSPYGDIKTK--ISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTF--FEYLLRKDIFFINSSSGIIYL 2365
            L  ++++ R  S+  S    C        T+SV I  RI D NDN P F    Y++   E     G  +  V A+D D    N+++ Y+I     +  F I+  +G +    +LD+E     Y+++ V A+D  R   + L+    V   V D+ND  P    SY   + ++E  P    + + +A D D+G  G++ + I D     +F      GD++ +  +  DRET++ Y + I AKDMG P L S+ ++ +++LDV+DNDP F+  P     AN S+S      + +++V   D +EG N   +       +   +  F+ +S +G++Y+
Sbjct: 1128 LCTKVLVKRAASA--STRGICLTATPAQATTSVLI--RITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEG-DNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLV-VTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLP-----ANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYV 1451          

HSP 7 Score: 116.316 bits (290), Expect = 1.888e-26
Identity = 126/485 (25.98%), Postives = 219/485 (45.15%), Query Frame = 2
Query:  908 GTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGL-FLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHG--QFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL---SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV----IHFIS----DTQFFSC-SPYGDIKTKISFDRETRSSYTIIIYAKDMGNP-SLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQS--SSELTKVSCK-DIDEGDNGKIIFTFF 2305
            GTV  R    +  +I P++ +      ++  +G+  +++ K D V KT+ F+           +VA  G      +T  +S+ +LD NDN P I L    +    VE+    P  + + +++  D D G NG +     S G  + +I P +   +     +            +DRE  + +++ +   D+G   L+ S  +++ + D+ND  P F      +S  E L +GS + TV AT+ +    N++  Y I      + F+++  SG   +TS+   ++     +  +A+D G P  L G   +Y  V D+ND  P   L      V I E +P+   +  ++A D D G  G V    +H       D + F   +  G I T  + DRE+++ Y++I+ A D G P S  S+  + + + D++DN+P F+   P  G+   S S  E S   + +  VS   D D G N  I++ F 
Sbjct: 1873 GTVSARAHTHTGTRIPPQYIL-----IIQNESGVTIVDVAKADFVEKTSQFI--------LFRIVALDGGSPPRSTTFNLSVIVLDVNDNVP-IFLSPGGYAVSVVEL--GAP-GTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGAN------------IDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATE-NYKGHNTKYTYKI-AGIGKNAFTVHATSG--LVTSTRLLKSYERFNLTAVATDHGRPP-LWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIV-LPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGAN-AIVYYFI 2321          

HSP 8 Score: 111.309 bits (277), Expect = 6.122e-25
Identity = 167/723 (23.10%), Postives = 297/723 (41.08%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILP-NATDKDIGINSVINYKLLNH--TNFIQIKPSHSGLNL-SIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLE------IGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYS---TSTVSIKILDQNDNYPKIGLDSSIFEK--KEVEIPENRPIDSTILT-----LFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDRE--ISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDL-EIGSHILTVNATDLDATRTNS-QIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAE-----------------------NLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPS-----LTS--SSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSS--SELTKVSCKDIDEGDNGKIIFTFFEY----LLRKDIFFINSSSGIIYLTSTPGKYNLK--KIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            D ND  P F  R+    + + +  P   I    A+D+D G+N  + Y +++    N   I P+   L +   + +++  + F +     + I+A +   P  N TLT+ + +       LD+      F  +  N ++      + + S  + +   +   C+  L+ S   F             G++     LDRE   ++ + +          Y+   +  + + ILD+NDN P       +F +   E EIPEN P + T+LT     ++  D D G N T+    L  G  A   ++++        G +S  L     LDRE        +TI   D G+ + T  V + + +LD+NDN P F          E+   +G+ ++ V A D D    ++  + YSI    N D F I+E +G I   + +DYET    ++ V+A+D+  P   +        V+  N+   +L  S   Y A                         LP+   +     H+       +     SD      +  G+I T+ + DRE   SY + + ++D G P      LT+   + +++ + D NDN PEF       GSA + +  RE ++  + LT +   D D G NG +      +    +  + I  I + SG+  +      +  K  +    +++A D G+P  R ++ N+ V ++D+
Sbjct: 1274 DVNDVTPWF-LRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYN-----LTIMAKDMGTPPLNSTLTVGVRV-------LDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSP-------VFSQVTYEAEIPENSP-NGTVLTVLNGPIYASDADFGVNATLAYSLLG-GSSAYFLIDRD-------RGNVSMALGQG--LDREGIPGGRLELTILVQDGGRRNAT--VRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGN-DTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTAS---CELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDK-----RHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRD-GGPREAIAVLTNKPGAYVYVNVTDENDNSPEF-----EAGSATL-VEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPP-RSTTFNLSVIVLDV 1946          

HSP 9 Score: 88.9669 bits (219), Expect = 4.087e-18
Identity = 94/344 (27.33%), Postives = 163/344 (47.38%), Query Frame = 2
Query: 1493 SSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFS-------CSPYGDIKTKISFDRETRSSYTI--IIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEG-DNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS-ANIFVQIVDI 2488
             S  + + +++ NDN P+F    Y +S  E+  +G+ ++ V ATDLDA     Q+ Y    S++SD FS++  SG I + ++LD+E      + V+A D G  ++ +G V +   + D+ND  P  Q  SY     EN    + V  + A D D+    ++ + I  T  +S          YG +    + D E     TI   I A D G+P L S+ +  +++ D NDN P F      + S +I+I     + + +  V+  D D+  + G++   +   L     F IN+ SG I  T+   +  + + + L V A D G    +K+  A + + ++D+
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAG-VFGQVSYHF--SDDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQET-AGRVRI--NLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIF-----DRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIY--SLEGSTQFRINARSGDITSTTLLDREAVSQ-YILIVRAVDGGDGNDQKTGIATVNITLLDV 341          
BLAST of Protocadherin-1-like vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 180.259 bits (456), Expect = 1.338e-46
Identity = 226/887 (25.48%), Postives = 388/887 (43.74%), Query Frame = 2
Query:   98 VTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILP--NATDKDIGINSVINYKLLNHTNF------IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQL-------KSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV-EIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTM---VLAGILIVIIMSILTAVVYVCH 2686
            V+YR+ EE      +GN   D ++          Y   L   +    ++ A     L+  +    E +     ++DRE +C  +            +C      H  +   V  +   PF       L+ V + + D NDN P F    + V  S+ +  P+    P   A D D   N V  Y+LL           + +  + +G  +  + + K+ +     Q   + + A++   P  + +  +R+ + +    S  +F Q     ++ EN  VGT +  VQL        SN ++  +           +       + ++ G++   G L+REE   + + ++A     + V +T+TV++ + D NDN P I +   +     V  I E   ++  +  +   DPD G NG + C       +   P    +Q  K L+    Y+L  R  LD E  + + V I   D G  SL+ ++++ +++LD NDN PVF +  Y++S PE+  IG H++TV+ATD D  + N+++ Y +   +   +F ++  +G I LT  LD E        ++A D+G P  L GN  V   V D+ND  P+  L+ +  Y+ EN+P  S V  +   DSD G  G+V   I    + Q FS  P  G I++ + FDRE R  Y + + A D G P  +S+  + I ++D+NDN P  V  PPS  +    +  R    + +T+VS  D D   N ++ +         ++F I+   G I L   P       +  L V   D G   +  + A + V + +    L+    I++  I  S      +D++ F R     E + V +   VLAG+L V ++ +L  +V+ C+
Sbjct:   39 VSYRVAEELREGAFIGNPSVDLRL--------ADYNLELTYKVMLSKAEDAAPP--LVRVNPRTGELFAAG-RKMDREALCGGQ--------DPGDEC------HVDVQVGVLPVQPGPFFK-----LIEVRINVEDINDNAPAFAAPVLTV--SVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDRE-ERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNS-PVFDQAEVNVEIPENSPVGTHV--VQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTC-------YIYNP-EVPFQLKK-LTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDK-NAEMVYFL-GPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIP-VLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSP-IVLMPPSNTTYKFVVP-RTLPGTIVTEVSAVDNDAEINAELRYHIVGG-NPHNLFHIDPVIGNITLME-PLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNE---TLENATYIEW-LIAGSLQTPLDTDVAGFGR--REQEDNKVLLLAAVLAGVLGVALIVLLGVLVHRCY 867          
BLAST of Protocadherin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 7.607e-46
Identity = 184/682 (26.98%), Postives = 306/682 (44.87%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNAT--DKDIGINSVINYKL-LNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS-NKQINPKFKI----EKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTI---FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYET------CTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD----TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQS--SSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFV 2473
            D NDN P+F    +  + S+ +  P    +   T  D D G N  + Y+L        Q+  + +G   + +++++        Q  ++    +    P     +TI +      P +   F++  Y F V EN+  GT++G V   + +   N  + I    ++ S ++E S G           I T   +DREEQ  + + VVA  G    V   ++VS+ + D N++ P       +F++   EV I E+ P++S   ++   D D G+NG +     +     +F I P            G+L YV   R  LDRE    +S+T+   D G   L+SSVT+ + +LD+NDN P+F  + Y   + E+ E+GS +  V ATD DA  +N  + YS  K + +  F ++  +G I      D E             +V+A+D G PK L     V   V D+ND  PQ   S Y   ++E+    + +  + A D D G  G + + I++     +F   +  G I    S DRE  +SYT+++ A D G   L +S ++ +++LD NDN P F         + +S+   E +     L  ++  D D G +G + +           F I+ S+G ++L      +  ++++ L V A D G P R  SSA I V
Sbjct:  546 DLNDNHPVF--YPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVN-AVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAI---VTITVADAQDTPPT---FARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGR----------IFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAP-------VFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP-----------DGQL-YV---RYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAG-SNGGVTYSFEKPQVN--FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFT-------ESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHA-TFAIDRSTGSVFLARRL-DFETQRLYRLNVSAEDGGRPPR--SSATILV 1169          

HSP 2 Score: 175.252 bits (443), Expect = 1.329e-44
Identity = 168/665 (25.26%), Postives = 288/665 (43.31%), Query Frame = 2
Query:  602 ATDKDIGINSVINYKLL--NHTNFIQIKPS--------------HSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGR-----LSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNL-----KKIFSLKVIAHDHGTPE--RRKSSANIFVQIVDIEP 2494
            A D D G+N+ + Y ++  N   +  +  S               S + L+I   ++ A+       L++ +L +N E P F  T  +   ++N++P  L + S       + EN   GTV          Q    F+++  +                 G + T   LDREE  ++ + V A       + ST+ V++ + D NDN+P       +F   +    I EN P  + + T+   DPD G NGT+                  YQ T   + R     ++  +  R+ LDRE  + + + +   D G +   S   + + + D  D PP F ++ Y     E++  G+ + +V+A+ LD    N+ + Y I   +    FSI    G I+  +++D E   +  + V+A+  G    ++G   V   V D+N+  P   + SY V IAE+ P+ S   S+ A D D+G  G+V + I +    + F   P G +  +   DRETR  Y++ + A D G   L+SS ++ + +LDVNDN P F     +  S        ++  S +  V   D D G NG + ++F +  +    F ++S +G I       +  L        FS  V+A D G P+  + +++  +FVQ V+  P
Sbjct:  365 AMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLP-GLFVVSVSAADSDLGEN---GTVRYNFDPDMPAQYREMFRLDSLT-----------------GKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP-------VFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTV-----------------RYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD---LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG----VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF-----NSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN---FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNP 969          

HSP 3 Score: 171.014 bits (432), Expect = 2.455e-43
Identity = 167/629 (26.55%), Postives = 282/629 (44.83%), Query Frame = 2
Query:  506 DKNDNPPLF--PQRTINVYLSLKKEGPSSMILP-NATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKA--AEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENI-----NVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKH--DGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGK---ISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDL---------FSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSE---LTKVSCKDIDEGDNGKIIF 2296
            D NDNPP+F  P+  + V    +  G   +I   +ATD D G N+++ Y +L+ +    +  + SG+  +   +++   A Y L  +       +  T       ++ +R   DN+ P     FS+  Y F V E+          VIG V L  +    P  ++       E S       G H   G +  T  LDRE  ++ C  + A   D   + +T+ + + +LD NDN P +  DS        E+PE+ P  +++L +   D DEG N  +        +F+I   + E +      G+LS        LDRE  S++++ +   D+ +     L+S+V + L + D+NDN P F      ++ PED  +G+ + TV A D D+ R NS + Y++                 F++N  +G++ L   LD E      + V+A D+G P  L+    +  TV D ND  P+  +  Y   IAE+ P  + V  + A D D G  G++ + I+    T  F   P  G +      DRE  +SY + + A+D G P+ + ++S+ + + DVND  P F   P        ++  RE +      + +V  +D D G +G++ +
Sbjct: 1508 DVNDNPPVFAVPEMELEVE---ENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVR------ASDGTHATDARLSVAVRDANDNS-PR----FSRHAYSFDVAEDAAPDGKTTRAVIGTV-LAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRE--SRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDS-----LAAEVPEDAPPGTSLLRISATDDDEGVNAEL--------EFSISSGDPEGRFAVGNDGQLSVARA----LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALA-PEDSPVGAVVATVQAVDPDSGR-NSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPP-LTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSP-------YTVHARENTQGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 4 Score: 161.77 bits (408), Expect = 1.727e-40
Identity = 141/558 (25.27%), Postives = 242/558 (43.37%), Query Frame = 2
Query:  881 FKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDC-------LSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGF--PKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS-------------DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
             +VEEN   G VI  +      Q           + L  S G F+ +    GV++ +  LDREE+  + + V A+ G H    + + +S+ + D NDN P+    +  F+  E   P+ +   + I T+   D D G  G +            + G F + P+      T+ L              DRE  + + +     D G ++ T+ + +   +LD NDN P    +      PED   G+ +L ++ATD D    N+++ +SI   +    F++    G + +  +LD E  ++  + V  SDR    P  LS  V V   +TD+ND  P      +    E+ P+ + V ++ A D D+G    V + ++                F   +  G+++     DRE R SY + + A D G P LTS++++ + + D NDN P F   P  +  A  +I+  E   +E+ ++S  D DEG NG++ +         D F ++   G + + + P        + L V A D G P  R  +A++ V + D+
Sbjct: 1523 LEVEENTGEGEVIFTLSATDADQGQNALV---TYSVLSGSEGAFV-VDAASGVLRASRRLDREERASYLLTVRASDGTHA---TDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPL--------------DRESRACYVLRARATDGGGLAATARLYVN--VLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATD-DDEGVNAELEFSISSGDPEGRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF---PRREYEA--AIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD-FRLDPVLGTLAV-ARPLDRERTASYELAVRARDGGGPA-RSDTASVRVTLSDV 2047          

HSP 5 Score: 156.377 bits (394), Expect = 8.942e-39
Identity = 169/673 (25.11%), Postives = 291/673 (43.24%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL--NHTNFIQIKP-------------SHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQL-----KSNKQINPKFKIEKCSNTLERSAGLF--LEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDH-KEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLS-GRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVY--IAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQF-----FSCSP-YGDIKTKISFDRE-TRSSYTIIIYAKDMGNPSLTSSSS---IFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIF--TFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSL 2410
            D N++ P+F + +  V ++  +   S      ATDKD G N  + Y++   N      I P             +    +L++  ++   E    S  +++ +L +N  KP FN +                      Y F   E   VG+++G VQ       SN  +   F+  + +  L+   G    L +   + +I+  G             VVA  G   K +   +TV + + D NDN P+     S+++    E   N    + +L +   D DEG NG +        ++AI   N+  + T D S G+++ +      LDRE ++ +++ +   D G   L +S T+ +++LD NDNPP F ++   +   E   +G  ++T+ A+D D T  +  + Y+I        F+I+  +G ++L   LD+ET     +NV A D G P   S  ++V   V D ND  P   L   V+  I EN+PI + V ++ A D D    G+ +H+    QF     F+  P  G+I T    DRE T   + + + A D   P  T  S+   + + + D NDN P FV P     +A +    R  + S +  +   D DE +N  + +  T  +  +   +F ++  +GII  ++   + +    F+L
Sbjct:  750 DVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSS---------------------SYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGG------AASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA--KSVYQASVSESASNL---TQLLRVTASDVDEGVNGAL--------RYAINEGNEGGKFTVDASTGQITLLGS----LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDED-TGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVH-VRDFNDNPPAF-LPGDVFASIMENIPIGTRVITVTARDPDADVNGE-LHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTP-----TAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAI---LFRLDRRTGIIETSTELDRESGHGAFTL 1366          

HSP 6 Score: 137.117 bits (344), Expect = 7.217e-33
Identity = 168/682 (24.63%), Postives = 294/682 (43.11%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGP--SSMILPNATDKDIGINSVIN--YKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQP-LSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAG-LFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDE----GENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGK-ISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGF-PKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDT------QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIE 2491
            D NDN P FP+  + + ++ K++      ++L  A D+D+G N V +  YK+++     ++ P       + +++         + P  ++ + A +   P     L + + + +A  ++   F +  Y   V E+  VG  +                     + L R  G L +      G++ T   LD E + Q+ + + AA G +  +   +T  I++LD NDN P I         +   + E+    +    +   D D     GE           G F +            + G    VL     LDRE    +++TI   D GK ++ +++ ++ + + D+ND+ P F  + Y  +  E    GS++  V A D D+   N+++ YSI    +   FS++E +G +     +D E  + +V+N+ A D+G  PK+   ++ V  T+ D+ND  P   Q  Y     EN      V S+ A DSD G  G V  +F  D        F   S  G + T  S DRE    Y +++ A+D G+P L S++ + + + D+NDN P F    P Q  A  SI   E   + +T V+  D D G NG + +        +  F +N+ +G +  T        + ++ L+V A D G   R +S A + + + D +
Sbjct:   15 DVNDNAPSFPEPGV-MEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDAN-DNPPAFEKPAYRASVAEDSPVGAAL--------------------RDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLH--------APGVPGL--RVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSG-LNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTV--TLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY---PVQYFA--SILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR--FQVNAVTGAVS-TRVSLDREERAVYQLQVTALDGGH-LRARSPAIVTITVADAQ 652          

HSP 7 Score: 135.961 bits (341), Expect = 1.555e-32
Identity = 119/426 (27.93%), Postives = 192/426 (45.07%), Query Frame = 2
Query:  884 KVEENINVGTVIGRVQLKSNKQ-INPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEV-VAAIGDHKEVYSTSTVSIKIL--DQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTI------------FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENL---PIQSHVTSIVAHDSDTGFGGKVIH---FISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKD 2092
            +V E+   GT + R+    + + +N + +    S   E   G F  +G +DG +     LDRE Q+ + + V V+    H     +S V + ++  D NDN P      +    +    PE+ P+ + + T+   DPD G N  +                   G FA+  +  E +  ++L              DRE    +++T+   DKG+  LTS+ T+ + + D NDN P FP+  Y+ +  ED   G+ +L ++A D D    N ++ Y I   + +  F ++   G + +   LD E      + V A D G P + S    V  T++D+NDC P  QLS YTV+  EN    P+   +  +VA D D G  G+V +     +D   FS SP G +    S DRE +  + +II A D
Sbjct: 1737 EVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPE---GRFA-VG-NDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAP------AFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVREL--------------DREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEG-ANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGP-ARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVL--ILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 8 Score: 131.339 bits (329), Expect = 4.947e-31
Identity = 137/548 (25.00%), Postives = 237/548 (43.25%), Query Frame = 2
Query:  926 VQLKSNKQINPKF-KIEKCSNTLERSAGLFLEIGKHDGVIKTTGF----------LDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIF---EKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREI------SSYFSVTIFCYDKGKIS-LTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSY-TVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI----SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP--ERRKSSANIFVQIVD 2485
            V +  ++ +N +F  +        ++  +  EIG+ +G  K   F          LDRE + ++ + V A     + + S+ TV++ +LD NDN P     S +F   E++EV         S +  +   D D G NG +         ++ E     ++   + +GR++ +     + DRE       ++ FS ++   D G+   L    T+++ + D+NDNPP F K+ YQ S  E     + +L V A+D+D    N  + Y+I +      F+++  +G I L  SLD E      + V A+D G    L+ +  V   V D ND  P+   S  +V   E+  +   + ++ A D DTG  G V + I    +   F      G +      D ET+  Y + + A+D G P  +S++ + + + D NDN P F+      G    SI       + +  V+ +D D   NG++ ++          F I+  SG I   +   +     +F + V A D   P   RR +  N+ V + D
Sbjct:  765 VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEV--------GSLVGAVQATDADAGSNGGV--------TYSFEKPQVNFELDSE-TGRIASLR----VFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEG-VNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGT-SPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL-----PGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTD 1284          

HSP 9 Score: 108.612 bits (270), Expect = 3.939e-24
Identity = 91/348 (26.15%), Postives = 155/348 (44.54%), Query Frame = 2
Query: 1505 IKLRILDMNDNPPVFPK-NFYQISYPEDLEIGSHILTVNATDLDA--TRTNSQIFYSIRKSENSDLFSINERSGDIYL----TSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP--EFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLK----------KIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            +++ + D+NDN P FP+    ++++ ED  +G  +L   A D D      N   +  +  +E   L      +   +L    T  LD E      + V A D G P+   G + V  TV D ND  P  +  +Y   +AE+ P+ + +  ++      G G   + F   T        G + T+   D E R  YT+ + A D GNP L+  ++  I++LDVNDNDP   FV+ PP+  SA++  S    + + L  V+  D     NG++  +      R           +++    PG   LK           +++L ++A D+G P  R ++A++ V + D+
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRY-GRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHR----GRGPLAVPFDPKT--------GMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTA-NGELSVSIVGGNERGHF--------VLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDV 334          

HSP 10 Score: 95.5153 bits (236), Expect = 3.844e-20
Identity = 83/344 (24.13%), Postives = 159/344 (46.22%), Query Frame = 2
Query: 1319 LSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRII---LDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVT-----SIVAHDSDTGFGGKVIHFISDTQ-------FFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFT 2299
            ++ G   I PL+  ++ + DL+ R  +++ + ++    D    S+    +  +++ +IS          + D+NDNPPVF     ++   E+   G  I T++ATD D  + N+ + YS+  S +   F ++  SG +  +  LD E     ++ V ASD     + + +  +   V D ND  P+  + +Y+  +AE+       T     +++A D+D+G  G+V + ++ ++        F   P  G +      DRE+R+ Y +   A D G   L +++ +++ +LD NDN P          S    +       + L ++S  D DEG N ++ F+
Sbjct: 1447 VTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEIS----------VEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQ-NALVTYSV-LSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD----GTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSV-----QNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFS 1767          

HSP 11 Score: 85.1149 bits (209), Expect = 5.850e-17
Identity = 109/479 (22.76%), Postives = 199/479 (41.54%), Query Frame = 2
Query: 1142 VSIKILDQNDN---YPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTT--KDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQ--------SHVTSIVAHDSDTGFGGKVIHFISDTQ---FFSCSPYGD----IKTKISFDRETRSSYTIIIYAKDMGNP-SLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFS--LKVIAHDHGT-PERRKSSANIFVQIVDIEPIL 2500
            V + + D NDN   +P+ G+        EV   E+  +   +L     D D G NG      ++H  + I   N+E +    + ++ R    L     LDRE +  +++ +   D G       + + + + D NDNPP F K  Y+ S  ED  +G+ +      DL            + +         + ++G +     LD+E      +++ A+D G P  LSG       + D+ND  P ++  Y    A +  +         + + ++   DS T  G   +  +   +   F   +P       +K     DRE    Y + I A D G P + ++++S+ + + DVND+ P F     +  +   ++S    + S +  V+  D D G N K+ ++        D+  F ++ S+G++   +T GK + +   S  L + A D G  P+   +S  + +  V+ EP L
Sbjct:    9 VRVVVGDVNDNAPSFPEPGV-------MEVAFKEDAAVGRQVLLDTAVDRDVGPNG------VNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-----RDL------------LHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPP-LSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRF-----ALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSG---NDLGWFSVDESTGLV---TTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPL 445          
BLAST of Protocadherin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 6.370e-42
Identity = 187/773 (24.19%), Postives = 332/773 (42.95%), Query Frame = 2
Query:  317 RIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKL-LNHTNFIQIKP----SHSGLNLSIININKAAEYFLHSQPLSIK--------------ILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS-NKQINPKFKIEKCSNT----LERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPK---IGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSG--RLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVF--PKNF------YQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSEN----SDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-------QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQ-----FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSA 2461
            R+DRE +C ++           C   R T F      TV    ++    S    LL V++++ D ND+ P F    +NV +S  +     + LP A D D G NS+ +Y++     + +Q+ P         +              H   L ++              +   +   P  + ++ + + +    DNA P  +D  ++ +   ++ E+  VGT +  VQL++ +    P   I    +T    L   A L ++       ++    LDRE    H + VVA  G      ++ TV++++ D NDN P    I L         V+I EN P  + ++ +   DPD G +GT+              +  E+ T  +L+   ++ ++L    +LD E +  ++V++   D+G   L+  + + + ++D+NDN PVF  P +       Y++S  E+   G+ +L + ATD D+   N  I +++ +       ++LFS+N R+G + L + LD E      ++V A D G P+      IV  TV D ND  P            Y  ++ E   + ++V ++   D D G   +V ++ + +           +P G ++T +  DRE R  Y + + A D G P+L++S  + I + D NDN P    P  +    ++  ++          V+  DID GDNG+ ++        K IF +N+ SG + L  T    + + +  L V   D G    R+  A
Sbjct:   88 RLDREALCMEE--------PDAC---RSTGF----MHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNA-PVFVDPPTRPV---RITEHSKVGTSV--VQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTV-------------DVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSG-PNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQR-KARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVR-TFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGG-NPKGIFLLNADSGALSLARTVSSLD-EGLHRLVVRVRDRGGSGSRRVRA 821          

HSP 2 Score: 120.553 bits (301), Expect = 6.173e-28
Identity = 146/529 (27.60%), Postives = 226/529 (42.72%), Query Frame = 2
Query: 1043 KTTGFLDREEQNQHCVEVVA-AIGDHKEVYSTSTVSIKILDQNDNYPKIG---LDSSIFEKKEV--EIPENRPIDSTILTLFPEDPDEGENG-------TIFCDCLSHGQFAI-------EPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVF---PKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENS----DLFSINERSGDIYLTSS--LDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFP-----QLQLSY----TVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDTQFFSCSPYG-DIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANI-SISYREQ--SSSELTKVSCKDIDEGDNGKIIFTFFEYLLRK---DIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            ++TGF+       H V+V A A G          V + + D ND+ P      L+ SI E + V   +P  R ID          PD G N            D L  G F++       +           +  R   +L  R  LDRE    + + ++  D G   L+ SV + + ++D NDN PVF   P    +I+  E  ++G+ ++ + A D DA   N  I YS      S        ++  +G + + ++  LD ET     + V+A D G   S S +V V   + D ND  P      LQ  Y     V I ENLP  + V  I   D D G  G V   + F +  +  S +     +KT    D E    Y + + A D G P L+   ++ I ++D+NDN P F+ P   +G   +  +S RE   + + +  +   D D G NG I FT  E    +   ++F +N  +G + L +TP     +  + L V A D G+P+ RK+ A + V ++D
Sbjct:  103 RSTGFM-------HTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAID----------PDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHR--ALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRIT--EHSKVGTSVVQLRAADPDAG-PNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARD-GGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTL-ATPLDREKRMRYELSVEACDGGSPQ-RKARAIVRVTVLD 606          
BLAST of Protocadherin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006212.1 (pep scaffold:Pmarinus_7.0:GL476841:227071:229326:-1 gene:ENSPMAG00000005617.1 transcript:ENSPMAT00000006212.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 1.803e-39
Identity = 139/456 (30.48%), Postives = 214/456 (46.93%), Query Frame = 2
Query:  884 KVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAA-IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFP------EDPDEGENGTIFCDCLSHG--QFAIEPLNKEYQTTKDLSGRLS--------YVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETC-TYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT-QFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGN-PS--LTSSSSIFIKILDVNDNDPEFVFP 2179
            ++ EN  VGT + RVQ  S+       K++    +   S+     +    G++   G LDREE + H + +VA      +   +T+T++I + D+ND  P+I L   I  + E +         T    FP       D D G  G +       G  + A +    E     DL  R+         Y+L   + LDRE      V +   D G   L+S+  + +R+ D NDNPP FP+  Y+ +  E+   G  + +V ATD D  + N  + YSI +  +S  F I   +G +  + SLD E       + V+ASDRG P  LS    V   + D ND  PQ +L  +  Y+ EN P  + +  + A D D G  GK+ + I+     FS  P  G I+   SFDRE +  YT+ + A+D+   P+  L+SS+ +FI ++D +DN PEF+ P
Sbjct:    1 EIPENSPVGTPVVRVQ-ASDPDEGENGKVQYRLASWSSSSSSSQPLDSSSGLVVVWGLLDREEADVHRLVIVATDCAPSRPASATATLTIVVGDENDTPPEIEL--RIIARTEGDAVTAD---DTDDDGFPIALISVSDRDSGSGGVVSLSISLDGDEESAGKDEEDEAGAAADLPFRVRRLPPSPDRYLLETGVGLDRERRERHVVRVVAKDSGVPRLSSTAVVFVRVADANDNPPTFPRRVYEAAVAENGPPGLRVASVMATDADVGK-NGAVVYSIERPSSS-AFRIELTTGLVTASQSLDREDAPGGYALAVVASDRGVPP-LSATATVIVRILDRNDNAPQFELPDFHFYVRENQPAGNIIGRVSAWDPDEGDNGKLEYAITVVNALFSIDPDTGVIRAGFSFDREKQHFYTLEVRARDLDQTPTSRLSSSARVFIHVVDEDDNAPEFLAP 447          

HSP 2 Score: 119.783 bits (299), Expect = 2.431e-28
Identity = 125/460 (27.17%), Postives = 206/460 (44.78%), Query Frame = 2
Query: 1223 EIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYD-KGKISLTSSVTIKLRILDMNDNPP-----------------------VFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDL-FSINE--RSGDIYLTSS---LDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI---SDTQFFSCSPYGDIKTKISFDRE-TRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKK--IFSLKVIAHD-HGTPERR-KSSANIFVQIVD 2485
            EIPEN P+ + ++ +   DPDEGENG +        Q+ +   +    +++ L      V++  + LDRE +    + I   D       +++ T+ + + D ND PP                        FP     +S   D + GS  +   +  LD    ++           +DL F +     S D YL  +   LD E     V+ V+A D G P+ LS   +V+  V D ND  P   +  Y   +AEN P    V S++A D+D G  G V++ I   S + F      G +    S DRE     Y + + A D G P L++++++ ++ILD NDN P+F  P       +  +   + + + + +VS  D DEGDNGK+ +      +   +F I+  +G+I    +   ++ +K   ++L+V A D   TP  R  SSA +F+ +VD
Sbjct:    1 EIPENSPVGTPVVRVQASDPDEGENGKV--------QYRLASWSSSSSSSQPLDSSSGLVVVWGL-LDREEADVHRLVIVATDCAPSRPASATATLTIVVGDENDTPPEIELRIIARTEGDAVTADDTDDDGFPIALISVS---DRDSGSGGVVSLSISLDGDEESAGKDEEDEAGAAADLPFRVRRLPPSPDRYLLETGVGLDRERRERHVVRVVAKDSGVPR-LSSTAVVFVRVADANDNPPTFPRRVYEAAVAENGPPGLRVASVMATDADVGKNGAVVYSIERPSSSAFRIELTTGLVTASQSLDREDAPGGYALAVVASDRGVPPLSATATVIVRILDRNDNAPQFELP-----DFHFYVRENQPAGNIIGRVSAWDPDEGDNGKLEYAI---TVVNALFSIDPDTGVIRAGFS---FDREKQHFYTLEVRARDLDQTPTSRLSSSARVFIHVVD 436          

HSP 3 Score: 62.003 bits (149), Expect = 4.217e-10
Identity = 64/240 (26.67%), Postives = 109/240 (45.42%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVY-LSLKKEGPSSMILPN--ATDKDIGINSVINYKLLNHTNFIQIKPSHSG----LNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDH---KEVYSTSTVSIKILDQNDNYPK 1183
            D NDNPP FP+R   VY  ++ + GP  + + +  ATD D+G N  + Y +         +PS S     L   ++  +++ +        ++ ++A +   P  + T T+ + I    DNA P+    F    + F V EN   G +IGRV      + +   K+E     +         I    GVI+     DRE+Q+ + +EV A   D      + S++ V I ++D++DN P+
Sbjct:  225 DANDNPPTFPRR---VYEAAVAENGPPGLRVASVMATDADVGKNGAVVYSIE--------RPSSSAFRIELTTGLVTASQSLDREDAPGGYALAVVASDRGVPPLSATATVIVRILDRNDNA-PQ----FELPDFHFYVRENQPAGNIIGRVSAWDPDEGD-NGKLEYAITVVN----ALFSIDPDTGVIRAGFSFDREKQHFYTLEVRARDLDQTPTSRLSSSARVFIHVVDEDDNAPE 443          
BLAST of Protocadherin-1-like vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 197.208 bits (500), Expect = 2.628e-51
Identity = 208/680 (30.59%), Postives = 303/680 (44.56%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILP--NATDKDIGINSVINYKL-LNHTNFIQIKPSHSGLNLSIININK--AAEYFL------HSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVE--IPENRPIDSTILTLFPEDPDEGENGTIFCDCLSH--GQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            D NDN P+F   +     SL +  P    +    ATD+D G N+ + Y+L +  T+  ++ P+ +GL  +   +++   A Y L      H +P    + AI         TLTI    DN+ P+    FSQ  Y   V EN   G+ I RV L S+       ++    + +  + G    I    G I   G +DRE    + + + A         ST+ V+I + D+NDN P       IF   E    I E   I S +  +   D DEG N  +F   +      FAI  +N               VL  +  ++RE    +++TI   D+G   +TS   + + + D+NDNPPVF    Y  S  E+    + +LTV A D D    N+ + YSI    +   F IN  SG I  T+ LD+E  +   + V A+D  +    +    V   V ++ND  P   Q +YT  + EN P  + V  + A D D+ FG      +   D+  FS     G I T    DRE  S Y I +   D GNP L++ + + IKILD NDN P+F        S + SI      SS   K++  D DEG N +I +     L R D F I +SSG+I L     + N K  + L + A DHGTP  + SS  I V ++DI
Sbjct: 1091 DVNDNAPVFNPGSY--AKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPA-TGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAI---------TLTINDLNDNS-PQ----FSQSKYTLTVTENTANGSNILRV-LASDPDAGANGRV--TYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP-------IFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNG--------------VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVG-ANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTN----VTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS-FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKF-----DSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYN----LSRNDAFMIGASSGVITLAQPLDREN-KSTYDLAIQARDHGTPP-QASSITIRVTVIDI 1712          

HSP 2 Score: 189.889 bits (481), Expect = 4.877e-49
Identity = 174/668 (26.05%), Postives = 299/668 (44.76%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQI----------------KPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHG--QFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGF-PKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            D NDNPP F +      +        ++    ATD D G N  I+Y +L+    +                  + + +  +L+I   + +   F+ +  ++I I   N  +P F              P            F + E+   GT +G++   +++ I P   +      +  + G   ++    G++     LDRE    + + V A+     +   T+++ + +LD NDN P+   + S+F     EI E+  + ST+L +  ED DEG NG I       G   F I           D +G     ++++  LD E ++ + +T+   D G  S +++  +K+ I+++NDN P F       S PED+ I +H++ +NATD D T     + + I +      F I++ SG I +   LD ET     + V A++ G   +S+  N  +   V D+ND  P     SY   + ENLPI   V  + A D D G   KV + +S  DT  F  +P  G + TK   DRE ++SY++ + A D G PS ++ ++I + I D+NDN P+F     SQ    ++++    + S + +V   D D G NG++ ++        + F I+S++G I +     +  L   ++L + A D G P
Sbjct:  677 DVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTG------------PSR----------FNISEDSPTGTRVGQL-TATDRDIGPNGAVTYA--IISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPR--FEKSLFSG---EIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTI-----------DSTG----FVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGT----PLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIR--VLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQF-----SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISG-NHGNAFRIDSTTGRITVVGVVDREALAS-YNLTISAKDSGVP 1286          

HSP 3 Score: 189.504 bits (480), Expect = 7.405e-49
Identity = 182/657 (27.70%), Postives = 308/657 (46.88%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYL-SLKKEGPSSMI-LPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRV-QLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPER 2446
            D+NDN P FP   +N Y+ ++++  P++ + +  ATD+D G N+ I Y L +  N   +  S +G   ++  ++   +        +++I A + +   F   +T+    DNA       F+  +Y   V E++ VG+++ ++  +  +  IN +      S         +  +    GVI+T G  DRE +  + V + A  G        +TV I+ILD NDN P       +F   +    + E+  I + ++T+   D D G N  +        +++    N  +  T D    ++ V+     LD E  S +++ +   D+G   LT +  + + + D+NDNPPVF  + YQ    E+   G+    V+ATD D++ TN  + + I K  +  +F+I+  +G I +  S DYE  T   + V A DRG P       +  F + D+ND  P    S Y+  I E+  I S V ++ A D D+G  G++    IS      F   +  G I+     DRET  SY++ + A+D G+ S +SS+ + I + D+NDN P F      QG     +S       ++ +V+  D D+  NG + +   +     D+F IN+S+G+I L  T   Y  K  + + V A D GTP R
Sbjct:   62 DENDNAPEFP---LNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMN-SKTGEIRTVTPLDHETK-----DSYTMRISAFDGKHTTFVPLITVDDVNDNA-----PFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS-----YFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRP-------VFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADL--------RYSFTSGNTNHAFTLDA---VTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQ---VSATDRDSS-TNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIF-IEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF------QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD---NTDVFSINTSTGLITL-KTQLDYEKKTQYMVTVTAKDGGTPSR 665          

HSP 4 Score: 174.481 bits (441), Expect = 3.897e-44
Identity = 183/672 (27.23%), Postives = 309/672 (45.98%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEK--CSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV-EIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIH-FISDTQF--FSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSS--SELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            D NDNPP+F   + + Y S  KE   +    +ATD+D   N  + + ++  N      I  S       II+I K+ +Y   ++   + + A +   P   DT  + +FI++ + +   +FS   Y  ++ E+  +G+ +  V   ++    P+ ++E    S  ++   G F  I  + G I+ +  LDRE    + ++V A  G      S++ V+I + D NDN P       IF+   V  + E+      I  +   D D+  NG +        ++A+   N +  +    +G ++     +  LD E  + + VT+   D G  S +S   +K+ + D+NDNPP F K+ Y  +  E+L  G  +  V ATD D+   N +I YSI     +  F+++  +G+I     LD ET     + + A D    + ++    V  ++ D ND  P         I+E+ P  + V  + A D D G  G V +  IS  Q   F   P  G +  + + DRET  SYT+++ A D G+P  + ++SI + +LDVNDN P F         +  S   RE +S  S + +V  +D DEG NG I  +        D F I+S+     L+ TP  Y     + L V A D G+P  + ++A + + I+++
Sbjct:  368 DINDNPPVF---SPSAYQSRVKENTPAGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGS-----TGIISIAKSPDYENKTR-YDLTVQARDRGVPVKYDTAQVTIFIED-VNDHSPVFSPSNYSKQIPESTVIGSTVVTV-TATDLDSGPRGRLEYRLISGNVK---GAF-NIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP-------IFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDV--------RYALSD-NTDVFSINTSTGLITL----KTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADS-GANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAA-TTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFE-------KSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGE--GSDNFTIDSTG--FVLSKTPLDYETTAAYQLTVTARDGGSPS-KSATAQVKITIINV 990          

HSP 5 Score: 152.525 bits (384), Expect = 2.013e-37
Identity = 155/577 (26.86%), Postives = 248/577 (42.98%), Query Frame = 2
Query:  758 SIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLF--LEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLS--HGQ-FAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGG----KVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQS--SSELTKVSCKDIDEGDNGKIIFTFFEYLL----RKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            +I++L +N   P FN             P S        Y   + EN+ +G  + +V          + + E    T E S G     E+    G++ T   LDRE+Q  + + V A         + + +++ I D NDN P+         K  + + EN    S IL +   DPD G NG +    +S  HG  F I+            +GR++ V     ++DRE  + +++TI   D G     S+  + + + D NDN P+F  N       E + IGS +  V ATD D   +N+Q+FYSI + + S  F+IN  +G + +   ++ ET     + + ASDRG P  ++ +  +   V D+ND  P     SY   + EN    + V ++ A DSD G        +I    + +F   S  G I T    D E +S Y + + A D      T+ +++ I+++++ND  P F          N + S RE S  S+ + KVS  D D        F    Y +      D F I+  SGII       +  L  +++++V   D G P
Sbjct: 1086 TIRVLDVNDNAPVFN-------------PGS--------YAKSLHENLPIGQTVAKVTATD------RDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQ-----SKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDST----------TGRITVVG----VVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDE-GSNAQVFYSIVRGDTS-AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPM-MTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFT-------QQNYTASVRENSPTSTSVVKVSASDRDS-------FGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDR-ELVSLYAIQVRVTDAGNP 1595          

HSP 6 Score: 152.14 bits (383), Expect = 2.885e-37
Identity = 162/597 (27.14%), Postives = 270/597 (45.23%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL-NHTNFIQIKPSHSGLNLSI-ININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDE-GENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSC----SPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDID 2269
            D+NDN P+F     +  +       S + +  ATD+D G N+ + Y ++   T+   I   +  L +   IN      Y L        I A +   P       + + + N + ++  +F+ + Y   V EN    T +  V    S+   N   +    S   E+      +I    GVI TT  LD EE++Q+ +EV A   D K    T+ V+I++++ ND  P         +     + EN P  ++++ +   D D  G             +F+I+              + S ++    +LDRE+ S +++ +   D G   L++   + ++ILD NDN P F  + Y  S  E+    S    + ATD D   TN++I Y++ ++   D F I   SG I L   LD E  +   + + A D G P   S ++ +  TV DIND  P +  S     + EN P ++HV  I+A D+DTG   ++   +   +  S     +  GDI TK+  DRE ++ YT+ I   D GNPSL+S + + I ++D +DN P F    P++   N++IS      + + +V+ +DID
Sbjct: 1300 DENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTL-------TIRASDRGSPMMTSDKELTVVV-NDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR----FKINSTSGVIMTTTPLDFEEKSQYGLEVTAT--DSKYTAKTN-VTIRVINLNDITPAF-----TQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSID--------------QRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEG-TNARITYNLSRN---DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQAS-SITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRF---QPTE--YNVTISESLPRGASIVQVTARDID 1852          

HSP 7 Score: 143.665 bits (361), Expect = 1.380e-34
Identity = 145/507 (28.60%), Postives = 237/507 (46.75%), Query Frame = 2
Query: 1004 GLFLEIGKHDGVIKTTGF-LDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIH-FISDT---QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSS-ANIFVQIV-DIEPIL 2500
            G+F  I    G I TTG   DRE ++++ + V+A    ++     + V I + D+NDN P+  L+S +F      I EN P  + +  +   D D G N  I     ++  F+ E  NK    +K  +G +  V      LD E    +++ I  +D    +    +T+     D+NDN P F  + Y+    ED+ +GS +  + A DLD    N+++ YS+   + S  F+++ + G I    + D ET     + + A D G P S SG   V   + D+ND  P    + YT  + E++ I + + ++ A D D G    + + F S      F   +  G +    S D E RSSY + +   D G+P LT +S + I + D+NDN P  VF P +        S  ++++   T+VS  D D   NG ++F   +      +F I+ S+GII +  +P  Y  K  + L V A D G P +  ++   IF++ V D  P+ 
Sbjct:   10 GMFT-IDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVF-----NIRENTPA-AQVAIVTATDRDSGTNAAI-----TYSLFSGE--NKFMMNSK--TGEIRTVTP----LDHETKDSYTMRISAFDGKHTTFVPLITVD----DVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDV-GINARLSYSLVSGDTS-YFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSP-SRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP--VFSPSAYQ------SRVKENTPAGTQVSATDRDSSTNGALVFGIIKG-NDDGVFTIDGSTGIISIAKSP-DYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF 478          
BLAST of Protocadherin-1-like vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 188.734 bits (478), Expect = 1.582e-48
Identity = 204/719 (28.37%), Postives = 318/719 (44.23%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLN----HTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIR---LFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQ-INPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD--TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI--------EPILKVKRTIDF-SRIPVSFFDKKKSDLSEFSRFFWNI 2599
            D NDN P+F +      +   K     ++   A+D D G N  + Y +LN    ++ F   + S +   +  ++  K   Y L  Q       A +   P  + T+T++   L +++  P+    FS+K+Y   + E++ V  ++  V+     Q  N +   E  S         F  I + +G ++    LD E      + V A       +Y+ +TV I ++D NDN P+    SS F+     IPEN  +      +   D D G NG I         F+    +  +   ++  G     +  +  LDRE    F+  I   DKG      +  I + +LD+NDNPP F +  Y  S  E+   G+ +L V A D D+  TN  + YSI  S   D  F IN + G I L+ +L+Y T    V +V ASD      LS   +VY  VTD N   P+ +  SY+  + E+  + + V +++A D DTG   K+ + I+    +F      G IKT  S DRE   +Y   + A D G P L + S ++I I DVNDNDP F+ P     S    +    +    + +VS  D D G N +II++F      +  F I+S+ GII  T  P        + L V+A D GTP   ++S  + V + D+        +P+ +V    D   R PV     K  DLS  +   ++I
Sbjct:  120 DVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQ-------AQDQGNPPRSATVTVKITLLDVNDCTPQ----FSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMN----FFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQ--FVSSHFQ---TMIPENYAVGQEFYRVQAYDKDHGTNGEI--------TFSFMQNDLPFSINENTGG-----ISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTN--VVYSIVSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASD----GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKP-----SYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIR-TLKPLDRETIPEYELTVVATDQGTPP-GQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSI 791          

HSP 2 Score: 182.956 bits (463), Expect = 9.743e-47
Identity = 131/432 (30.32%), Postives = 215/432 (49.77%), Query Frame = 2
Query: 1211 KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI---SDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            +++  + E+  + + + T+   DPD G NG I        ++++ P       T     +++ V+  +  LDRE        +   D G+ SL   + + + +LD+NDN P+F +N Y    PED  IG  +L V A+D D+  +N ++ Y I  S+  +  FSI E SG + +   LD E      + V A D+G P   S  V V  T+ D+NDC PQ  +  Y+  I E++P+   VT++ A D D G  G+V   I   +D  FFS +   G+++ K   D E    + +++ A+D G P L + +++ I ++DVNDN P+FV    S     I  +Y      E  +V   D D G NG+I F+F +  L    F IN ++G I +     +  + K F+  + A D G P  ++ +A I + ++DI
Sbjct:   24 QEDASVSEDAEVGTVVATVSASDPDSGSNGMI--------RYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSG-SNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPR-SATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFV---SSHFQTMIPENY--AVGQEFYRVQAYDKDHGTNGEITFSFMQNDLP---FSINENTGGISIKEELDREKVPK-FTFGIKARDKGVP-FKEGTAQITITLLDI 435          

HSP 3 Score: 179.104 bits (453), Expect = 1.413e-45
Identity = 156/543 (28.73%), Postives = 248/543 (45.67%), Query Frame = 2
Query:  887 VEENINVGTVIGRVQLK-----SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            V E+  VGTV+  V        SN  I  ++ +    N +   +  +  I +  GVI T   LDRE  ++H   V A  G    +     ++I +LD NDN P       IFE+     +IPE++ I   +L +   D D G NG +        ++ I  LN +   +    G +S  +     LDRE    +++ +   D+G    +++VT+K+ +LD+ND  P F K  Y  +  ED+ +   + TV ATD D   +N ++F+ I    + + FSIN  +G++ +   LDYE      + V A D+G P  L     V   + D+ND  PQ   S +   I EN  +      + A+D D G  G++   F+ +   FS +   G I  K   DRE    +T  I A+D G P    ++ I I +LD+NDN P+F     SQ   + SI+   +  + + +V   D D G    ++++          F IN   G+I L+ T   YN K ++   V A D        S+A ++V + D
Sbjct:   29 VSEDAEVGTVVATVSASDPDSGSNGMI--RYSMSPSQNLM---SATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGP-------IFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEV--------KYCI--LNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQG-SNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQP-FLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKF-----SQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRCFRIN-PQGLITLSCTL-NYNTKHVYVFSVSASDG----MLSSTALVYVNVTD 535          

HSP 4 Score: 119.783 bits (299), Expect = 2.845e-27
Identity = 100/314 (31.85%), Postives = 155/314 (49.36%), Query Frame = 2
Query: 1532 DNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSEN---SDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI----SDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDI--FFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            +NPP F +     S  ED E+G+ + TV+A+D D+  +N  I YS+  S+N   +  FSI++ +G I     LD E        V A D G P SL G + +   V D+ND  P  + + Y   I E+  I   V ++ A D+D+G  G+V + I     D   FS     G +      DRE   +YT+ + A+D GNP  +++ ++ I +LDVND  P+F     S+   + +I      +  +T V   D D+G NG++   FFE +   D+  F IN  +G + +      Y +  +F+L V A D G P
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSG-SNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEP-SLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQF-----SKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEV---FFEIVSGNDMNFFSINRINGEVRVKQKL-DYEMIGVFNLLVTAQDKGQP 317          

HSP 5 Score: 117.087 bits (292), Expect = 2.112e-26
Identity = 146/573 (25.48%), Postives = 244/573 (42.58%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNL-SIININKAAEYFLHSQPLSIKILAINTEKPFFNDT--LTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHD--------GVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIR-KSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSD----TGFGGKVIHFISDTQFFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP 2164
            D NDN P F        +              A DKD G N  I +  + +     I  +  G+++   ++  K  ++       +  I A +   PF   T  +TI L   N  P     FSQ+ Y   + EN   GT + +V     K I+P         ++  S+G       HD        G+I  +  L+   ++ +   V A+ G    + ST+ V + + D N + P+       F+++    E+ E+  + +++LT+   D D G N  I         ++I  L  E+ +  + +G    V+     LDRE    +   +   D G   L +   + + I D+NDN PVF K  Y+    ED+  G  ++ V+A+D D  + N+QI YS     +    F+I+   G I     LD ET     + V+A+D+G P     +V V   + D+ D  P  +   Y V + E+ P +S V ++ A   D    TG    ++   S  Q F  +P  G I+T +  D ET+S Y + + A    +P  T  +++ + + D+NDN P
Sbjct:  331 DVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKF-------TFGIKARDKGVPFKEGTAQITITLLDINDNPPK---FSQEEYHTSIAENSRWGTSVLQV-----KAIDPDSGPTNVVYSIVSSSG-------HDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPE-------FKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKI--------SYSIATLVPEF-SVDETTG----VIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGK-NAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPG-QASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNS-PQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATL--SPFFT-ETTVMVYLKDINDNTP 852          
BLAST of Protocadherin-1-like vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 187.963 bits (476), Expect = 2.908e-48
Identity = 180/675 (26.67%), Postives = 298/675 (44.15%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIK-----ILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQL--KSNKQINPKFKIEKCSN-TLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQF--FSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPI 2497
            D+NDN P+F  +  +  +S      + +++ +A+D D   N+ + Y ++ H    Q  P        +  IN A      S+   +K     +L  +   P      ++++ +       L  F +  Y   V EN  +G ++  + L       ++  ++I K +N   +R  G+        G ++  G LD E +N++ + V A +    ++  T  V +++LD ND  PK   D  +       IPEN  I S +L +F ED D G NG +    +S  +   E  + +  T           +  R  LDRE    F   +   D G   LTS  T++  +LD+ND PP F ++ +  S  ED  IG  + T+ ATD D    N++++Y I   +    F I  ++G I++  SLD E+     +N+ ASD  F         +   + D ND  P    S Y  +I EN P+ S V ++ A D+D G   ++ + +    F  F+    G +   +  DRETR  Y  ++ A D+G  +  S+ SI +   DVNDN P F     SQ S   ++         L +V   D D G N K+ ++          F I + +GII L   P    LK+ ++L V   D GTP    S A + +++++I  +
Sbjct: 2541 DENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGH----QTPP--------VFTINAATGVIQVSREPEVKSYNFFVLVKDGGNPLLRSIASVKITVLERDARILH-FGKSKYDVTVGENAEMGQIVTGLNLVVPGGNPVDVDYRIIKGNNDNNDRKFGV-----DSTGRVRVIGRLDYEIRNRYVMIVEANVSAINQIARTVVV-VQVLDINDVTPKFVSDPYL-----ASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTG---------WITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDED---LNTELYYFILSGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNISASDGLFTSFAQ----MKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFGTFAVDKNGKMTNLVELDRETRPFYNFMVSAADIGGQACYSNISIHLD--DVNDNRPLF-----SQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDA--GGTFTIETGTGIISL-EKPLNRELKENYTLNVEVMDGGTPP-LSSIATVQIKVLNINDV 3164          

HSP 2 Score: 144.821 bits (364), Expect = 6.240e-35
Identity = 153/574 (26.66%), Postives = 256/574 (44.60%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEG--PSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININ-KAAEYFLHS----QPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFL--EIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRII-----LDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT----QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEF 2170
            D ND PP F Q       S+K++     S+    ATD+D+  N+ + Y +L            SG   +   I  K    F+H     + +    L I+     F     +++ I++A  ++  + +Q IY   ++EN  +G+ +  V        +     E   +   +  G F   + GK   +++    LDRE +  +   V AA    +  YS   +SI + D NDN P     SS F      + E+ P+   +L +  +D D G N  +                  Y    D  G  +      II     L+RE+   +++ +   D G   L+S  T+++++L++ND PP F  + Y  +  ED  IG+ ++ V A   ++  +N  I Y+I +  +S LFSI+ ++G I++   LDYET     + V ASD G P  L     V  +VTD ND  P+  +  Y+  + EN  + + V  + A D D+G   ++ + I++     +F      G IK     DRE  +SY + + A+D G P   + + + I++ DVNDN PEF
Sbjct: 2855 DVNDTPPKFSQSEF--MASVKEDALIGQSVTTITATDEDL--NTELYYFIL------------SGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNISASDGLFTSFAQMKIDIEDA-NDNPPICTQSIYVEHIKENTPLGSTVLTV---GATDADVGVNAELTYSVFGQGFGTFAVDKNGKMTNLVE----LDRETRPFYNFMVSAADIGGQACYSN--ISIHLDDVNDNRPLFS-QSSYF----TAVYEDAPLKKVLLQVKADDADVGVNRKL-----------------TYSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRES--SNDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAG-PPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEF 3377          

HSP 3 Score: 132.88 bits (333), Expect = 3.413e-31
Identity = 142/561 (25.31%), Postives = 252/561 (44.92%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEG---PSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI---SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP 2164
            D NDNPP+  Q   ++Y+   KE     S+++   ATD D+G+N+ + Y +     F       +G   +++ +++    F +     +    I  +  + N    I + +D+ + ++  LFSQ  YF  V E+  +  V+ +V+   ++  +N      K + +L   AG    I    G+I     L+RE +  + + V    G    + S +TV IK+L+ ND  P+     SI+      + E+ PI + ++ +      E  N  I    L      +  ++++  T          + +NR  LD E +  +++T+   D G   L S+  +++ + D NDN P F +  Y     E+  +G+ +L V ATD D+  TN+QI YSI +  ++  F I E +G I ++  +D E      + V A D+G P  ++ + +V   VTD+ND  P+    + T  ++E+    + V  +  HD D    G    F     D   F     G I TKI     +   Y + +   D G+P  ++  SI +KI +   + P
Sbjct: 2955 DANDNPPICTQ---SIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQ-GFGTFAVDKNGKMTNLVELDRETRPFYN---FMVSAADIGGQACYSN----ISIHLDD-VNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVN-----RKLTYSLVTDAGGTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPE--FSHSIYHGN---VSEDAPIGNEVVRVRAVS-RESSNDVITYAILRGADSGLFSIDRKNGT----------IHVNRK-LDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSG-TNAQIKYSIAEGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVA-DTVVDIEVTDVNDNSPEFSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFKLHSNGLI-TKIGDVSHSDGQYRLRVLVADNGHPPQSTEVSITVKIAESKTHPP 3478          

HSP 4 Score: 119.783 bits (299), Expect = 3.173e-27
Identity = 172/654 (26.30%), Postives = 284/654 (43.43%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNH-TNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFID-NAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKC-SNTLERSAGLFLEIGKHDGVIK-TTGF-LDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSH--GQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ----FFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHD 2428
            D ND  P+F   T +  + L     + + +  ATD D   N  + + L    T    + P        ++ ++ AA   L     +IK+   +      N T   R+ I    +P S   FS+K Y   V E ++V + +  V+          + I    + T+   + LF  I    GV+    GF LDRE  + + V V A         + + V ++++D+NDN P + ++S  F   ++ + +   I     T    D D G N  +  D +    G F+I             S +   V++ R + D ++   F++ +   D       +   +K++++D     PVF +  +     ED  IGS + +V A     +   + I YSI   +  + FSI+ ++G + L SSLDYET T   + V A+D     S   +V V  TVTD+ND  P    S Y   I+E+ P+ + V ++ A D D+G   ++ +FI +      FF      G +    S D E+R  + +II A D G PSLT  + + + ++D NDN P F      +     SI         +T++   D DEGD  K+ ++      R+  F I+S SG+I L+   G     K++ L V   D
Sbjct: 1826 DINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSAAN--LTFSLARQDTELFAVNPL-----TGVVTVSNAA--LLRRDTYTIKLTVSDG-----NHTAHARVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRALG-------YPIGSTITYTIINPSELF-HIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQP-VFINSPYFIVLQLGVAQGTIIGQAQAT----DADIGSNANLRYDLIGGDPGYFSI-------------SRKTGEVVVRRTLDDVKVPRLFTLMVEATDG---LFRTEAVVKIKVVDKE--TPVFDQLSFSKVLAEDTPIGSEVTSVTAR----SPNGAGILYSITGGDPVNQFSIDFKTGVVTLVSSLDYETRTKYKLVVRATDA--RTSSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRF-----DKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQH-FQIDSQSGVITLSRVVG-IKQGKVYGLDVEVSD 2421          

HSP 5 Score: 110.153 bits (274), Expect = 2.659e-24
Identity = 135/515 (26.21%), Postives = 220/515 (42.72%), Query Frame = 2
Query: 1040 IKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV--EIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHG-QFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHIL---TVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGD--IYLTSSLDYETCTYIV-INVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT----QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLT---SSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELT------KVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGK-YNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI---EPILK 2503
            IKT+  L+RE    + + VV      K     + V+I + D NDN P       IF KK+    IPE+ P+ ++I  +   D D G NG I+         FAI P++      + LS       +  +  DR +            K K S    + + ++ ++       F   F   +  +++  G+  +   T+   D D           I        FSI     D  + +   LD E   +   + + A D+G P   +G+ ++   V D ND  P+  Q  Y   ++E  PI + V  ++A D D G  G +++ I+      +F   S  G I TK   D E+R  + + + A D G P  +   S+  + + ILD ND+DPEF  P            YR+    +LT       VS +D+D G NGK+ ++     LR   F I   +GII  T+   +   L +  +L+V A D GTP RR++   + +++ ++    P+LK
Sbjct:   57 IKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRP-------IFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTSFAINPISGVVSVAQKLSNSARIHRLTVVARDRALPP---------SKPKSSRNCQLIVNVQAVNQ------FSPEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVR-NGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALD-GVPLQSRKISTVPVVVNILDANDHDPEFKAP-----------EYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLAN--LRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLK 534          

HSP 6 Score: 109.768 bits (273), Expect = 3.457e-24
Identity = 86/302 (28.48%), Postives = 148/302 (49.01%), Query Frame = 2
Query: 1214 KEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ-LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDT--QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSL 2110
            + + I E+ PI + +      D D+G NG +    +     ++  +N         +G L+  +     LDRE  S +++ I   D GK   ++   + ++I D+ND  PVF K  Y+++ PE++ +G  +  V+A+D D   TN  I Y I  ++    F +N  SG + +   LDYE      I + A D        G+  V  T+ DIND  P ++   + V + E+L + + VTSI A D D+G GG++   + ++  +F   S  G I+ +   D E +S+Y + +   D G+P+L
Sbjct:  691 QNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDSVFNINM-------FTGELTVAMP----LDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQG-TNGFITYQI-VNDFGGKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPAL 979          

HSP 7 Score: 103.605 bits (257), Expect = 3.291e-22
Identity = 128/481 (26.61%), Postives = 209/481 (43.45%), Query Frame = 2
Query: 1058 LDREEQNQHCVEVVAA-IGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSG-----RLSYVLMNRIILDREISSYFSVTIFCYDKG-KISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVT----DINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGF-------GGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTP 2440
            LDRE  + + + + A   G H++   T  +++KI D ND  P       +F+K   EV +PEN  +  T+  +   D D+G NG I                  YQ   D  G     R+S V+     LD E    + + I   D         S  + + +LD+NDN P+     + ++  EDL + + + +++A+D D+     +I +S+   E++  F+I+ +SG I L   LD+E  +   + V  +D+G P   +   +V   +      +   F   ++  T  I EN P+ + V S  A D D+ +       G  V  FI D         G I+T    D E    Y + + AKD  +  L ++  + I I+D+ND  P F    PS  +    ++    S S + +V+ KD D G  G ++         ++ F I+  SG+I  T  P     K  + L V A D GTP
Sbjct:  749 LDRETISSYTLNISAVDCGKHRKSAYT-ILNVKITDVNDCSP-------VFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFI-----------------TYQIVNDFGGKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSG-PGGEIEFSL--PESTRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVLDVNENSLAPVFSGGRILET-SINENSPVGTVVISPKATDQDSWYLKYAIIDGTGVDKFIIDPD------TGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFA---PS--TYYPVLAENLPSGSSVVQVTAKDPDSG--GSLLRYTITKGNEQNNFVIDPQSGLI-TTLRPLDREFKSEYKLTVSASDGGTP 1186          

HSP 8 Score: 98.5969 bits (244), Expect = 9.552e-21
Identity = 98/347 (28.24%), Postives = 162/347 (46.69%), Query Frame = 2
Query: 1421 LDREISSY-FSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFP---KSLSGNVIVYFTVTDINDCFPQLQL-SYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSP-YGDIKTKISFDRETR--SSYTIIIYAKDMGNPSLTSSSSIF-IKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHD 2428
            LDRE++ + ++VT+  YDKG      S  +++ +LD NDN P F ++ Y  +  E   I + +L V ATD DA  +N  I Y I +      F IN ++G IY    LDYE+     + V A D G P   + +S  V V   + D ND  P+ +   Y   + E+L   + V ++ A D D+G  GKV + +++ +   F   P  G I+T  + DR+T       + + A D G P    + ++  +++ ++NDN P        Q   NI +         +T V+  DID  D  + +     +      F ++  +G   L +      L++ F+L + A D
Sbjct:  276 LDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAG-SNGNIMYVITRGNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALD-GVPLQSRKIS-TVPVVVNILDANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVL-----KQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTG--ELRTARSLRGLQREFTLIIKATD 612          

HSP 9 Score: 92.8189 bits (229), Expect = 6.340e-19
Identity = 155/665 (23.31%), Postives = 291/665 (43.76%), Query Frame = 2
Query:  512 NDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTN---FIQIKPSHSGLNLSIININKAAEY---FLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGL-FLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLN--KEYQTTKDLSGRLSYVLMNRIILDREISSY--FSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTS---IVAHDSDTGFGGKVIHFISDT--QFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPP-PSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFF-EYLLRKDIFFINSSSGIIYLTSTPGKYNLKK--IFSLKVIAHDHGT 2437
            ND  P F +      +S      ++++   A D D GIN  INY + N +    F +I    SG    ++ + K+ +Y    +H     + I+A +  KP       +R+ + +A  ++   F + +Y   +  + + G  + R+      + + K    K   ++    G    +I    GVI  +  +  ++   + ++V  +   H    STS V + I D ND+ P       IF +   +V   EN P  + +  +   D D G          +H  ++I+ ++  ++++   D     S +L +R++ DRE SS    SV I   D G         +++ ++D NDN P+F    Y  +    + +G+ +L  +A+D DA+ +N+ + Y I   +   +F+IN  +G I ++   + ++  +    V+  D G P  L     V  TV + +        S Y V + EN  +   VT    +V   +      ++I   +D   + F     G ++     D E R+ Y +I+ A ++   +  + + + +++LD+ND  P+FV  P  +    NI I       S++ +V  +D+D G NG + +    +  L K+ F I+  +G I   +T G  + +K   F  +V A D+GT
Sbjct: 2230 NDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKID-KKSG----VVFVAKSLDYESRVVHE----MIIVAADEGKPSLTGETRVRVVLMDA-NDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAK----KLRYSITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDSVH---VSTSKVRVIIGDTNDHSP-------IFSEDVYKVSFNENYPEGTFVTMVSATDLDSGN--------YAHLTYSIDSVDAMRKFRIDAD-----SGMLYSRLMFDRENSSQAIMSVPIRATDGG--GRFGFCVVEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDAS-SNAALTYVIVGHQTPPVFTINAATGVIQVSREPEVKSYNFF---VLVKDGGNPL-LRSIASVKITVLERDARILHFGKSKYDVTVGENAEMGQIVTGLNLVVPGGNPVDVDYRIIKGNNDNNDRKFGVDSTGRVRVIGRLDYEIRNRYVMIVEA-NVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDI------GSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWI---TTRGALDREKQPSFEFQVRATDNGT 2840          

HSP 10 Score: 90.1225 bits (222), Expect = 4.038e-18
Identity = 145/685 (21.17%), Postives = 282/685 (41.17%), Query Frame = 2
Query:  512 NDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL-NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEV--EIPENRPIDSTIL-----TLFPEDPDEGENGTIF----CDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFP--QLQLS---YTVYIAENLPIQSHVTSIVAHDSDTGFG-GKVIHF--ISDTQFFSCSPYGD---IKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKD--IFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIE 2491
            ND+ P F        + +  +  ++++   ATDKD G NS + Y ++  +TN    K      N  ++ +       +H    ++K+ + +  +P     + +++ +   +      F +  Y   + EN      I  V       I P ++I    +   R       + +  GVI +    D EE     +E+ A   D +  +S++ V + I D+NDN P       IFE   +   + E  P  + +L      L     D+  +G        +  +   F+I P      T K              +LD E++  ++  I   D G   L++   +K+ + D+ND  PVF  + Y  +       G+ +  V ATD D+    + + +S+ + ++++LF++N  +G + ++++      TY  I +  SD        GN   +  V    +  P   LQ S   Y+  + E + + S + ++ A     G+  G  I +  I+ ++ F   P      I+     DRE+  +Y +I+ A+D   P   + +++ ++++D NDN P F+  P       I +       + + +    D D G N  + +     L+  D   F I+  +G + +  T     + ++F+L V A D       ++ A + +++VD E
Sbjct: 1515 NDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTN----KSLSVDQNSGVVKVAGRLSTLVHQ--YALKVQSTDGGEPPLKTQVDVKVKVRGIVKNFA--FEKPKYEVSLPENSPPDQAIATVVYNG---ILPVYEIVPGRSPCWRD----FTVQRQSGVIISKKSFDAEEVTHCKLEIRANSTDGQ--HSSTLVIVTIQDKNDNQP-------IFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHPATGAITTAK--------------VLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSA---ANLTFSLAR-QDTELFAVNPLTGVVTVSNAALLRRDTY-TIKLTVSD--------GNHTAHARVRIRCENLPSSDLQFSRKNYSASVREGVSVDSELVTVRA----LGYPIGSTITYTIINPSELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSP-----YFIVLQLGVAQGTIIGQAQATDADIGSNANLRYD----LIGGDPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDG----LFRTEAVVKIKVVDKE 2131          

HSP 11 Score: 90.1225 bits (222), Expect = 4.073e-18
Identity = 86/320 (26.88%), Postives = 143/320 (44.69%), Query Frame = 2
Query: 1217 EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL---QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS----DTQFFSCSPYGDIKTKISF-DRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVN 2152
            E  I EN P+ + +++    D D         D     +F I+P     +T  +L              D E++ ++ +T+   D     L +++ + + I+D+ND  P F  + Y     E+L  GS ++ V A D D+    S + Y+I K    + F I+ +SG I     LD E  +   + V ASD G P  +S +V     +TD ND  P+    Q    V+  +       +  +VA D D G    + + I+    D +F   S  G+I T +S  D E   SY + I A+D G P L++S+++ I ++  N
Sbjct: 1008 ETSINENSPVGTVVISPKATDQDSWYLKYAIIDGTGVDKFIIDPDTGAIRTAGEL--------------DHEVADHYWLTVQAKDGESYPLYTNIPVLINIVDLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDS--GGSLLRYTITKGNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPP-VSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGE---SYDLTIVAEDNGLPKLSTSTNVLIDVIQGN 1307          

HSP 12 Score: 84.3445 bits (207), Expect = 2.056e-16
Identity = 120/456 (26.32%), Postives = 194/456 (42.54%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLL--NHTNFIQIKPSHSGLNLSIININK--AAEYFL-------HSQPLS------IKILAINTEKPFFND-TLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI---RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPK 1804
            D ND  P F   T    L+      SS++   A D D G  S++ Y +   N  N   I P  SGL  ++  +++   +EY L        + P+S      +KI   N  +P F +    + +F   A  +S  L+         +E+I     +     K N+  + KF I+       RS  +F  +   DG               + + +VA      ++ +++ V I ++  N    K   ++ +F  K+   +I E++ I+S +L +  EDPD                + I   N   + T D  G    V  +   LDRE  S++S+ +   D      T+SV + + ILD+NDN P   +  Y+    E+ ++G+ + TV   D DA   N ++ Y I    K+E++ LF I   SG I     LDYET    V+ + ASDRG PK
Sbjct: 1096 DLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPDSG-GSLLRYTITKGNEQNNFVIDP-QSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQ----VVATDEDIGSNADLRYSITKGNR--DNKFIID------SRSGEIFTNVSLVDG-------------ESYDLTIVAEDNGLPKLSTSTNVLIDVIQGN----KPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD-----------FDQITYNIASGNHGNKFTIDRYGGFITVAHS---LDREEKSFYSLRVEATDGYN---TASVPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTVK--DPDAG-VNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPK 1500          

HSP 13 Score: 76.2554 bits (186), Expect = 6.207e-14
Identity = 93/346 (26.88%), Postives = 158/346 (45.66%), Query Frame = 2
Query: 1421 LDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRK-SENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ----FFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEY-LLRKDIFFINSSSGIIYLTSTPGKYN-LKKIFSLKVIAHDHG 2434
            LD E  + + + +   D  + S  S V + + + D+ND  P F ++ Y  +  E   + + ++TV A D D+   N +I Y I+  S     F I+++SG +++  SLDYE+     + ++A+D G P SL+G   V   + D ND  P+   S Y   I  +      VT I+A D D G   K+ + I+  Q    F   S  G I        +    Y + +   D  +    S+S + + I D ND+ P F     S+    +S +      + +T VS  D+D G+   + ++      +RK  F I++ SG++Y      + N  + I S+ + A D G
Sbjct: 2195 LDYETRTKYKLVVRATD-ARTSSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSG-INKEINYFIQNVSRVGAFFKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKP-SLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDSVH---VSTSKVRVIIGDTNDHSPIF-----SEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRK--FRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGG 2527          

HSP 14 Score: 66.2402 bits (160), Expect = 8.177e-11
Identity = 101/416 (24.28%), Postives = 167/416 (40.14%), Query Frame = 2
Query:  533 PQRTINVYLSLKKEGPSSMILP--NATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSI--KILDQNDNYPKIGLDSSIFEKKEV--EIPENRPIDSTILTLFPEDPDEGENGTIFCDC--LSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGK-ISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSL 1741
            P+ ++   L    EG S ++       DKD G N  I+   +   N        S  N   + + K  +  L     ++ + A +   P  N +  +R+ +    DN  PE    F+Q  Y   + E   + T + RV L ++K       I     T     G F EI    G I T G LD E + +  + V A  G   +    STV +   ILD ND+ P+       F+  E   ++ E+    +++ T+  ED D G NG +      L    F IEP     +TT +L              D  +  + ++ +   D G  +   +   +K+R+ +MNDN PV  +    I    +  +G  I TV A D+D +  +  + Y          FS++ ++G++    SL
Sbjct:  209 PEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNN-PE----FNQSRYITNLSELAPIHTPVLRV-LATDKDAGSNGNIMYVI-TRGNELGKF-EINSKTGQIYTKGDLDYESRQRFDLTVAALDGVPLQSRKISTVPVVVNILDANDHDPE-------FKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTNLD------------RDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTGKAFSLDPKTGELRTARSL 597          
BLAST of Protocadherin-1-like vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 184.882 bits (468), Expect = 3.853e-48
Identity = 190/685 (27.74%), Postives = 299/685 (43.65%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGP------SSMILPNATDKDIGINSVINYKLLNHTNFIQ-------------IKPSHS-------GLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS-NKQINPK--FKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYE-----TCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ-FFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSE-LTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNL--KKIFSLKVIAHDHG 2434
            D+NDN P F        +  +  GP      +S I+  ATD+DI  N+ + Y+L N ++ IQ             + P  S            +I  ++A         + I +L  N   P F             IP S+           + E  ++G  + RV     +  +N +  F I   S       G F EIG+ DGV++ +G LDRE +  + + V A  G +       TV++ + D NDN PK       F K    V++ E   + S I+     DPD+G N  I    +S+  FAI         T+ L              DRE    +S T+   D G   L S+V + + I D NDN P FP   YQ    +   +G+ +L VNA D D    N  + Y+I        F I   +G+I  +S LD E     T  + V+N+  +D G  +  +   ++  +VTD ND  PQ  Q  Y+  + EN+P+ + VT + A D D+G   ++++ ++     FS  P  G I+ + + +RE + +Y + I A D G P L+S + + + +LDVNDN P F      +     ++S    ++ E + +V+  D D   NG + +T     L   +F IN ++G+I    T G  N   K  ++L V+A D G
Sbjct:  215 DRNDNVPKFSHARYTGSIQ-ENSGPGVPVQMASSIM--ATDRDIESNADVRYRL-NGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRF-------------IPSSIQ--------STISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSE------GKF-EIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPK-------FTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITY-SMSYPGFAINSNTGSVTITRPL--------------DRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGN-NGHVTYAILILP----FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQ-FTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYER-----TMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGAL--GMFTINETTGVI---RTQGVLNRESKDFYTLIVMARDQG 827          

HSP 2 Score: 131.724 bits (330), Expect = 2.649e-31
Identity = 143/506 (28.26%), Postives = 234/506 (46.25%), Query Frame = 2
Query: 1034 GVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCL---SHGQF-AIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKG-KISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPED------LEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLT----SSLDYETCTYIVINVIASDR-GFPKSLSGNVIVYFTVTDINDCFPQ-LQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            G+IKT   L+R++   + + + AA        +T+ VSI + D NDN P       +F        + EN P+ +++L +   D D G+N  +        SHG F A+  ++     T +++G           LDRE++ ++++TI   D G  IS T+     +RILD NDN P F    Y  S  E+      +++ S I+   ATD D   +N+ + Y +  S+ S  F++N R+G I        SLD+E  T    +VIA+D+ G        V+++  V D ND  P+ +  S    I+E   I   V  + A+D D+G  G++   I+  S+ +F      G ++   S DRE ++ Y + + A D          ++ + + DVNDN P+F  P     + N+ +S      S +   +  D D+G N  I      Y +    F INS++G + +T  P     K+ +S  V A D G  E   S+  + V+I D
Sbjct:   64 GMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNP-------VFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSN--HGTIEVAGN----------LDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIM---ATDRD-IESNADVRYRLNGSD-SIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIH--VLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKP-----AFNVDVSEGVAVGSVIVNATATDPDQGSNAAIT-----YSMSYPGFAINSNTGSVTITR-PLDRETKQAYSFTVHARDGGGLE---SNVAVNVEIGD 529          

HSP 3 Score: 124.405 bits (311), Expect = 6.181e-29
Identity = 119/434 (27.42%), Postives = 202/434 (46.54%), Query Frame = 2
Query: 1256 ILTLFPEDPDEGENGTI--------FCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLF-SINERS--GDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAEN----LPIQSHVTSIVAHDSDTGFGGKVIHFI--SDTQFFSCSPY-GDIKTKI----SFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            I T+   D D+G NG +          D  S+  F ++P     +T ++L              +R+ +  +++TI   D G  S +++  + + + D+NDN PVF    Y  +  E+  +G+ +L V ATD D+ + N+ + YS+   ++  LF ++ + S  G I +  +LD E   +  + + A+D G P S +   I    + D ND  P+     YT  I EN    +P+Q   +SI+A D D      V + +  SD+  F+ +P  G I T++    S D E  ++YT  + A D       S + + I +LD NDN P F+   PS  S   +IS        + +V+  D D G NG+I F+       K  F I  S G++ ++ +  +   K ++ L V A D G+   R+    + V + D+
Sbjct:   23 IATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNL--------------ERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQ-NAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQ-MASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFI---PS--SIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGK--FEIGRSDGVVRVSGSLDR-EAKAVYVLNVSAID-GSYSPREGYGTVTVTLQDV 431          

HSP 4 Score: 114.005 bits (284), Expect = 9.369e-26
Identity = 147/565 (26.02%), Postives = 243/565 (43.01%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-IQIKPSHSGLNLS-IININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCY-----DKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAE-NLPIQSHVTSIVAHDSDTGFGGKVIHFI---SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDP 2164
            D NDN P F   +I   +S       S+    A D D G+N  I + + + +    +I  S   + +S  ++    A Y L+   +S    + +  + +   T+T++   DN  P+    F++  +   V E + VG+VI       N       +    + T   S   F  I  + G +  T  LDRE +  +   V A  G   E  S   V+++I D+NDN P+         + + ++ +  P+ + +L +  ED D G NG +    L    F I P      T+  L              DRE  S +++  +       D G    TS   + + + D NDN P F ++ Y  +  E++ +G+ +  V A D D+   NSQI YS+   +   +FSI   +G I L  +++ E      + + ASDRG P  LS +  V+  V D+ND  P      Y   ++E N      V  + A D+D    G V + I   +   F      G I+T+   +RE++  YT+I+ A+D G        +I + ++D NDN P
Sbjct:  326 DANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLN---VSAIDGSYSPREGYGTVTVTLQDVNDNT-PK----FTKPAFNVDVSEGVAVGSVI------VNATATDPDQGSNAAITYSMSYPGFA-INSNTGSVTITRPLDRETKQAYSFTVHARDGGGLE--SNVAVNVEIGDENDNSPQFPT-----VQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILIL-PFIIVPDTGNINTSSKL--------------DREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDS-GINSQIMYSLTGGDG--VFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPV-LSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          

HSP 5 Score: 65.855 bits (159), Expect = 7.987e-11
Identity = 87/353 (24.65%), Postives = 153/353 (43.34%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMIL--PNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSI-ININKAAEYFL--HSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS-NKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPV 1546
            D+NDN P FP  T+     +    P   I+   NA D+D+G N  + Y +L    FI I P    +N S  ++  + + Y L  +   LS+    +     F    +++  F DN  P+    F+Q  Y   V EN+ VGT +  V  +  +  IN +        +L    G+F  I    G I+    ++RE +  + V + A+      + S + V + +LD NDN P     S ++E+   E   N      ++ +   D D   NG +    + HG   +  +N+            + V+  + +L+RE   ++++ +   D+G +      TI + ++D NDN P+
Sbjct:  529 DENDNSPQFP--TVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL-ILPFI-IVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQ-PQ----FNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMY-----SLTGGDGVF-SIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPV--FTSRVYERTMSE--GNAAAGEFVVQVNATDADVERNGHVTYTIM-HGALGMFTINE-----------TTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTPI 850          
BLAST of Protocadherin-1-like vs. Ensembl Nematostella
Match: EDO33358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF1])

HSP 1 Score: 171.4 bits (433), Expect = 1.239e-45
Identity = 153/489 (31.29%), Postives = 234/489 (47.85%), Query Frame = 2
Query: 1034 GVIKTTGFLDREEQNQHCVEVVAAIGDHK--EVYSTSTVSIKILDQNDNYPKIGL---DSSIFEK----KEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTS--SVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGF-PKSLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD---TQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPP-SQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERR 2449
            GVI  T  LD E      + + A        E  + + V I ++D NDN P   L   +++I E       V + E  P+  TIL L   D D  EN  +    +S      +P +  + +    SG +S        LD E    +++T+  +D GK  L S     + +RI D NDN PVF ++ Y+    E++  G  ++ V A D D  + N ++ YS+ +  N+  F +NE +G+IYL+ SLD+E     V  +IASD G  PKS S +V V   V D+ND  P   +  Y   + EN P+ +    + A D+DTG   K+ + I+       F    +G +    + D ETR  Y + I A+D G+P LTS  S+ + I D NDN P F  P    +   N+SI       +++ +V   D D G N +I ++F    + K  F IN+++G+IY T     +  K+++   VIA D G P  R
Sbjct:    7 GVITLTKSLDSERNTTFNLTITAHDKGMPSLETATRAIVVIDVVDTNDNNPIFELSLYETTILENTTAGSSVMVSEYAPVGQTILRLTVSDNDTAENSQLNLRVVSG-----DPNSTFFLSN---SGEISIARK----LDYERLQMYNLTVVAWDSGKPVLQSLKPANVVIRIRDDNDNQPVFSRDLYEAWVLENITAGQFVVQVKAKDADYQQ-NGRLVYSMVR--NNSKFRVNETTGEIYLSESLDFEETKEYVFGIIASDSGVEPKSSSTSVRV--IVMDVNDNVPTFDRFLYKSTVRENSPVGTTAIKVQAIDTDTGSNAKIEYIIASGNTNNSFDIDNHGFVTVNKAIDFETRKIYNLTIMARDCGDPVLTSIVSVVLLIEDENDNPPVFDLPYYFVRMYENVSI------RADIIRVHASDSDSGFNSEIRYSFPVGFVVKP-FAINANTGMIY-TRHEIDFEEKRVYEFSVIASDQGIPVLR 470          

HSP 2 Score: 106.686 bits (265), Expect = 3.836e-24
Identity = 127/456 (27.85%), Postives = 209/456 (45.83%), Query Frame = 2
Query:  506 DKNDNPPLFP----QRTINVYLSLKKEGPSSMILPNA-----------TDKDIGINSVINYKLL----NHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFND----TLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFP 1801
            D NDN P+F     + TI   L     G S M+   A           +D D   NS +N +++    N T F+    S+SG     I+I +  +Y    Q  ++ ++A ++ KP         + IR+  DN   ++  +FS+ +Y   V ENI  G  + +V+ K ++ Q N +       N  +        + +  G I  +  LD EE  ++   ++A+    +   S+++V + ++D NDN P    D  +++     + EN P+ +T + +   D D G N  I        ++ I   N       D  G   +V +N+ I D E    +++TI   D G   LTS V++ L I D NDNPPVF   +Y +   E++ I + I+ V+A+D D+   NS+I YS         F+IN  +G IY    +D+E       +VIASD+G P
Sbjct:   51 DTNDNNPIFELSLYETTI---LENTTAGSSVMVSEYAPVGQTILRLTVSDNDTAENSQLNLRVVSGDPNSTFFL----SNSGE----ISIARKLDY-ERLQMYNLTVVAWDSGKPVLQSLKPANVVIRIRDDN---DNQPVFSRDLYEAWVLENITAGQFVVQVKAKDADYQQNGRLVYSMVRNNSK------FRVNETTGEIYLSESLDFEETKEYVFGIIASDSGVEPKSSSTSVRVIVMDVNDNVPT--FDRFLYKST---VRENSPVGTTAIKVQAIDTDTGSNAKI--------EYIIASGNTNNSFDIDNHG---FVTVNKAI-DFETRKIYNLTIMARDCGDPVLTSIVSVVLLIEDENDNPPVFDLPYYFVRMYENVSIRADIIRVHASDSDSG-FNSEIRYSFPVGFVVKPFAINANTGMIYTRHEIDFEEKRVYEFSVIASDQGIP 467          
BLAST of Protocadherin-1-like vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 216.853 bits (551), Expect = 1.115e-57
Identity = 198/675 (29.33%), Postives = 311/675 (46.07%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKL-----LNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-----SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFI--SDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVS---CKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTST-PGKYNLKKIFSLKVIAHDHGTPERRKSS 2458
            D NDN P F    + + +       +   +P A D+D G N V  Y L      N    +Q+          +I I         S  L+I++  ++  KP    +  +R+ +    DNA P+    F +  Y  ++ EN   G  + +V+       +N  I+  + + + S+T++R     L I +  G+I   G +DREE N     VVA         S + V+I I DQNDN P I   G+   I +     I E+ PI + +  +   D DEGEN  + C       F + P ++     K       Y L    +LD E    + + I   D G  +L+S+ ++K+++ D+NDN P F     ++++ ED + G  ++ V ATD D+   N+++ YSI +S  + LF IN  +G+I + + LD E        V A+D+G P S +G  IV   V D ND  P+  LS Y+  + EN+P  + V  +   D+D G   +V  F+   + +F   +  G I + ISFDRE  S+YT  + A D G+P  +S   + I +LD NDN P    P      AN S ++ + SS   T V     +DID G N ++ +T         +F I+ +SG I L     GK+  K +  L V   D G P R  ++
Sbjct:  143 DINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRV--VDGGKPPRASSALLRITVTDQNDNA-PK----FEKNQYEAELPENSPPGHSVLQVRANDADTGANGDID--YSLHQASDTVQR----LLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRK-----RKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSG-VNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVP-SKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKP------ANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHG-LFQISHNSGEIKLAQGFTGKH--KGLHRLVVRVSDKGKPPRHTTA 788          

HSP 2 Score: 83.9593 bits (206), Expect = 6.522e-16
Identity = 127/576 (22.05%), Postives = 231/576 (40.10%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQ--IKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIP---ESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQI-----------NPKFKIEKCSNTL-ERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL----QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ---FFSCS-PYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDN 2158
            D+NDN P F +      L        S++   A D D G N  I+Y L   ++ +Q  ++   S   + +  +    E  L    +  +    N++      T++I+   DNA       + L   + +   + E++ +GT +  VQ+    +            +  F++   S +  +R    FL+         TT  LD E    + +E+VA    +  + ST+++ +++ D NDN P      ++ E    E  +N+P D  ++ +   D D G N  +    +     ++  +N         +G +      R  LDRE    +   +   DKG  S T +  + + + D NDN P F  + Y  S  E++   + +  V  +D D    NSQ+   +        F I   +G I  + S D E  +     + A D G P   S  V V   V D ND  P +      SYT ++  + P  + V  + A D D G   ++ + I+       F  S   G+IK    F  + +  + +++   D G P   +++ + + + +  +N
Sbjct:  255 DQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQ---------TTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPS--FSPALLEVNFAE--DNQPGDK-VIDVVATDADSGVNAELVYSIIESSAASLFEINSN-------TGEIRV----RNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGE-NSQVTLFVEPDNGK--FIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPR-SSYVGVTINVLDENDNAPYVTKPANSSYT-HLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 80.1073 bits (196), Expect = 8.179e-15
Identity = 97/353 (27.48%), Postives = 155/353 (43.91%), Query Frame = 2
Query: 1511 LRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFS------INERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDT--QFFSCS-PYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQG---------SANISISYREQSSSELTKVSCKDIDEGDNGK---IIFTFFEYLLRKDIFFINSSSGIIYL-TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            + +LD+NDN P F      +S PE+   G+      A D D+  +N    Y++    +++ LF       ++E+   + +  +LD E      +N+   D G P   S + ++  TVTD ND  P+ + + Y   + EN P    V  + A+D+DTG  G +   +H  SDT  +        G I  K   DRE  +     + A+D G  S +S + + I I D NDN P        +G          ANIS      +   L +VS  D DEG+N     ++     + LR      N      +L T+T   Y   K + ++++A D G P    S+ ++ VQ+ DI
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSG-SNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRAS-SALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEI----RGIGLVIHQNFVANISEDMPIGTPVALVQVS--DRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPA-LSSTNSLKVQVTDI 482          
BLAST of Protocadherin-1-like vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 216.853 bits (551), Expect = 2.213e-57
Identity = 198/675 (29.33%), Postives = 311/675 (46.07%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKL-----LNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFI----DNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLK-----SNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVS---CKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTST-PGKYNLKKIFSLKVIAHDHGTPERRKSS 2458
            D NDN P F    + + +       +   +P A D+D G N V  Y L      N    +Q+          +I I         S  L+I++  ++  KP    +  +R+ +    DNA P+    F +  Y  ++ EN   G  + +V+       +N  I+  + + + S+T++R     L I +  G+I   G +DREE N     VVA         S + V+I I DQNDN P I   G+   I +     I E+ PI + +  +   D DEGEN  + C       F + P ++     K       Y L    +LD E    + + I   D G  +L+S+ ++K+++ D+NDN P F     ++++ ED + G  ++ V ATD D+   N+++ YSI +S  + LF IN  +G+I + + LD E        V A+D+G P S +G  IV   V D ND  P+  LS Y+  + EN+P  + V  +   D+D G   +V  F+   + +F   +  G I + ISFDRE  S+YT  + A D G+P  +S   + I +LD NDN P    P      AN S ++ + SS   T V     +DID G N ++ +T         +F I+ +SG I L     GK+  K +  L V   D G P R  ++
Sbjct:  143 DINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRV--VDGGKPPRASSALLRITVTDQNDNA-PK----FEKNQYEAELPENSPPGHSVLQVRANDADTGANGDID--YSLHQASDTVQR----LLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRK-----RKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSG-VNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVP-SKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKP------ANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHG-LFQISHNSGEIKLAQGFTGKH--KGLHRLVVRVSDKGKPPRHTTA 788          

HSP 2 Score: 83.5741 bits (205), Expect = 9.244e-16
Identity = 127/576 (22.05%), Postives = 231/576 (40.10%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQ--IKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIP---ESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQI-----------NPKFKIEKCSNTL-ERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQL----QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ---FFSCS-PYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDN 2158
            D+NDN P F +      L        S++   A D D G N  I+Y L   ++ +Q  ++   S   + +  +    E  L    +  +    N++      T++I+   DNA       + L   + +   + E++ +GT +  VQ+    +            +  F++   S +  +R    FL+         TT  LD E    + +E+VA    +  + ST+++ +++ D NDN P      ++ E    E  +N+P D  ++ +   D D G N  +    +     ++  +N         +G +      R  LDRE    +   +   DKG  S T +  + + + D NDN P F  + Y  S  E++   + +  V  +D D    NSQ+   +        F I   +G I  + S D E  +     + A D G P   S  V V   V D ND  P +      SYT ++  + P  + V  + A D D G   ++ + I+       F  S   G+IK    F  + +  + +++   D G P   +++ + + + +  +N
Sbjct:  255 DQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQ---------TTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPS--FSPALLEVNFAE--DNQPGDK-VIDVVATDADSGVNAELVYSIIESSAASLFEINSN-------TGEIRV----RNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGE-NSQVTLFVEPDNGK--FIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPR-SSYVGVTINVLDENDNAPYVTKPANSSYT-HLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          

HSP 3 Score: 80.4925 bits (197), Expect = 6.526e-15
Identity = 97/353 (27.48%), Postives = 155/353 (43.91%), Query Frame = 2
Query: 1511 LRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSD-LFS------INERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV---IHFISDT--QFFSCS-PYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQG---------SANISISYREQSSSELTKVSCKDIDEGDNGK---IIFTFFEYLLRKDIFFINSSSGIIYL-TSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDI 2488
            + +LD+NDN P F      +S PE+   G+      A D D+  +N    Y++    +++ LF       ++E+   + +  +LD E      +N+   D G P   S + ++  TVTD ND  P+ + + Y   + EN P    V  + A+D+DTG  G +   +H  SDT  +        G I  K   DRE  +     + A+D G  S +S + + I I D NDN P        +G          ANIS      +   L +VS  D DEG+N     ++     + LR      N      +L T+T   Y   K + ++++A D G P    S+ ++ VQ+ DI
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSG-SNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRAS-SALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEI----RGIGLVIHQNFVANISEDMPIGTPVALVQVS--DRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPA-LSSTNSLKVQVTDI 482          
BLAST of Protocadherin-1-like vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 215.698 bits (548), Expect = 5.956e-57
Identity = 215/772 (27.85%), Postives = 344/772 (44.56%), Query Frame = 2
Query:  422 CSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI-RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTM-VLAGILIVIIMSILTAVVYVCHKIQ 2695
            C   F ++++  + +    L+   + + D NDN P FP   + + +       +   +P ATD+D   N V +Y L    +      +Q+     G    +I +         S  L+IK  A++   P       +R+ + +A   S   F    Y  +V EN  VG  +  +Q+K++   + P  +IE   +         L I +  G+I   G LDREE N     VVA     +   S + V+I++ DQNDN P +   G+      +    I E+ P+ + +  +   D DEGEN  + C       F + P +    +T D   +  Y L     LD E    + V I   D G  +L+S+ ++K+++ D+NDN PVF    +++ + E+ + G  IL V ATD D+  TN+++FY+I   S    LF I+  +G++   + LD E        V A+D+G P    G   V   V D ND  P+  LS Y+  + EN+P  S V  +   D D G    V   +     +F   +  G I + ISFDRE  SSYT  + A D G P  +S   + I +LD NDNDP    P     S+   +S      S +  V  +D+D G N  ++F+       + +F I+ SSG I L     + +   +  L V   D G P R    A   V I   E I  V  ++  + +  S +     D++      +  + S +    LAG+  V+I+  + AVV++ H+IQ
Sbjct:  173 CYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIK--AVDGGNPQRYSQALLRVVVTDANDNSPK-FEHPSYEAEVSENSPVGHSV--LQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAS---DSTSD--NKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSG-TNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVH-KGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP---SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQ-LFRISPSSGEITLAKEMTRKH-GGLHRLVVRVSDRGKPPRH---ATALVHIYVNETISNV--SLVEALVGHSLYTPLDRDIAGDPESSFAAQRSNILFGSLAGVAGVVIL--ILAVVFIRHRIQ 920          
BLAST of Protocadherin-1-like vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 214.542 bits (545), Expect = 6.137e-57
Identity = 215/772 (27.85%), Postives = 344/772 (44.56%), Query Frame = 2
Query:  422 CSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNF-----IQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSN-KQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKI---GLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSI-RKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFIS--DTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTM-VLAGILIVIIMSILTAVVYVCHKIQ 2695
            C   F ++++  + +    L+   + + D NDN P FP   + + +       +   +P ATD+D   N V +Y L    +      +Q+     G    +I +         S  L+IK  A++   P       +R+ + +A   S   F    Y  +V EN  VG  +  +Q+K++   + P  +IE   +         L I +  G+I   G LDREE N     VVA     +   S + V+I++ DQNDN P +   G+      +    I E+ P+ + +  +   D DEGEN  + C       F + P +    +T D   +  Y L     LD E    + V I   D G  +L+S+ ++K+++ D+NDN PVF    +++ + E+ + G  IL V ATD D+  TN+++FY+I   S    LF I+  +G++   + LD E        V A+D+G P    G   V   V D ND  P+  LS Y+  + EN+P  S V  +   D D G    V   +     +F   +  G I + ISFDRE  SSYT  + A D G P  +S   + I +LD NDNDP    P     S+   +S      S +  V  +D+D G N  ++F+       + +F I+ SSG I L     + +   +  L V   D G P R    A   V I   E I  V  ++  + +  S +     D++      +  + S +    LAG+  V+I+  + AVV++ H+IQ
Sbjct:   96 CYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIK--AVDGGNPQRYSQALLRVVVTDANDNSPK-FEHPSYEAEVSENSPVGHSV--LQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAS---DSTSD--NKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSG-TNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVH-KGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP---SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQ-LFRISPSSGEITLAKEMTRKH-GGLHRLVVRVSDRGKPPRH---ATALVHIYVNETISNV--SLVEALVGHSLYTPLDRDIAGDPESSFAAQRSNILFGSLAGVAGVVIL--ILAVVFIRHRIQ 843          
BLAST of Protocadherin-1-like vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 211.075 bits (536), Expect = 9.327e-56
Identity = 223/845 (26.39%), Postives = 375/845 (44.38%), Query Frame = 2
Query:   20 MSLKLMMIIGLFLCKNYYFLIFHNVSVT----YRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLC-QLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEY--FLHSQPLS--------IKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNT-LERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFE-KKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSS---SELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            M LK   ++G  L       I+ + S+     Y I EE   ++ +GN+  D  I   +A    S   NL  +L+      P  +  G      +  E +  T +RIDRE++C    FE                  D  CS    + + P   +  F L+ +++++ D NDN P+FP   IN+ +       S   +P+ATD D G NSV  Y+L+N           S   L I+   +  ++   +  Q L         +KI   +   P  + T  +++ + + + ++  +F +      + EN  +GT + ++Q  ++  I P  +I     T +  +      +    G+I     LDREE   H + V+A+ G      + +TV I + D NDN P I L   I      V + E  PI++ I  +   D D   NG + C       F ++ +               Y+L    +LD E +  ++  I   D GK SL  +  +++R+ D NDNPP+F +   +++  E+ +    + T++ATD D+ + N++I Y +    N+  F ++ ++G +  +   D E     +  V A D G P  L     V  TV D ND  P+   + +  +++ENLP  S V  I   DSD G    + +  ++D + F   P+ G IK+ +SFDRE +SSYT  + A D G P  +S++ + I ++DVNDN P  ++PP     +N S      SS   S + +V   D D G N ++ +T       K +F I+  +G I L   P   ++  +  L V   D G P+   +   +F+ + D
Sbjct:    1 MDLKDFYLLGSLLA-----CIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGAS--ANLVYRLVSKAGDSPLVRVLG------NTGEIF-TTSNRIDREKLCPGSSFE------------------DAECSFEIEVVVLP---NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELIN---------GQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTD-VNDNKPVFRENQIEVHIPENSPIGTSVVQLQ-ATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSP--ARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN-----------QYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGK-NAEIVYQL--GPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPP-LQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPP-----SNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSG-NNKGLFRIDPVTGNITLEEKPAPTDI-GLHRLVVNISDLGYPKSLHTLVLVFLYVND 775          
BLAST of Protocadherin-1-like vs. Planmine SMEST
Match: SMESG000066263.1 (SMESG000066263.1)

HSP 1 Score: 2035.77 bits (5273), Expect = 0.000e+0
Identity = 1010/1012 (99.80%), Postives = 1011/1012 (99.90%), Query Frame = 2
Query:   20 MSLKLMMIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFPVPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPYKSTPNTEIPVLCSNEYVDSERESLQLISTSRSLDRHQLNRSENDYEIIKAANLPLKRNIKRELSLIRQ 3055
            MSLKLMMIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQIFLLLLVEVVIIDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERS GLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFPVPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPYKSTPNTEIPVLCSNEY+DSERESLQLISTSRSLDRHQLNRSENDYEIIKAANLPLKRNIKRELSLIRQ
Sbjct:    1 MSLKLMMIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQIFLLLLVEVVIIDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSVGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFPVPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPYKSTPNTEIPVLCSNEYMDSERESLQLISTSRSLDRHQLNRSENDYEIIKAANLPLKRNIKRELSLIRQ 1012          
BLAST of Protocadherin-1-like vs. Planmine SMEST
Match: SMESG000066263.1 (SMESG000066263.1)

HSP 1 Score: 2023.05 bits (5240), Expect = 0.000e+0
Identity = 1004/1006 (99.80%), Postives = 1005/1006 (99.90%), Query Frame = 2
Query:   38 MIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFPVPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPYKSTPNTEIPVLCSNEYVDSERESLQLISTSRSLDRHQLNRSENDYEIIKAANLPLKRNIKRELSLIRQ 3055
            MIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQIFLLLLVEVVIIDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERS GLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFPVPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPYKSTPNTEIPVLCSNEY+DSERESLQLISTSRSLDRHQLNRSENDYEIIKAANLPLKRNIKRELSLIRQ
Sbjct:    1 MIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLSPFITSQIFLLLLVEVVIIDKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSVGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFPVPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPYKSTPNTEIPVLCSNEYMDSERESLQLISTSRSLDRHQLNRSENDYEIIKAANLPLKRNIKRELSLIRQ 1006          
BLAST of Protocadherin-1-like vs. Planmine SMEST
Match: SMESG000023518.1 (SMESG000023518.1)

HSP 1 Score: 218.009 bits (554), Expect = 2.909e-58
Identity = 232/837 (27.72%), Postives = 386/837 (46.12%), Query Frame = 2
Query:   92 VSVTYRIEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKI----CQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLF--PQRTINVYLSLKKEGPSSM---ILPNATDKDIGINSVINYKLLNHTN-----FIQIKPSHSGLNLSIININKAAEYFL--------------HSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNK-QINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDRE-EQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLS---HGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTV--YIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQG----SANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            ++ TY + EEQ   I +GN+  D +++++ + +    Q     L FFP SQ + K++ +   S+++Q+  LV   ++DRE++C    F+     SKI    C C  +    + IC  +  ++L  F   +  +++ + V++ D NDNPP+F  P  TI +    +++ PS      +P A D+DI +N+ I Y+L NH +     +IQI        L  ++  K  +Y +               S  L++ I+ IN  +P F+              ESL+L S       + E   +G  I  +    N    N K +        +  A     I K  G I     LDRE  ++ H   +V+  G      S + +++ I D+NDN P I    +        I ENR   ST+  +   D D G +    CD ++      F +  +  E  T    S   ++ L    ILDRE  S +S+ I C+D G   L++S  I + + D NDN P F ++ ++I   E+    S +L + A+D D       +++ I   +++  F IN+ SGD+Y   ++D+E    I I +   D+G P S +    V+ T+ D+ND  P L +SY++   +AE++P  + V ++   D DTG GG+V   +   +        ++ T + FDRE    Y+I++  +D G P LT+S  + I I D+NDN P       S G    +  IS SY+E     +  +   D D   N ++  T+F +   K  F ++  SG + L ST    +L   F L +   D+GTP R  S   + + +VD
Sbjct:   26 INFTYSMNEEQDPPIYLGNIIHDLRLDKVLSLK----QLEENTLTFFPWSQASSKFYMIYKDSANSQK--LVLQKKVDREKLCQ---FQHTLSKSKIFSSGCICNMEN--DNKICFMLISLSLLEF--QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIK---EEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSK-------------ESLNLIS-----VFISEQAKIGQKIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMA-LTVIINDENDNAPFIECPENFI------IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT--FMINQTSGDLYQIEAIDFERHKQITITIGCKDQGSP-SFTTTAYVHVTIKDMNDVPPSL-VSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQETIGFSIATIYFHDDDINQNAQL--TYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTP-RLFSLLELIIHVVD 813          

HSP 2 Score: 90.8929 bits (224), Expect = 3.470e-18
Identity = 95/393 (24.17%), Postives = 175/393 (44.53%), Query Frame = 2
Query: 1040 IKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ----------LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFV 2173
            + TT  LDRE  + + + ++        + ++  +SI + DQNDN P        F +   E+++ EN+   S++L L   D D G N  +         F I  ++  +   +  SG L  +      +D E     ++TI C D+G  S T++  + + I DMND PP         S  E +  G+ + T++  D D T    ++  ++   EN  +F    R+ ++      D E      I VI  D G P+ L+ ++++  T++DIND  P+L            + T+  +    I   + +I  HD D     ++ +FI +++  +F   P  G++K   +       S+ ++I  +D G P L S   + I ++D   ++P++ 
Sbjct:  455 LSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIP-------FFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLL-------YFIITNVDHTFMINQ-TSGDLYQIEA----IDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPD-TGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPR-LTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQETIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 822          
BLAST of Protocadherin-1-like vs. Planmine SMEST
Match: SMESG000023518.1 (SMESG000023518.1)

HSP 1 Score: 213.386 bits (542), Expect = 8.118e-57
Identity = 230/831 (27.68%), Postives = 382/831 (45.97%), Query Frame = 2
Query:  110 IEEEQSHHITVGNLYSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETYLVTISRIDREEICYDKVFESKSHNSKI----CQCKRKTPFHDPICSTVFHITLSPFITSQXXXXXXXXXXXXDKNDNPPLF--PQRTINVYLSLKKEGPSSM---ILPNATDKDIGINSVINYKLLNHTN-----FIQIKPSHSGLNLSIININKAAEYFL--------------HSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNK-QINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDRE-EQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLS---HGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLSYTV--YIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQG----SANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSANIFVQIVD 2485
            + EEQ   I +GN+  D +++++ + +    Q     L FFP SQ + K++ +   S+++Q+  LV   ++DRE++C    F+     SKI    C C  +    + IC  +  ++L  F   +  +++ + V++ D NDNPP+F  P  TI +    +++ PS      +P A D+DI +N+ I Y+L NH +     +IQI        L  ++  K  +Y +               S  L++ I+ IN  +P F+              ESL+L S       + E   +G  I  +    N    N K +        +  A     I K  G I     LDRE  ++ H   +V+  G      S + +++ I D+NDN P I    +        I ENR   ST+  +   D D G +    CD ++      F +  +  E  T    S   ++ L    ILDRE  S +S+ I C+D G   L++S  I + + D NDN P F ++ ++I   E+    S +L + A+D D       +++ I   +++  F IN+ SGD+Y   ++D+E    I I +   D+G P S +    V+ T+ D+ND  P L +SY++   +AE++P  + V ++   D DTG GG+V   +   +        ++ T + FDRE    Y+I++  +D G P LT+S  + I I D+NDN P       S G    +  IS SY+E     +  +   D D   N ++  T+F +   K  F ++  SG + L ST    +L   F L +   D+GTP R  S   + + +VD
Sbjct:    1 MNEEQDPPIYLGNIIHDLRLDKVLSLK----QLEENTLTFFPWSQASSKFYMIYKDSANSQK--LVLQKKVDREKLCQ---FQHTLSKSKIFSSGCICNMEN--DNKICFMLISLSLLEF--QEGMIIVTIRVIVNDINDNPPIFQLPNFTIMIK---EEQAPSDWNYQSIPIAIDQDIELNAKILYRLTNHKDKFTIKYIQIANELKIAPLQTLDREKKDKYLIIIEAIDCGKPDSLSGSLNLTVNIIDINDSQPRFSK-------------ESLNLIS-----VFISEQAKIGQKIATIFAHDNDIGNNSKLQFSLNEKLTDSYAMEHFFINKSTGAIHVWNELDREIYESVHLFVIVSDCGSPPRSNSMA-LTVIINDENDNAPFIECPENFI------IEENRGELSTVGFIKAFDMDSGASSNCSCDLINIKPTNSFKLSNVTLESTTYIKKSIVFTFELSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIPFFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLLYFIITNVDHT--FMINQTSGDLYQIEAIDFERHKQITITIGCKDQGSP-SFTTTAYVHVTIKDMNDVPPSL-VSYSMNPSVAEHMPKGTVVQTLSVIDPDTGPGGEVSVALLPWENKFVFRNLNLLTNLEFDREINDKYSILVILRDNGQPRLTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQETIGFSIATIYFHDDDINQNAQL--TYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGS-FRLVIKVQDNGTP-RLFSLLELIIHVVD 782          

HSP 2 Score: 90.8929 bits (224), Expect = 3.094e-18
Identity = 95/393 (24.17%), Postives = 175/393 (44.53%), Query Frame = 2
Query: 1040 IKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKK--EVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQ----------LSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISDTQ--FFSCSP-YGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFV 2173
            + TT  LDRE  + + + ++        + ++  +SI + DQNDN P        F +   E+++ EN+   S++L L   D D G N  +         F I  ++  +   +  SG L  +      +D E     ++TI C D+G  S T++  + + I DMND PP         S  E +  G+ + T++  D D T    ++  ++   EN  +F    R+ ++      D E      I VI  D G P+ L+ ++++  T++DIND  P+L            + T+  +    I   + +I  HD D     ++ +FI +++  +F   P  G++K   +       S+ ++I  +D G P L S   + I ++D   ++P++ 
Sbjct:  424 LSTTSILDRENISTYSLVILCHDNGSPRLSNSKLISILVSDQNDNIP-------FFHRSNFEIQVVENKVNLSSVLKLKASDNDIGINADLL-------YFIITNVDHTFMINQ-TSGDLYQIEA----IDFERHKQITITIGCKDQGSPSFTTTAYVHVTIKDMNDVPPSLVSYSMNPSVAEHMPKGTVVQTLSVIDPD-TGPGGEVSVALLPWENKFVF----RNLNLLTNLEFDREINDKYSILVILRDNGQPR-LTNSILLTITISDINDNRPRLTHLIGSPGVKISNQTISFSYQETIGFSIATIYFHDDDINQNAQLTYFIHESEKPYFILHPDSGNLKLNSTCSVSDLGSFRLVIKVQDNGTPRLFSLLELIIHVVDGPSSNPDYA 791          
BLAST of Protocadherin-1-like vs. Planmine SMEST
Match: SMESG000074162.1 (SMESG000074162.1)

HSP 1 Score: 211.075 bits (536), Expect = 7.516e-56
Identity = 213/785 (27.13%), Postives = 352/785 (44.84%), Query Frame = 2
Query:  506 DKNDNPPLFPQRTINVYLSLKKEGPSSMILPNATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLS-IININKAAEYFLHSQPLSIKILAINTEK---------------PFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKS---NKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFC--DCLSHGQFAIEPLNKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLS-GNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKV-IHFISDT--------------------------QFFSCSPYGDIKTKIS-FDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKIFSLKVIAHDHGTPERRKSSA-NIFVQIVDIEPIL----KVKRTIDFSRIPVSFFDKKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQ 2695
            D NDN P + Q  +    S   E   S  L  A D D G N +  Y          I P  +   LS IIN N    Y    Q   +    ++ EK               P FN ++ + + + +    S  +F + +Y   V EN+   T +  +QLK+   + ++N K + +  S T    A LF  I  + G I     LD E      + V A    +    ST TV I I D NDN P+I  + S F     +I EN      +     +D D  ENG + C  + +++ +F++E +N        +S   S+        DRE  S  +  I C+D+G    T+S ++ + + D+ND  P F +  Y     ED++ G+++ T+NATD D    N+ + YSI   +++ +FSI++  G ++L + LD E+   +   + A+D G+PK LS  NV V   V DIND +P L  S  +Y+ EN      +  +   D+D G   +  +  +S+T                            FS  P G +  + S  DRE  + Y I+I A D GNP  ++   I+I +LDVND  P+F+F  PS  ++ + +  R  S + + ++   D DEG N ++ ++F       D+F +N  SG I L  T  + +    + L V+  D+G P    ++   I ++ ++ + IL    K+K  +++S      FD + ++               + ++ A  L +I+MS+ T+++ VC K +
Sbjct:  157 DINDNSPFWSQNELVTQFSEGSEIGDSKSLTVALDNDFGTNGISYY---------SISPEITEFELSYIINTNTMM-YSNKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNS-PVFEKAVYIISVNENLQSNTPV--IQLKAIDADSEMNGKIEYQISSLTKPEYAKLF-SIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRF-TNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEEFSLERMNIPLTVMYKISTLKSF--------DREQKSKVTAHIVCFDEGNPRQTTSGSVSVGVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEG-INALLSYSIF-GKDAKIFSISKLDGKVFLETDLDRESVESLHFTIRAADSGYPKQLSTANVTV--IVKDINDNYPFLPKSIYLYVFENHTADVPLVQVNVTDADEGLNSETKVTLVSETATTLIKRKDEYPIQKLFRDVTKSFSNSLFSLLPDGKLIIRESGLDRELTTKYEIVIEATDRGNPPKSTKGIIYINVLDVNDCKPKFIF--PSGSNSTVKVKPRTVSGTTIAQIIAIDEDEGKNSELEYSFKSNNQTNDLFLMNPESGKISLQQTIQESHKVCCYVLIVVVKDNGIPRLEDTARLRIIIESINGDSILSKENKMKDNVEYSNEESDNFDFRINNNV----------VIIIVLICAAALFIIMMSLATSLL-VCRKFK 901          

HSP 2 Score: 95.1301 bits (235), Expect = 1.492e-19
Identity = 107/356 (30.06%), Postives = 168/356 (47.19%), Query Frame = 2
Query: 1499 VTIKLRILDMNDNPPVFPKNFYQISYPEDLEIG-SHILTVNATDLDATRTNSQIFYSIRK-----------SENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFPKSLSGNVIVYFTVTDINDCFPQLQLS-YTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIHFISD------TQFFSC-SPYGDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKVSCKDIDEGDNGKIIFTFFEYLLRKDIFF--INSSSGIIYLTSTPGKYNLKKIFSLKVIAH----DHGTPERRKSSANIFVQIVDI 2488
            + + + + D+NDN P + +N     + E  EIG S  LTV A D D   TN   +YSI             + N+ ++S N+    + L   LD E        V A D G P S +G++ V   VTD ND  P  + + Y + + ENL   + V  + A D+D+   GK+ + IS        + FS  S  G I  +   D ET ++ ++I+ A DMGN    S+ ++ I I D+NDN PE  F  PS+ + N  I+  E     +   S +D D  +NGK+     E +  ++     +N    ++Y  ST   ++ ++    KV AH    D G P R+ +S ++ V + DI
Sbjct:  149 IVLVIEVKDINDNSPFWSQNELVTQFSEGSEIGDSKSLTV-ALDNDFG-TNGISYYSISPEITEFELSYIINTNTMMYS-NKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNP-SFNGSIKVIVAVTDENDNSPVFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKIEYQISSLTKPEYAKLFSIESNSGYIHVRWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYF-EPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVT-CHLEPIANEEFSLERMNIPLTVMYKISTLKSFDREQ--KSKVTAHIVCFDEGNP-RQTTSGSVSVGVEDI 495          

HSP 3 Score: 83.1889 bits (204), Expect = 8.269e-16
Identity = 135/562 (24.02%), Postives = 236/562 (41.99%), Query Frame = 2
Query:  677 KPSHSGLNLSIININKAAEYFLHSQPLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENINVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTTGFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSSIFEKKE--VEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPLNK-EYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSVTIKLRILDMNDNPPVF---PKNFYQISYPEDLEIGSHILTVNATDLDATRTNSQIFYSIRKSENSDLFSINERSG-------DIYLTSSLDYETCTYIVINVIASDRGFPK-SLSGNVIVYFTVTDINDCFPQL-QLSYTVYIAENLPIQSHVTSIVAHDSDTGFGGKVIH--FISDTQFFSCSPY-GDIKTKISFDRETRSSYTIIIYAKDMGNPSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSE--LTKVSCKDIDEGDNGKIIFTF 2302
            K +   L+L+I    K+ + F H   L I++  IN   PF++    +  F      E  ++   K     ++ +     +       S   I+P+    + S  +  +  ++    K    +     LDRE+ +++   V A  G +     +  V + + D+NDN P       +FEK    + + EN   ++ ++ L   D D   NG I        ++ I  L K EY     +     Y+ + R  LD E  +  S+ +   D G +   S+ T+ + I D+NDN P     P  F   +   + E    ++ V +     +  N ++   +    N + FS+ ER          I    S D E  + +  +++  D G P+ + SG+V V   V DIND  P   + SY  ++ E++   +++ +I A D D G    + +  F  D + FS S   G +  +   DRE+  S    I A D G P   S++++ + + D+NDN P   F P S     I +   E  +++  L +V+  D DEG N +   T 
Sbjct:  129 KNNQCNLDLTI----KSDDDFSHIIVLVIEVKDINDNSPFWSQNELVTQF-----SEGSEIGDSKSLTVALDNDFGTNGI-------SYYSISPEITEFELSYIINTNTMMYS--NKEQLKLVLKKKLDREKIDKYEFIVNAFDGGNPSFNGSIKVIVAVTDENDNSP-------VFEKAVYIISVNENLQSNTPVIQLKAIDADSEMNGKI--------EYQISSLTKPEYAKLFSIESNSGYIHV-RWELDYETYTTISLIVEANDMGNLRRGSTCTVIINIRDLNDNSPEIYFEPSRFTNNAKITENEAPGKLVAVFSVQDKDSNENGKVTCHLEPIANEE-FSL-ERMNIPLTVMYKISTLKSFDREQKSKVTAHIVCFDEGNPRQTTSGSVSV--GVEDINDEAPHFSEKSYIFHVNEDVKPGTYLFTINATDKDEGINALLSYSIFGKDAKIFSISKLDGKVFLETDLDRESVESLHFTIRAADSGYPKQLSTANVTVIVKDINDNYP---FLPKS-----IYLYVFENHTADVPLVQVNVTDADEGLNSETKVTL 644          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH91.392e-5626.69protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH95.454e-5626.81protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH96.515e-5626.81protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH99.670e-5626.81protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11Y1.305e-5426.81protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.564e-4428.59FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.682e-4428.59FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-12.807e-3224.18CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-46.491e-2424.00Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-15.237e-2126.06Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds2.369e-4726.30gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.369e-4726.30gene:FBgn0284247 transcript:FBtr0343249[more]
stan8.915e-4425.25gene:FBgn0024836 transcript:FBtr0339463[more]
stan9.955e-4425.25gene:FBgn0024836 transcript:FBtr0303223[more]
stan9.955e-4425.25gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a2.709e-5828.31protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a5.089e-5828.31protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh113.261e-5728.07protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.857e-5728.07protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh7b7.216e-5526.24protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa7.902e-5527.41VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
pcdh173.528e-5327.21protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh176.524e-5327.21protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh177.664e-5327.21protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.531e-5226.75protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh97.892e-5726.69protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh97.160e-5626.81protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh98.433e-5626.81protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh98.433e-5626.81protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.115e-5526.81protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN4.644e-5526.81Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q9BZA8|PC11Y_HUMAN2.341e-5326.48Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|O35161|CELR1_MOUSE5.963e-5327.79Cadherin EGF LAG seven-pass G-type receptor 1 OS=M... [more]
sp|Q6X862|PC11X_GORGO1.037e-5126.19Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WYY1|PC11X_PANPA8.012e-5126.05Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin-1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GT963.998e-6427.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2I0LQM71.313e-6026.42Protocadherin gamma-B1 OS=Columba livia OX=8932 GN... [more]
A0A3Q2P1361.274e-5627.15Uncharacterized protein OS=Fundulus heteroclitus O... [more]
A0A1A8H3W12.741e-5626.80Protocadherin 1a (Fragment) OS=Nothobranchius kort... [more]
A0A1A7WNY84.765e-5626.40Protocadherin 1a OS=Iconisemion striatum OX=60296 ... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a4.011e-5728.21protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a4.918e-5727.93protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b1.253e-5626.61protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh112.321e-5527.65protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh97.163e-5525.99protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006996.11.343e-5128.72pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
pcdh111.338e-4625.48protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.17.607e-4626.98pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.16.370e-4224.19pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006212.11.803e-3930.48pep scaffold:Pmarinus_7.0:GL476841:227071:229326:-... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.628e-5130.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482371.582e-4828.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417672.908e-4826.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348153.853e-4827.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333581.239e-4531.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1b1.115e-5729.33protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b2.213e-5729.33protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1a5.956e-5727.85protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a6.137e-5727.85protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh99.327e-5626.39protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin-1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066263.10.000e+099.80SMESG000066263.1[more]
SMESG000066263.10.000e+099.80SMESG000066263.1[more]
SMESG000023518.12.909e-5827.72SMESG000023518.1[more]
SMESG000023518.18.118e-5727.68SMESG000023518.1[more]
SMESG000074162.17.516e-5627.13SMESG000074162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034986 ID=SMED30034986|Name=Protocadherin-1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=3055bp
GTTGGAAATAAACTGCCATATGTCATTGAAATTAATGATGATTATCGGTT
TGTTTCTATGTAAAAACTATTACTTTTTAATATTTCACAACGTTTCTGTT
ACATATCGGATCGAGGAAGAACAATCACATCATATAACGGTTGGGAATTT
ATATTCCGATTTTAAAATTGAACAGATTGCAGCAAATAGGAATTGTTCTT
ATCAAAAAAATCTCTGCCAGTTAATGTTCTTTCCATCCTCACAGCCAGCT
CGGAAATATTTTGGGCTCATTTCTACTTCGTCTCATGCTCAAGAGACTTA
CCTTGTTACAATATCAAGAATAGATCGAGAAGAAATTTGTTATGATAAAG
TCTTTGAATCCAAATCACACAATTCCAAAATATGCCAATGTAAAAGAAAA
ACGCCTTTTCACGATCCAATCTGCTCGACTGTGTTCCACATAACCCTTTC
ACCCTTTATTACGAGTCAGATCTTTCTTTTATTATTGGTCGAAGTGGTTA
TAATAGATAAAAATGACAATCCACCATTATTTCCTCAAAGAACCATAAAT
GTTTATTTGAGTCTAAAAAAGGAGGGTCCTTCCTCAATGATTCTCCCGAA
TGCTACAGATAAAGACATTGGTATCAACAGTGTAATTAATTATAAACTCT
TAAATCATACGAATTTCATCCAAATTAAACCGTCTCATTCGGGACTCAAT
CTTTCTATTATTAATATCAACAAAGCAGCTGAGTACTTTTTACACAGTCA
GCCTTTGTCAATTAAAATCTTAGCAATAAACACAGAAAAACCATTTTTTA
ATGACACTTTAACCATACGGTTATTCATTGACAATGCCATTCCAGAATCT
TTGGATTTGTTCAGTCAAAAAATTTACTTTTTCAAAGTCGAAGAAAACAT
CAATGTGGGAACAGTTATTGGAAGAGTCCAACTGAAAAGTAACAAACAAA
TAAATCCAAAATTTAAAATAGAAAAATGTTCAAACACCTTAGAAAGATCT
GCTGGTTTGTTTTTGGAAATCGGGAAGCATGATGGGGTCATTAAAACTAC
AGGATTCTTAGATAGAGAAGAACAAAATCAGCATTGTGTAGAAGTCGTTG
CAGCTATAGGAGATCACAAGGAGGTTTACAGTACCTCTACGGTTTCTATA
AAAATATTAGATCAAAATGATAACTACCCTAAAATTGGTTTAGATTCGTC
AATTTTCGAGAAAAAAGAAGTGGAAATTCCGGAAAATCGTCCAATAGACA
GCACTATATTGACACTATTTCCAGAGGATCCCGACGAAGGAGAAAATGGA
ACTATCTTCTGTGACTGTCTTTCTCATGGACAATTTGCCATAGAACCACT
TAATAAAGAATATCAAACTACCAAGGATTTGTCAGGAAGACTTTCGTACG
TTTTAATGAATCGAATAATTTTAGATCGAGAAATATCCAGTTATTTTTCG
GTGACGATTTTTTGTTATGATAAAGGTAAAATATCTCTTACTTCGAGTGT
GACAATAAAATTACGCATTCTTGATATGAATGACAACCCGCCGGTTTTTC
CGAAAAACTTTTACCAAATTTCTTATCCCGAAGACTTAGAGATTGGCTCA
CATATTCTTACTGTCAACGCTACAGATCTTGATGCGACCAGGACTAATTC
ACAGATATTTTATTCCATACGAAAATCGGAAAATTCAGATTTATTTTCAA
TAAATGAAAGAAGTGGAGATATCTATTTAACTAGTTCACTGGACTATGAA
ACTTGTACGTATATTGTGATAAATGTTATCGCCAGTGACAGAGGGTTTCC
TAAGTCATTGTCTGGCAATGTCATCGTTTATTTTACTGTAACCGACATCA
ATGACTGCTTTCCTCAATTACAGCTATCTTATACAGTTTACATTGCAGAA
AACCTACCAATTCAGTCTCATGTGACTTCAATAGTCGCCCATGATTCCGA
TACAGGTTTTGGTGGAAAGGTTATCCATTTCATTTCTGACACTCAATTCT
TTTCTTGTTCTCCTTATGGAGATATTAAGACGAAAATTTCATTTGATAGA
GAAACCAGAAGTTCATACACAATAATTATATATGCTAAAGATATGGGAAA
TCCTAGTTTAACAAGCAGTTCATCTATATTTATCAAAATTCTAGACGTAA
ATGACAATGATCCAGAGTTTGTTTTTCCACCACCTTCACAAGGATCAGCT
AACATTTCTATATCTTACAGAGAACAGTCTTCAAGTGAATTAACTAAAGT
ATCCTGTAAGGATATTGATGAAGGAGATAACGGGAAAATCATATTCACAT
TTTTTGAGTATCTCTTACGAAAAGACATATTTTTTATCAACTCCTCTAGC
GGAATAATATATCTTACCAGTACTCCTGGAAAATACAACCTGAAAAAAAT
ATTCTCATTAAAAGTAATAGCCCATGACCATGGAACTCCAGAGCGACGAA
AATCCTCTGCAAATATTTTTGTTCAAATTGTCGATATAGAACCGATTTTA
AAAGTTAAAAGAACAATTGACTTTTCACGAATTCCAGTTTCTTTTTTCGA
CAAAAAAAAATCTGATTTATCTGAATTTTCGAGATTTTTTTGGAATATTG
AGCACAGCGCGGTAACAATGGTGTTGGCAGGAATTTTAATTGTGATAATT
ATGAGTATTTTAACAGCGGTCGTATATGTCTGTCATAAAATCCAATTTCC
GGTTCCGGGCACTGAGAGAACTAACGTGTCCAGCTTGTCAGCTCATTTGG
TCTCTAACGAAAGATCAGGCGTAACAATTACTTGGCGCCACAGAATCAAG
ACCCCGTCTGTAAAATGGAAGTGCATGGCGTCAATGCTTCATATACCGTA
CAAATCTACTCCGAATACAGAAATTCCAGTATTGTGTTCAAATGAATATG
TGGACTCGGAGAGAGAATCATTGCAGCTAATCAGTACTTCACGGAGTCTT
GATAGACACCAATTAAATCGGAGTGAAAATGATTATGAAATTATCAAAGC
AGCCAATTTACCTTTAAAAAGGAATATCAAGAGGGAGTTATCATTAATAC
GGCAG
back to top

protein sequence of SMED30034986-orf-1

>SMED30034986-orf-1 ID=SMED30034986-orf-1|Name=SMED30034986-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1018bp
LEINCHMSLKLMMIIGLFLCKNYYFLIFHNVSVTYRIEEEQSHHITVGNL
YSDFKIEQIAANRNCSYQKNLCQLMFFPSSQPARKYFGLISTSSHAQETY
LVTISRIDREEICYDKVFESKSHNSKICQCKRKTPFHDPICSTVFHITLS
PFITSQIFLLLLVEVVIIDKNDNPPLFPQRTINVYLSLKKEGPSSMILPN
ATDKDIGINSVINYKLLNHTNFIQIKPSHSGLNLSIININKAAEYFLHSQ
PLSIKILAINTEKPFFNDTLTIRLFIDNAIPESLDLFSQKIYFFKVEENI
NVGTVIGRVQLKSNKQINPKFKIEKCSNTLERSAGLFLEIGKHDGVIKTT
GFLDREEQNQHCVEVVAAIGDHKEVYSTSTVSIKILDQNDNYPKIGLDSS
IFEKKEVEIPENRPIDSTILTLFPEDPDEGENGTIFCDCLSHGQFAIEPL
NKEYQTTKDLSGRLSYVLMNRIILDREISSYFSVTIFCYDKGKISLTSSV
TIKLRILDMNDNPPVFPKNFYQISYPEDLEIGSHILTVNATDLDATRTNS
QIFYSIRKSENSDLFSINERSGDIYLTSSLDYETCTYIVINVIASDRGFP
KSLSGNVIVYFTVTDINDCFPQLQLSYTVYIAENLPIQSHVTSIVAHDSD
TGFGGKVIHFISDTQFFSCSPYGDIKTKISFDRETRSSYTIIIYAKDMGN
PSLTSSSSIFIKILDVNDNDPEFVFPPPSQGSANISISYREQSSSELTKV
SCKDIDEGDNGKIIFTFFEYLLRKDIFFINSSSGIIYLTSTPGKYNLKKI
FSLKVIAHDHGTPERRKSSANIFVQIVDIEPILKVKRTIDFSRIPVSFFD
KKKSDLSEFSRFFWNIEHSAVTMVLAGILIVIIMSILTAVVYVCHKIQFP
VPGTERTNVSSLSAHLVSNERSGVTITWRHRIKTPSVKWKCMASMLHIPY
KSTPNTEIPVLCSNEYVDSERESLQLISTSRSLDRHQLNRSENDYEIIKA
ANLPLKRNIKRELSLIRQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030426growth cone
GO:0044291cell-cell contact zone
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0030900forebrain development
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 400..429
score: 24.1
coord: 514..527
score: 35.78
coord: 570..596
score: 30.1
coord: 495..514
score: 38.98
coord: 336..355
score: 26.46
coord: 705..722
score: 41.98
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 538..621
e-value: 1.7E-19
score: 80.8
coord: 644..721
e-value: 9.1E-20
score: 81.7
coord: 750..831
e-value: 5.7E-5
score: 32.5
coord: 303..393
e-value: 0.0024
score: 27.1
coord: 422..514
e-value: 1.3E-4
score: 31.3
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 406..506
e-value: 2.6E-8
score: 34.2
coord: 627..713
e-value: 8.8E-12
score: 45.3
coord: 521..614
e-value: 9.6E-19
score: 67.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 32..169
e-value: 1.6E-6
score: 30.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 393..511
e-value: 2.8E-17
score: 65.2
coord: 620..719
e-value: 5.5E-21
score: 77.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 512..619
e-value: 3.5E-28
score: 100.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 720..830
e-value: 8.7E-16
score: 60.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 284..392
e-value: 1.2E-14
score: 56.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 171..278
e-value: 4.3E-8
score: 35.7
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 17..584
NoneNo IPR availablePANTHERPTHR24028:SF249CADHERIN-3coord: 17..584
NoneNo IPR availablePANTHERPTHR24028:SF249CADHERIN-3coord: 576..1000
coord: 471..829
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 576..1000
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 471..829
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 288..395
score: 14.869
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 517..623
score: 22.629
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 623..723
score: 23.133
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 401..516
score: 18.289
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 729..847
score: 11.712
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 291..391
e-value: 8.22829E-15
score: 68.8793
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 626..719
e-value: 9.92833E-25
score: 97.3841
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 406..512
e-value: 9.38895E-16
score: 71.5757
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 745..829
e-value: 6.81087E-12
score: 60.7901
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 521..618
e-value: 6.40631E-26
score: 100.466
NoneNo IPR availableTMHMMTMhelixcoord: 871..893
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 504..514
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 711..721
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 165..175
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 505..623
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 389..508
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 286..401
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 711..830
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 165..276
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 612..725