Protocadherin gamma

Overview
NameProtocadherin gamma
Smed IDSMED30034969
Length (bp)3466
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin gamma (SMED30034969) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin gamma (SMED30034969) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin gamma (SMED30034969) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin gamma (SMED30034969) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034969

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30034969SMESG000005850.1 SmedASXL_015881SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30034969SMESG000005850.1 dd_Smed_v6_17255_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30034969SMESG000005850.1 OX_Smed_1.0.10885ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
headSMED30034969SMESG000005850.1 OX_Smed_1.0.14954ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 223.787 bits (569), Expect = 3.479e-59
Identity = 212/778 (27.25%), Postives = 352/778 (45.24%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQI-----NNDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDH---LYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            + + E QP  T +G +       D    Y   +      +D K+GDI T +  ID E L  C N     +   +   V++    Q     +++  I + DI+DN P F  P  T+ I E  +  ++   +P A D+D +  N   +Y +     A  L      E+   + P+L ++ ++D E+   Y  T+          +++  + + V++ ND AP+F +  YE  + E+  +   +I+V A D+D G N  + Y         +       N G + +   +D E   +  F++ A D       A +++ +TV D+ND  P+  +    LV  +   + I         V  + V DRD    N  + C         LR +  +  +D    Y L T   LD E + D  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENN  G  + +  A+D D G NA + Y+++      GLF I   TG +++   LDRE++  Y L +VA D+     + G+  + + VLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA++   +  D+   + Q    N TG++ S+  FDRE++S    Q++  D  +    +++V V +N+LDENDN P I                   T  SN  + + ++ + ++G  ++ V A D D    ++L Y +       L    F I   SG IT+ + + R   GL ++ V V D G P
Sbjct:   62 YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLP-GDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSL-FPIPLASDRD-AGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDE-GENAAVTCVVAGDVPFQLR-QASETGSDSKKKYFLQTTTPLDYEKVKDYTI--EIVAVDSGNPPLSSTN-SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQ-GTATVLVNVLDCNDNDPKFMLSGY-NFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGV-PPRSAYVGVTINVLDENDNAPYI-------------------TAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGL----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 800          

HSP 2 Score: 137.887 bits (346), Expect = 2.957e-32
Identity = 144/493 (29.21%), Postives = 221/493 (44.83%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-----LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQ------LYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS--VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P++      L I E    G L       DRD+     G+   E     +A     L++ +DQ      LI     + +LDRE          +  YD  IK Q        ++  + + V D NDNAP F    Y+  + EN+ IG+ + Q +A D D G NA I Y    +  V   L  +D  TG + +  P+DRE  +    +++A D+  +  KS   Q+ +TV D NDNAP  E+R      + D   +I E++     +  +   D+DEGENA +   ++ D  +Q    ++TGS       L +    D EK      +I   DS  GN  L+S  S+ V ++D NDN P               +F  + TE       V      K G VIA + A+D D  + ++L Y LE    E   + +F I  ++G+I +   L R+     ++KV+  D G PSL+   T++V +LD
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGP--NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLI----VMGNLDRE---------RWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNP-KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS--GNPPLSSTNSLKVQVVDVNDNAP---------------VFTQSVTE-------VAFPENNKPGEVIAEITASDADSGSNAELVYSLE---PEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLD 604          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 223.402 bits (568), Expect = 9.283e-59
Identity = 212/778 (27.25%), Postives = 351/778 (45.12%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQI-----NNDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDH---LYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            + + E QP  T +G +       D    Y   +      +D K+GDI T +  ID E L  C N     +   +   V++    Q     +++  I + DI+DN P F  P  T+ I E  +  ++   +P A D+D    N   +Y +     A  L      E+   + P+L ++ ++D E+   Y  T+          +++  + + V++ ND AP+F +  YE  + E+  +   +I+V A D+D G N  + Y         +       N G + +   +D E   +  F++ A D       A +++ +TV D+ND  P+  +    LV  +   + I         V  + V DRD    N  + C         LR +  +  +D    Y L T   LD E + D  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENN  G  + +  A+D D G NA + Y+++      GLF I   TG +++   LDRE++  Y L +VA D+     + G+  + + VLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA++   +  D+   + Q    N TG++ S+  FDRE++S    Q++  D  +    +++V V +N+LDENDN P I                   T  SN  + + ++ + ++G  ++ V A D D    ++L Y +       L    F I   SG IT+ + + R   GL ++ V V D G P
Sbjct:   62 YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLP-GDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSL-FPIPLASDRDAG-PNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDE-GENAAVTCVVAGDVPFQLR-QASETGSDSKKKYFLQTTTPLDYEKVKDYTI--EIVAVDSGNPPLSSTN-SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQ-GTATVLVNVLDCNDNDPKFMLSGY-NFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGV-PPRSAYVGVTINVLDENDNAPYI-------------------TAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGL----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 800          

HSP 2 Score: 138.272 bits (347), Expect = 2.966e-32
Identity = 144/494 (29.15%), Postives = 221/494 (44.74%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-----LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQ------LYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS--VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +I V D+ND  P++      L I E    G L       DRD+     G+   E     +A     L++ +DQ      LI     + +LDRE          +  YD  IK Q        ++  + + V D NDNAP F    Y+  + EN+ IG+ + Q +A D D G NA I Y    +  V   L  +D  TG + +  P+DRE  +    +++A D+  +  KS   Q+ +TV D NDNAP  E+R      + D   +I E++     +  +   D+DEGENA +   ++ D  +Q    ++TGS       L +    D EK      +I   DS  GN  L+S  S+ V ++D NDN P               +F  + TE       V      K G VIA + A+D D  + ++L Y LE    E   + +F I  ++G+I +   L R+     ++KV+  D G PSL+   T++V +LD 
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGP--NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLI----VMGNLDRE---------RWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNP-KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS--GNPPLSSTNSLKVQVVDVNDNAP---------------VFTQSVTE-------VAFPENNKPGEVIAEITASDADSGSNAELVYSLE---PEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDC 605          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDHGA12 (protocadherin gamma subfamily A, 12 [Source:HGNC Symbol;Acc:HGNC:8699])

HSP 1 Score: 197.593 bits (501), Expect = 1.968e-51
Identity = 174/559 (31.13%), Postives = 267/559 (47.76%), Query Frame = 1
Query:  223 TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHN----SRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYN-----IQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL---REYTDFSI-LENLP----IGHYIGTLIAFDKDEGENARIMFKL 1821
            T +F+++P+SG + T   ID E LC  +          LN+++  +   + +  + + + DI+DN P F + E  ++I E    + M   LP A D DI  KN   +Y +S  ++ F+L   N    S+ P L L   +D E++  +   L+A    D   +    + + V++ ND AP F++  Y  SV E+++L   ++ VNA D D G N       RY+       F+++ N G +  I +LD E+   +   +QA D   + A +K+ ITVLDVND  P  +L      + E +  G L+  + V D+DS    + I   + N      +LEK   +      Y L T   LDRE +P   I       D G    L T   I LNV D NDN P+FP + Y   + ENN  G  L    A D D  +NA ITY+     IQ +  S    I+S TG L  +   D E+     + ++A D   H   S +  L++ VLD NDNAPE+      TD S  +E  P     G+ +  ++A D+D G+NA + ++L
Sbjct:   72 TQLFALNPRSGSLVTAGRIDREELCMGAI------KCQLNLDILMEDK-VKIYGVEVEVRDINDNAPYFRESELEIKISENAATE-MRFPLPHAWDPDIG-KNSLQSYELS-PNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGN---LPFKLEKSYGN-----YYSLVTDIVLDREQVPSYNI--TVTATDRGTP-PLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNG-HPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRL 608          

HSP 2 Score: 114.39 bits (285), Expect = 4.264e-25
Identity = 104/356 (29.21%), Postives = 165/356 (46.35%), Query Frame = 1
Query: 1357 VHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG--LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTG----SLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL-ENSASENLQQSIFDIDKKSGKI----TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            V D NDNAP F   +Y+  V EN  +G QL    ATD D G NA + Y+ ++  D    +F +D  +G +  +  LD E+   Y + + A+D A +   S   ++ ITVLD NDNAPE+   +   S+ EN P G  I  L   D+D  EN +++  +  +    P  + K+     SL ++ V DRE+       +  +D      L++   + +N+ D NDN P                    + + S   Y+ + + R   G  +  V A D D    +Q++Y L EN+       S   I+  +G +    + +    RDL    +VKVM  D+GHP L S  ++ + +LD
Sbjct:  232 VLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGY---SARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGN---LPFKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPP-LSTETHISLNVADTNDNPP-------------------VFPQASYSAYIPENNPR---GVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDL----QVKVMARDNGHPPLSSNVSLSLFVLD 554          

HSP 3 Score: 114.005 bits (284), Expect = 5.966e-25
Identity = 152/591 (25.72%), Postives = 265/591 (44.84%), Query Frame = 1
Query:  706 NVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINNDG-------ELHLIQKLDFEKHQSFSFTIQATDGE---FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTG-WLKLMQP--LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE--YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMD-----HLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE-KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRP-LHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD-IPQ 2397
             V ++V +IND AP F ++  E  + E+ + +      +A D D G N    Y L P T++  I  +G       EL L + LD E+  +    + A+DG        +++++ VLD ND  P++     +  + E    G  +  +   D D   +N  ++ +    + +A ++ K   ++       + T+  LD E    G         D+           + + V D+NDNAP    +     V EN+  G  +      D+D  +N  +   IQ ++    F ++   G +  L+    LDRE+   Y +T+ A D+      S  T +++ V D NDN P   +  Y+ + I EN P G  + ++ A D D  ENA+I + L+ +      L   +++N  TG L++   FD E+   +  ++   D+     L+S+VS+ + +LD+NDN P+I             L+    T+ S     V+++ R  + G+++  V A D D    + LSY L  ++   L    F +   +G++   R  L RD +  Q + V V+D G P L +  T+ V + D IPQ
Sbjct:  118 GVEVEVRDINDNAPYFRESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYELSPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDE-GVNAEVRYSFRYVDDKAAQVFKLDCNSG-----TISTIGELDHEE--SGFYQMEVQAMDNA---GYSARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGNLP---FKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPL-STETHISLNVADTNDNPPVFPQASYSAY-IPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNG-HPPLSSNVSLSLFVLDQNDNAPEI-------------LYPALPTDGST---GVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGL----FSVGLHTGEVRTARALLDRDALK-QSLVVAVQDHGQPPLSATVTLTVAVADSIPQ 670          

HSP 4 Score: 110.538 bits (275), Expect = 5.983e-24
Identity = 122/467 (26.12%), Postives = 211/467 (45.18%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAY--RMSGDHSA--FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYIL------LPMT------NYFQINNDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALR---LEKDQMSTDILL---IYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAP--LFPS--SQYQVGVK---ENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLD 1683
            +I +++LD +DN P F +PE+   + E +     ++ +  A D D  + N E+ Y  R   D +A  F L+ ++     +  + ++D+E+   Y+  + A   ++   SA   V + V+++ND APE   T    SV E+     +I  +N  D D +    ++      LP        NY+ +  D        LD E+  S++ T+ ATD        E+ + + V D ND PP +        I E N  G+ +  +T  D D         C E    T +L    ++   +S+ + +      LY + S D E   D  +    +  D+G    L +N+S+ L V D NDNAP  L+P+  +    GV+    + + GY + +  A D D G+NA ++Y +  + + GLF +   TG ++  +  LDR+   Q +  +VA+        S +  LT+ V D
Sbjct:  227 RIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVV-NATDPDEGV-NAEVRYSFRYVDDKAAQVFKLDCNSGT---ISTIGELDHEESGFYQMEVQAM--DNAGYSARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGNLPFKLEKSYGNYYSLVTD------IVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPRGVSLVSVTAHDPD---------CEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRD--LQVKVMARDNG-HPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSL--VVAVQDHGQPPLSATVTLTVAVAD 666          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDHGA12 (protocadherin gamma subfamily A, 12 [Source:HGNC Symbol;Acc:HGNC:8699])

HSP 1 Score: 198.364 bits (503), Expect = 2.036e-51
Identity = 174/559 (31.13%), Postives = 267/559 (47.76%), Query Frame = 1
Query:  223 TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHN----SRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYN-----IQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL---REYTDFSI-LENLP----IGHYIGTLIAFDKDEGENARIMFKL 1821
            T +F+++P+SG + T   ID E LC  +          LN+++  +   + +  + + + DI+DN P F + E  ++I E    + M   LP A D DI  KN   +Y +S  ++ F+L   N    S+ P L L   +D E++  +   L+A    D   +    + + V++ ND AP F++  Y  SV E+++L   ++ VNA D D G N       RY+       F+++ N G +  I +LD E+   +   +QA D   + A +K+ ITVLDVND  P  +L      + E +  G L+  + V D+DS    + I   + N      +LEK   +      Y L T   LDRE +P   I       D G    L T   I LNV D NDN P+FP + Y   + ENN  G  L    A D D  +NA ITY+     IQ +  S    I+S TG L  +   D E+     + ++A D   H   S +  L++ VLD NDNAPE+      TD S  +E  P     G+ +  ++A D+D G+NA + ++L
Sbjct:   72 TQLFALNPRSGSLVTAGRIDREELCMGAI------KCQLNLDILMEDK-VKIYGVEVEVRDINDNAPYFRESELEIKISENAATE-MRFPLPHAWDPDIG-KNSLQSYELS-PNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDEGVNAEVRYSFRYVDDKAAQVFKLDCNSGTISTIGELDHEESGFYQMEVQAMDNAGYSARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGN---LPFKLEKSYGN-----YYSLVTDIVLDREQVPSYNI--TVTATDRGTP-PLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNG-HPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRL 608          

HSP 2 Score: 114.39 bits (285), Expect = 5.096e-25
Identity = 152/591 (25.72%), Postives = 265/591 (44.84%), Query Frame = 1
Query:  706 NVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINNDG-------ELHLIQKLDFEKHQSFSFTIQATDGE---FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTG-WLKLMQP--LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE--YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMD-----HLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE-KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRP-LHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD-IPQ 2397
             V ++V +IND AP F ++  E  + E+ + +      +A D D G N    Y L P T++  I  +G       EL L + LD E+  +    + A+DG        +++++ VLD ND  P++     +  + E    G  +  +   D D   +N  ++ +    + +A ++ K   ++  +      T+  LD E    G         D+           + + V D+NDNAP    +     V EN+  G  +      D+D  +N  +   IQ ++    F ++   G +  L+    LDRE+   Y +T+ A D+      S  T +++ V D NDN P   +  Y+ + I EN P G  + ++ A D D  ENA+I + L+ +      L   +++N  TG L++   FD E+   +  ++   D+     L+S+VS+ + +LD+NDN P+I             L+    T+ S     V+++ R  + G+++  V A D D    + LSY L  ++   L    F +   +G++   R  L RD +  Q + V V+D G P L +  T+ V + D IPQ
Sbjct:  118 GVEVEVRDINDNAPYFRESELEIKISENAATEMRFPLPHAWDPDIGKNSLQSYELSPNTHFSLIVQNGADGSKYPELVLKRALDREEKAAHHLVLTASDGGDPVRTGTARIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVVNATDPDE-GVNAEVRYSFRYVDDKAAQVFKLDCNSGTI-----STIGELDHEE--SGFYQMEVQAMDNA---GYSARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGNLP---FKLEKSYGNYYSLVTDIVLDREQVPSYNITVTATDRGTPPL-STETHISLNVADTNDNPPVFPQASYSAY-IPENNPRGVSLVSVTAHDPDCEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRDLQVKVMARDNG-HPPLSSNVSLSLFVLDQNDNAPEI-------------LYPALPTDGST---GVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGL----FSVGLHTGEVRTARALLDRDALK-QSLVVAVQDHGQPPLSATVTLTVAVADSIPQ 670          

HSP 3 Score: 111.694 bits (278), Expect = 3.239e-24
Identity = 122/467 (26.12%), Postives = 211/467 (45.18%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAY--RMSGDHSA--FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYIL------LPMT------NYFQINNDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALR---LEKDQMSTDILL---IYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAP--LFPS--SQYQVGVK---ENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLD 1683
            +I +++LD +DN P F +PE+   + E +     ++ +  A D D  + N E+ Y  R   D +A  F L+ ++     +  + ++D+E+   Y+  + A   ++   SA   V + V+++ND APE   T    SV E+     +I  +N  D D +    ++      LP        NY+ +  D        LD E+  S++ T+ ATD        E+ + + V D ND PP +        I E N  G+ +  +T  D D         C E    T +L    ++   +S+ + +      LY + S D E   D  +    +  D+G    L +N+S+ L V D NDNAP  L+P+  +    GV+    + + GY + +  A D D G+NA ++Y +  + + GLF +   TG ++  +  LDR+   Q +  +VA+        S +  LT+ V D
Sbjct:  227 RIRVMVLDANDNAPAFAQPEYRASVPENLALGTQLLVV-NATDPDEGV-NAEVRYSFRYVDDKAAQVFKLDCNSGT---ISTIGELDHEESGFYQMEVQAM--DNAGYSARAKVLITVLDVNDNAPEVVLTSLASSVPENSPRGTLIALLNVNDQDSEENGQVICFIQGNLPFKLEKSYGNYYSLVTD------IVLDREQVPSYNITVTATDRGTPPLSTETHISLNVADTNDNPPVFPQASYSAYIPENNPRGVSLVSVTAHDPD---------CEENAQITYSLAENTIQGASLSSYVSINSDTGVLYALSSFDYEQFRD--LQVKVMARDNG-HPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSL--VVAVQDHGQPPLSATVTLTVAVAD 666          
BLAST of Protocadherin gamma vs. Ensembl Human
Match: PCDHGA6 (protocadherin gamma subfamily A, 6 [Source:HGNC Symbol;Acc:HGNC:8704])

HSP 1 Score: 196.438 bits (498), Expect = 3.635e-51
Identity = 174/603 (28.86%), Postives = 286/603 (47.43%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRI--KFAKQIDEELSYSFGLIT----DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKN----MVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL----EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMT----NYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAE-SKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYN-----IQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL---REYTDFSI-LENLP----IGHYIGTLIAFDKDEGENARIMFKL 1821
            +++I E     +FVG I      +  E   +   +++     +FS++P++G + T   ID E LC    A      +S N+ V  +   +++  + + I+DI+DN P F K E  ++I E     +    M +Y     D D+ M + +  +++SG+ S F++    E H  + P L L   +D E +  YR  L+A    D   S+   + + V+++ND  P F++ +Y  SV E++ +   ++ V A D D      + Y  + +T      F +N   GE+     LD+E    +   ++A DG  + + +K+ IT+LDVND  P  ++      I E+   G ++    VFDRDS  +N  + C+     +    LEK   +      Y+L T  +LDRE +    +Y   +         L T   I LNV D NDN P FP S Y V V ENN  G  +F   A D D+ +NA ++Y+     +Q +  S    I+S TG L  ++  D E+     L + A D       S +  L++ VLD NDNAPE+      TD S  +E  P     G+ +  ++A D+D G+NA + ++L
Sbjct:   32 RYSIPEELEKGSFVGNIVKDLGLEPQELAEHGVRIVSRGRMQLFSLNPRNGSLVTAGRIDREELC----AQSPRCLVSFNILVEDK---LNLYPVEVEIVDINDNTPRFLKEELEVKILENAAPSSRFPLMEVY-----DPDVGMNSLQ-GFKLSGN-SHFSVDVQSEAHGPKYPELVLEGTLDREGEAVYRLVLTAMDGGDPVRSSVAQILVTVLDVNDNTPMFTQPVYRVSVPENLPVGTPVLAVTATDQDEGVHGEVTYSFVKITEKISQIFCLNVLTGEISTSANLDYEDSSFYELGVEARDGPGLRDRAKVLITILDVNDNVPEVVVTSGSRTIAESAPPGTVIALFQVFDRDS-GLNGLVTCSIP--RSLPFELEKSVGN-----YYRLVTNAALDREEV---FLYNITVTATDKGTPPLSTETIISLNVADTNDNPPTFPHSSYSVYVLENNPRGASIFSVNALDPDVDQNAQVSYSLAEDTLQGAPLSSYVSINSDTGILYALRSFDYEQLRDLQLWVTASDSG-DPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRL 608          

HSP 2 Score: 125.561 bits (314), Expect = 1.322e-28
Identity = 158/591 (26.73%), Postives = 267/591 (45.18%), Query Frame = 1
Query:  709 VTLQVVNINDCAPEFSKTIYEESVYEDISLDE--IIIKVNAVDADGDNLRYILLPMTNYFQINNDGELH--------LIQKLDFEKHQSFSFTIQATDGEFVAESKLK---ITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-----VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTG-WLKLM--QPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSI--LENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLY-QPLTV-----NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE-KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRP-LHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            V +++V+IND  P F K   E  + E+ +      +++V   D   ++L+   L   ++F ++   E H        L   LD E    +   + A DG     S +    +TVLDVND  P +     ++ + E    G  V  +T  D+D      V+ +  +K TE   +   L +   ++ST   L Y+  + + L  E   DG           G++ +    I+I     D+NDN P    +     + E+   G  +   Q  D D G N L+T +I  S+    F ++   G + +L+    LDRE+   Y +T+ A D+      S  T +++ V D NDN P    ++ +S+  LEN P G  I ++ A D D  +NA++ + L+ D L   PL+      + TG L++ + FD E+   +   +  SDS     L+S+VS+ + +LD+NDN P+I             L+    T+ S     V+++ R  + G+++  V A D D    + LSY L  ++   L    F +   +G++   R  L RD +  Q + V V+D G P L +  T+ V + D
Sbjct:  119 VEVEIVDINDNTPRFLKEELEVKILENAAPSSRFPLMEVYDPDVGMNSLQGFKLSGNSHFSVDVQSEAHGPKYPELVLEGTLDREGEAVYRLVLTAMDGGDPVRSSVAQILVTVLDVNDNTPMFTQPVYRVSVPENLPVGTPVLAVTATDQDEGVHGEVTYSF-VKITEKISQIFCLNVLTGEISTSANLDYEDSSFYELGVEAR-DG----------PGLRDRAKVLITI----LDVNDNVPEVVVTSGSRTIAESAPPGTVIALFQVFDRDSGLNGLVTCSIPRSLP---FELEKSVGNYYRLVTNAALDREEVFLYNITVTATDKGTPPL-STETIISLNVADTNDNPPTF-PHSSYSVYVLENNPRGASIFSVNALDPDVDQNAQVSYSLAEDTLQGAPLSSYVSINSDTGILYALRSFDYEQLRDLQLWVTASDSG-DPPLSSNVSLSLFVLDQNDNAPEI-------------LYPALPTDGST---GVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGL----FSVGLHTGEVRTARALLDRDALK-QSLVVAVQDHGQPPLSATVTLTVAVAD 666          

HSP 3 Score: 97.0561 bits (240), Expect = 9.060e-20
Identity = 115/462 (24.89%), Postives = 205/462 (44.37%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLI-------DIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADG--DNLRYILLPMTNYFQ----INNDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEK-DQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAP--LFPS--SQYQVGVK---ENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLD 1683
            SV +I++ +LD++DN P F +P + + + E +     V+ +  A D+D  + + E+ Y      S   + E  S+   L +L        ++DYE    Y   + A  ++   +     V + ++++ND  PE   T    ++ E      +I      D D   + L    +P +  F+    + N   L     LD E+   ++ T+ ATD        E+ + + V D ND PP++  +   + + E N  G  +  +   D D V  N  +  +      Q   L     +++D  ++Y L    S D E + D  ++      DSG    L +N+S+ L V D NDNAP  L+P+  +    GV+    + + GY + +  A D D G+NA ++Y +  + + GLF +   TG ++  +  LDR+   Q +  +VA+        S +  LT+ V D
Sbjct:  224 SVAQILVTVLDVNDNTPMFTQPVYRVSVPENLPVGTPVLAV-TATDQDEGV-HGEVTY------SFVKITEKISQIFCLNVLTGEISTSANLDYEDSSFYELGVEA--RDGPGLRDRAKVLITILDVNDNVPEVVVTSGSRTIAESAPPGTVIALFQVFDRDSGLNGLVTCSIPRSLPFELEKSVGNYYRLVTNAALDREEVFLYNITVTATDKGTPPLSTETIISLNVADTNDNPPTFPHSSYSVYVLENNPRGASIFSVNALDPD-VDQNAQVSYSLAEDTLQGAPLSSYVSINSDTGILYAL---RSFDYEQLRDLQLWVT--ASDSG-DPPLSSNVSLSLFVLDQNDNAPEILYPALPTDGSTGVELAPRSAEPGYLVTKVVAVDRDSGQNAWLSYRLLKASEPGLFSVGLHTGEVRTARALLDRDALKQSL--VVAVQDHGQPPLSATVTLTVAVAD 666          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 180.259 bits (456), Expect = 2.378e-45
Identity = 210/777 (27.03%), Postives = 347/777 (44.66%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQIDEELSYSFGLITD-----IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDI-SMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINND---GELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFV---IDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITV---LDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL-ENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + E+ PI+T +  +K +    + L YS     D     +F++D  SG+I   K +D E L      DK    ++    V+   T+ +   +V+ +LD+ DN P FEK  +  EI+E       V+ + A   +D+ S +N EI Y + G+ +  NL   N++   ++    +D E     R  + A  K      +   V + VV++ND AP F+   Y  ++ E+I++  +I  V A D D G N  + Y +   +    +  D   GE+ L +++D  K+   +  I+A DG   A S    L I V+D+ND  P+ I   + + ++E    G  VG++   D DS   N  IK +    E   +  +   + T  L          LDRET     +       D G    L T+ +I + + DINDNAP F   +Y V + E    G Q+   +A D D  ++  ITY I+   D  +F    I  +   L +   L R+  ++  + I A DQ       G  Q    V   +DD ++AP   ++     I E+ PIG+ + TL A D D G+NARI++ +     ++      +G +  +   DRE ++     +  SD A    L +   + V + D NDN PQ                   +T  S   Y   +S    VG     V A D D+     + Y+L E+S+S ++Q  +F +D+ SG + ++  L R+   +  + +   D G PSL +A  I + + D+
Sbjct:  174 LPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVL------DKHILKVTAYERVD--PTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFA---RDLDSGENGEIEYSL-GEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDS-GPNGIIKYSMEGSEDFIIDEDSGLIKTTKL----------LDRETTARYSL--KVTARDMGTP-SLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIE-EADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQ-------GGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFR--IDPSSGDISVSSDLDREDRATFSVIVTASDHA-SPPLNTSTQIEVILDDINDNSPQ-------------------FTSSS---YAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQ--LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDV 885          

HSP 2 Score: 158.688 bits (400), Expect = 9.760e-39
Identity = 207/776 (26.68%), Postives = 343/776 (44.20%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQ---IDEELSYSFGLITDI--FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPE--FTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD-NLRYIL----LPMTNYFQINNDGE-LHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS-LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG---LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKL------SMDHLYQPLTVNKTGSLFSNQVFDREKKS-KVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMV 2376
            TI EN  I   +  +K   +    + ++ YS    + I   +ID  +G++   + ID         A     T  +      Q  L S + + I ++DI+D+ P     +   T+E    I  +   +Y   A+D+D S  N  I Y M G    F ++E +      +LL   D E   +Y   ++A      S++ +  + + + +IND AP F K  Y  ++ E++     II + AVD D D  + Y +      + +   I + G  L +  +L  + H+     I ATD G       + + + DVN  P  +  +P  + I E +  G  V  +   D D     R +   ++   +Q  R+  D  S DI       +V S LDRE   D   ++  +         L T+  I + + DINDN+P F SS Y   + E+  +G    Q  A D DIG N ++ Y +  S  S    LF +D  +G L++   LDRE+    +L I A D+      S ++++T+T+ D NDNAP   + + D  I EN P+G  +GT++A D DEG+NA I F++       +  + +    N    + +   FD E K+ K   ++Q S       L+S V V +++ D NDN P +    KD   L+N  F+N           V+M+   ++GF    + A D D N  + L Y+LE       +  + + +K +GKI + +   R++      K  V D  +    + + I V
Sbjct:  383 TILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID---------AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---AIDED-SGPNGIIKYSMEGSED-FIIDEDSGLIKTTKLL---DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHK-VRVEISATDQGGLQGRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRI--DPSSGDI-------SVSSDLDRE---DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL-SAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ----LSSTVPVRIHVSDVNDNKPAL----KDFVILMNR-FDN-----------VQMA--RQIGF----IPAFDPDQN--ATLEYFLE-------ENDLIEAEKYTGKILVKQEWKRNMD--VSFKTCVSDGANTECSTCRFIHV 1086          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 158.688 bits (400), Expect = 9.346e-39
Identity = 207/776 (26.68%), Postives = 343/776 (44.20%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQ---IDEELSYSFGLITDI--FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPE--FTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD-NLRYIL----LPMTNYFQINNDGE-LHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS-LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG---LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKL------SMDHLYQPLTVNKTGSLFSNQVFDREKKS-KVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMV 2376
            TI EN  I   +  +K   +    + ++ YS    + I   +ID  +G++   + ID         A     T  +      Q  L S + + I ++DI+D+ P     +   T+E    I  +   +Y   A+D+D S  N  I Y M G    F ++E +      +LL   D E   +Y   ++A      S++ +  + + + +IND AP F K  Y  ++ E++     II + AVD D D  + Y +      + +   I + G  L +  +L  + H+     I ATD G       + + + DVN  P  +  +P  + I E +  G  V  +   D D     R +   ++   +Q  R+  D  S DI       +V S LDRE   D   ++  +         L T+  I + + DINDN+P F SS Y   + E+  +G    Q  A D DIG N ++ Y +  S  S    LF +D  +G L++   LDRE+    +L I A D+      S ++++T+T+ D NDNAP   + + D  I EN P+G  +GT++A D DEG+NA I F++       +  + +    N    + +   FD E K+ K   ++Q S       L+S V V +++ D NDN P +    KD   L+N  F+N           V+M+   ++GF    + A D D N  + L Y+LE       +  + + +K +GKI + +   R++      K  V D  +    + + I V
Sbjct:   24 TILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERID---------AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---AIDED-SGPNGIIKYSMEGSED-FIIDEDSGLIKTTKLL---DRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHK-VRVEISATDQGGLQGRCVVNVFIDDVNSAP-YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRI--DPSSGDI-------SVSSDLDRE---DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL-SAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ----LSSTVPVRIHVSDVNDNKPAL----KDFVILMNR-FDN-----------VQMA--RQIGF----IPAFDPDQN--ATLEYFLE-------ENDLIEAEKYTGKILVKQEWKRNMD--VSFKTCVSDGANTECSTCRFIHV 727          

HSP 2 Score: 114.005 bits (284), Expect = 4.423e-25
Identity = 120/476 (25.21%), Postives = 208/476 (43.70%), Query Frame = 1
Query:  997 LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD---------SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            ++ITV+DVND  P +  +   + I E      ++  +   D D         S++ + GI     ++ T  + L +                  +D +  P     T  I    G +  L + + + +NV DIND+AP   ++Q  + ++EN  IG ++ +  A DED G N +I Y+++ S D   F+ID  +G +K  + LDRE   +Y L + A D       + ST + + + D NDNAP    +EY + +I E +P G  I TL A D DE +      + +   ++  L +   G++ S     + +  KV  +I  +D   G +    V   VN+  ++ N    F                   +H    + VK+     +G+ +  +KA D+D  + +++ Y +++S         F ID  SG I+++  L R+      V V   D   P L ++  I V + DI
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRE-----------------RIDAKNSP----ITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNT-STTIAVVLKDINDNAPTFDKKEY-NVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQ--GGLQGRCV---VNVFIDDVNSAPYF------------------NDHP---FSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDI 418          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 150.214 bits (378), Expect = 4.281e-36
Identity = 160/605 (26.45%), Postives = 275/605 (45.45%), Query Frame = 1
Query:  379 MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAA-VDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYE-DISLDEIIIKVNAVDADGDN------LRYILLPMTNYFQINN-DGELHLIQKLDFEKHQ---SFSFTIQATDGE---FVAESKLKITVLDVNDEPPSYILNPEKLV--IDETNKS----GILVGQITVFDRD-----SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGI-KRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDI-GKNALITYNIQFSVDSGLFVI-------DSRTGWLKLMQPLDRE---KKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSA--IGNVLTSHVSVCVNILDENDNYPQIFLYEKD----ETTLINSL 2061
            +K+ I+I D++DN P FE+ ++   +KE     + VI + A  +DK  +++   I     G    F +   +     + +   +D+E   QY   L A   +D   +A  NV + + ++ND AP+F +  Y  +V E D+ + +++  V+A DAD D        R         F+I    G + L++ LD +      S++F +QA D +    V  + +++ V D+ND  P +   PE+L   I+E  +     G+    +   D D     + +I  GI   +  +     R++++          K++ + SLDRE   +          D G+  R+ + N++I   V D+NDNAP F  ++Y+  V+E   IG  +    A D D   K+ + TY  Q S +S  F +        S  G L++ QPLD E   +++ + L I   D     R      + + ++D ND+AP +   T+  + E++P G  IG   A D+D G+ AR       D   Q  T+++ G+L      DRE  +     I+  D++  IG  +     V V + D NDN P+ +   +     E T +N L
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIG--AGGGRIPFGVRTDSGT---IFVKEPLDFEASDQYHLVLIA---SDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF---PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG--------KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTI--KVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTY--QLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD----GRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQ-FTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM-----VAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL 1890          

HSP 2 Score: 135.576 bits (340), Expect = 1.113e-31
Identity = 183/752 (24.34%), Postives = 334/752 (44.41%), Query Frame = 1
Query:  361 KTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEH----------NSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEE---SVYEDISLDEIIIKVNAVDADGDNLRYILLPMT----------------NYFQINNDG-ELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK-LKITVLDVNDEPPSYILNPEKLVIDE----------TNKSGILVGQITVFDRDSV--SINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYT-----NFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRT--GWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGE-NARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQ---IQLSDSAIGNVLTSHVSVCVNILDENDNYP----QIFLYEKDETTLINSL-----------FNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQK--VKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + LI   +  + ++DI+DN P+FE+P +   +         VI +  A D D +  N EI Y +  D +A   EEH          N R   + L+  I  + QK     ++      E++ ++  VTL V++    AP++  +   +   +V E++ L+++I++  AV +       ++  +T                N F+  N+  E+ +++ LD+E+  +++ T+ ATD    VA +K   + V DVND  P + ++     IDE          TN   I+  +    D D     ++  I       ET+  R+++        L  +++     DRE I D  I T       +    G       N+ + + ++D+NDNAP F   +Y   VKE+   G+ +   +A D D  K++ + Y++      G      RT  G + + +PLD E  +QY L ++A D     R + +T + I + D NDNAP  E ++Y    I E++ I   +  + A D D+ E ++RI+++L      +   + K +G++   +  DR+  + V +    +Q  D   GN L  +  V VN+ D NDN P    ++F Y ++    I+S            F++  TE++N++Y +   +R K+             +N                  +S+F ID+ +GKI   R L R++   ++  ++V   D G PS +    + +++ D+
Sbjct:  957 RPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITV-FAFDND-AAHNAEITYSLEIDTTAG--EEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDE--------LTGEIFPNEKFDREKI-DMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHL-IGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD----GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDD-GNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI---VRNKL-------------ING-----------------ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDM 1654          

HSP 3 Score: 126.716 bits (317), Expect = 6.141e-29
Identity = 164/644 (25.47%), Postives = 283/644 (43.94%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVD-KDISMKNKE-------IAYRMSGDHSA-----FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMTNYFQINNDGELHLIQKLDF----EKHQSFSFTIQATD-GEFVAESK---LKITVLDVNDEPPSYILNPE-KLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSG----IKRQLYTN-ISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQ-----LFQAQATDEDIGKNALITYNIQF--SVDSGLFVIDSRTGWLKLMQPL--DREKKNQYMLTIVAIDQAVHDRKS-GSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL----------YQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ 2016
            F +DPKSG + T          +   A  ++  +S + N   Q + +++++I+      D+  P+F K E+ + + E     N+V Y  + VD K  S ++ E       I Y + GD        F ++         RLL   D    K ++  ++A + N ES   ++++T+++ ++ND  P F++ +Y   V EDI L++ I+KV AVD D GDN R       + F IN++GE+    +LD     E+H  + F + A D GE V+ S    + I   + NDE   ++   +    + E  + G  V QI   D D   +       +    TQ + L      T ++ +    +   L     P   I    I  D G       + +T+  ++ + + D+N+N P FP       + +  +  Y+     + + +ATD+D   N  I Y++ +  S     FVID +TG L     +  DRE + +  +T+ A D+   DR   G  Q ++ V+D NDN+P+  R   + S+     +G  + T+ AFD D   NA I + L +D            +  L   ++G +   +     K  K    +   D+ I   L S   V +N+LD+    P+
Sbjct:  472 FIVDPKSGVVRTGWSKYERGDTYRISA--QAMDLSPSDNTTSQLSEVAILEILA-----DERPPQFAKQEYEVTVSE----DNLVDY--SVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRES---HVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSF-MDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENP---INLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPK 1092          

HSP 4 Score: 119.013 bits (297), Expect = 1.494e-26
Identity = 176/772 (22.80%), Postives = 307/772 (39.77%), Query Frame = 1
Query:  223 TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDE-SMSANMNVTLQVVNINDCAPEFSKTI-YEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDR-----DSVSINRGIKCTETNHETQALRLEK-----DQMSTDILLIYKLYTVHS----------------------LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG---------LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTD----FSILENLPIGHYIGTLIAFDKDEGENARIMFKLS--------MDHLYQPLTVNKTGSLFSNQV----FDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSA 2361
            T  F IDP +G IH  +++D     F+  A  +   + +     R+    S + + I I D++DN P F +P +T +++E I   N  I    AVDKD    N  I Y  S D+  F++  +     ++RL  D   E+   YRF ++A    +  S+S++  + ++  N ND +  F  T  Y   V ED      +I++ A DAD D + Y        F   N      +     ++H              +AE++  I +  +  +  S  + P K     T+ + +L+G   V +      D    +   K  E  ++T    + K     D  S +  ++Y LY   S                       DRET P   +       D G  R L       + V DINDN+P F    Y+  V     +G  +    A D D   NA ITY+++    +G           +++ R+G + L++P+   K  +++  ++A D  + +    S Q+T+ VLD    AP+ +   D     ++ EN+ +   I    A    +  N+ +++KL+         +  ++     + G+ +   V     D E+ +     +  +D  + + + S  +  V + D ND  PQ F  +    T+   +  N + E +N             G  I  VKA D D +      +Y     +   +   F ID+ +G+I  N    R+ I +  + V   D    +L  A
Sbjct:  582 TKWFRIDPSTGIIHLTRLLD-----FDDPALPKLHKLKVTA---REDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPL-NQTILKVTAVDKDTG-DNSRITY--SVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTY-------SFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKT---HTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVK--ATDRG-DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQ-FTVDLFTGTIDEEMTPNEHLEKTN-------------GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGA 1311          

HSP 5 Score: 97.4413 bits (241), Expect = 4.681e-20
Identity = 108/416 (25.96%), Postives = 181/416 (43.51%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNV----NRQKTLISVMKIVIIILDIDDNKPEFEKPEFTM--EIKEVIHRKNMVIYLPAAVD-KDISMKNKEIAY-----RMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNL-RYILLPMTNYFQINND--------GELHLIQKLDFE---KHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSG--IKRQLYTNISIPLNVHDINDNAP 1383
            ++F I   SG I  +K +D          D  +   S N  V    +    L+    + + + DI+DN P F +  F    E +E IH   +      A D  D + +N  I Y     ++    S F ++++  +   +R L D +   ++++   + A  +   S     NVT++V ++ND AP F KT YE SV E   +   ++  +A DAD    DN+  Y L   ++YF +  D        G L + Q LD+E   +   F   I+ +DG   AE+ + + ++D ND  P +I    +  + E    G  +G+ T  DRD+    R  +    +   +   +++D           L   H+LDRE I    +Y   I  YD+   I RQ+     + + + D+NDN P
Sbjct: 1484 EVFRIGKYSGTIELVKALD---------RDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL-DREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAP-HIHGATEHRVREDVPRGTSIGRYTATDRDAGDTAR-FRINRQSDPKRQFTIDQDGT---------LRVAHTLDREDI---AVYNLIIEAYDNSNNIGRQM-----VAVYLQDVNDNGP 1870          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 150.214 bits (378), Expect = 4.281e-36
Identity = 160/605 (26.45%), Postives = 275/605 (45.45%), Query Frame = 1
Query:  379 MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAA-VDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYE-DISLDEIIIKVNAVDADGDN------LRYILLPMTNYFQINN-DGELHLIQKLDFEKHQ---SFSFTIQATDGE---FVAESKLKITVLDVNDEPPSYILNPEKLV--IDETNKS----GILVGQITVFDRD-----SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGI-KRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDI-GKNALITYNIQFSVDSGLFVI-------DSRTGWLKLMQPLDRE---KKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSA--IGNVLTSHVSVCVNILDENDNYPQIFLYEKD----ETTLINSL 2061
            +K+ I+I D++DN P FE+ ++   +KE     + VI + A  +DK  +++   I     G    F +   +     + +   +D+E   QY   L A   +D   +A  NV + + ++ND AP+F +  Y  +V E D+ + +++  V+A DAD D        R         F+I    G + L++ LD +      S++F +QA D +    V  + +++ V D+ND  P +   PE+L   I+E  +     G+    +   D D     + +I  GI   +  +     R++++          K++ + SLDRE   +          D G+  R+ + N++I   V D+NDNAP F  ++Y+  V+E   IG  +    A D D   K+ + TY  Q S +S  F +        S  G L++ QPLD E   +++ + L I   D     R      + + ++D ND+AP +   T+  + E++P G  IG   A D+D G+ AR       D   Q  T+++ G+L      DRE  +     I+  D++  IG  +     V V + D NDN P+ +   +     E T +N L
Sbjct: 1319 VKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIG--AGGGRIPFGVRTDSGT---IFVKEPLDFEASDQYHLVLIA---SDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF---PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTG--------KIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTI--KVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTY--QLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD----GRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQ-FTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM-----VAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQL 1890          

HSP 2 Score: 135.576 bits (340), Expect = 1.113e-31
Identity = 183/752 (24.34%), Postives = 334/752 (44.41%), Query Frame = 1
Query:  361 KTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEH----------NSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEE---SVYEDISLDEIIIKVNAVDADGDNLRYILLPMT----------------NYFQINNDG-ELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK-LKITVLDVNDEPPSYILNPEKLVIDE----------TNKSGILVGQITVFDRDSV--SINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYT-----NFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRT--GWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGE-NARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQ---IQLSDSAIGNVLTSHVSVCVNILDENDNYP----QIFLYEKDETTLINSL-----------FNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQK--VKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + LI   +  + ++DI+DN P+FE+P +   +         VI +  A D D +  N EI Y +  D +A   EEH          N R   + L+  I  + QK     ++      E++ ++  VTL V++    AP++  +   +   +V E++ L+++I++  AV +       ++  +T                N F+  N+  E+ +++ LD+E+  +++ T+ ATD    VA +K   + V DVND  P + ++     IDE          TN   I+  +    D D     ++  I       ET+  R+++        L  +++     DRE I D  I T       +    G       N+ + + ++D+NDNAP F   +Y   VKE+   G+ +   +A D D  K++ + Y++      G      RT  G + + +PLD E  +QY L ++A D     R + +T + I + D NDNAP  E ++Y    I E++ I   +  + A D D+ E ++RI+++L      +   + K +G++   +  DR+  + V +    +Q  D   GN L  +  V VN+ D NDN P    ++F Y ++    I+S            F++  TE++N++Y +   +R K+             +N                  +S+F ID+ +GKI   R L R++   ++  ++V   D G PS +    + +++ D+
Sbjct:  957 RPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITV-FAFDND-AAHNAEITYSLEIDTTAG--EEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDE--------LTGEIFPNEKFDREKI-DMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHL-IGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD----GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDD-GNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGI---VRNKL-------------ING-----------------ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDM 1654          

HSP 3 Score: 126.716 bits (317), Expect = 6.141e-29
Identity = 164/644 (25.47%), Postives = 283/644 (43.94%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVD-KDISMKNKE-------IAYRMSGDHSA-----FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMTNYFQINNDGELHLIQKLDF----EKHQSFSFTIQATD-GEFVAESK---LKITVLDVNDEPPSYILNPE-KLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSG----IKRQLYTN-ISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQ-----LFQAQATDEDIGKNALITYNIQF--SVDSGLFVIDSRTGWLKLMQPL--DREKKNQYMLTIVAIDQAVHDRKS-GSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL----------YQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ 2016
            F +DPKSG + T          +   A  ++  +S + N   Q + +++++I+      D+  P+F K E+ + + E     N+V Y  + VD K  S ++ E       I Y + GD        F ++         RLL   D    K ++  ++A + N ES   ++++T+++ ++ND  P F++ +Y   V EDI L++ I+KV AVD D GDN R       + F IN++GE+    +LD     E+H  + F + A D GE V+ S    + I   + NDE   ++   +    + E  + G  V QI   D D   +       +    TQ + L      T ++ +    +   L     P   I    I  D G       + +T+  ++ + + D+N+N P FP       + +  +  Y+     + + +ATD+D   N  I Y++ +  S     FVID +TG L     +  DRE + +  +T+ A D+   DR   G  Q ++ V+D NDN+P+  R   + S+     +G  + T+ AFD D   NA I + L +D            +  L   ++G +   +     K  K    +   D+ I   L S   V +N+LD+    P+
Sbjct:  472 FIVDPKSGVVRTGWSKYERGDTYRISA--QAMDLSPSDNTTSQLSEVAILEILA-----DERPPQFAKQEYEVTVSE----DNLVDY--SVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRES---HVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSF-MDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENP---INLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG--DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPK 1092          

HSP 4 Score: 119.013 bits (297), Expect = 1.494e-26
Identity = 176/772 (22.80%), Postives = 307/772 (39.77%), Query Frame = 1
Query:  223 TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDE-SMSANMNVTLQVVNINDCAPEFSKTI-YEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDR-----DSVSINRGIKCTETNHETQALRLEK-----DQMSTDILLIYKLYTVHS----------------------LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG---------LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTD----FSILENLPIGHYIGTLIAFDKDEGENARIMFKLS--------MDHLYQPLTVNKTGSLFSNQV----FDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSA 2361
            T  F IDP +G IH  +++D     F+  A  +   + +     R+    S + + I I D++DN P F +P +T +++E I   N  I    AVDKD    N  I Y  S D+  F++  +     ++RL  D   E+   YRF ++A    +  S+S++  + ++  N ND +  F  T  Y   V ED      +I++ A DAD D + Y        F   N      +     ++H              +AE++  I +  +  +  S  + P K     T+ + +L+G   V +      D    +   K  E  ++T    + K     D  S +  ++Y LY   S                       DRET P   +       D G  R L       + V DINDN+P F    Y+  V     +G  +    A D D   NA ITY+++    +G           +++ R+G + L++P+   K  +++  ++A D  + +    S Q+T+ VLD    AP+ +   D     ++ EN+ +   I    A    +  N+ +++KL+         +  ++     + G+ +   V     D E+ +     +  +D  + + + S  +  V + D ND  PQ F  +    T+   +  N + E +N             G  I  VKA D D +      +Y     +   +   F ID+ +G+I  N    R+ I +  + V   D    +L  A
Sbjct:  582 TKWFRIDPSTGIIHLTRLLD-----FDDPALPKLHKLKVTA---REDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPL-NQTILKVTAVDKDTG-DNSRITY--SVDNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTY-------SFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKT---HTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVK--ATDRG-DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQ-FTVDLFTGTIDEEMTPNEHLEKTN-------------GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGA 1311          

HSP 5 Score: 97.4413 bits (241), Expect = 4.681e-20
Identity = 108/416 (25.96%), Postives = 181/416 (43.51%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNV----NRQKTLISVMKIVIIILDIDDNKPEFEKPEFTM--EIKEVIHRKNMVIYLPAAVD-KDISMKNKEIAY-----RMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNL-RYILLPMTNYFQINND--------GELHLIQKLDFE---KHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSG--IKRQLYTNISIPLNVHDINDNAP 1383
            ++F I   SG I  +K +D          D  +   S N  V    +    L+    + + + DI+DN P F +  F    E +E IH   +      A D  D + +N  I Y     ++    S F ++++  +   +R L D +   ++++   + A  +   S     NVT++V ++ND AP F KT YE SV E   +   ++  +A DAD    DN+  Y L   ++YF +  D        G L + Q LD+E   +   F   I+ +DG   AE+ + + ++D ND  P +I    +  + E    G  +G+ T  DRD+    R  +    +   +   +++D           L   H+LDRE I    +Y   I  YD+   I RQ+     + + + D+NDN P
Sbjct: 1484 EVFRIGKYSGTIELVKALD---------RDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSL-DREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAP-HIHGATEHRVREDVPRGTSIGRYTATDRDAGDTAR-FRINRQSDPKRQFTIDQDGT---------LRVAHTLDREDI---AVYNLIIEAYDNSNNIGRQM-----VAVYLQDVNDNGP 1870          
BLAST of Protocadherin gamma vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 145.976 bits (367), Expect = 7.016e-35
Identity = 183/721 (25.38%), Postives = 304/721 (42.16%), Query Frame = 1
Query:  217 LITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEH---NSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAE---SKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            L T++ SID ++G I     ID        C         +         L + +++V  +LD +   P+FEK  + +EI E       ++ + A  +      +K I Y +       N +EH   ++    + +    D+EKQK Y+ T+ A   N E+ ++ +++ L+  ++ND  P F    Y  +V E    +E ++ V+A D D      + Y +L  ++ F IN   GE+   + L       F   + A DG   +    + + ITV+D + + P +  +  ++   E    GI +G +    +   SI  G    + +H      +++D          K+Y    LD + + D ++        SG   Q    I I     D NDN P F SS  ++ ++E+  +    +  QA+D+D  KN  + Y+I  S       ID  TG L     LD E    Y L + A D  +  R S  T L I VLD NDNAPE  + +    +LEN P    +G ++A DKD  EN +I+++++    Y  +   K G++++ +  DRE  S V   I   D  +    +S  S  +++LD NDN P                        S    VV       +   I  + A D D      + Y  +      LQ S+F + K +G + + R L+      Q++ V+V D G P
Sbjct:  478 LDTELVSIDKETGRIFVPNTID--------CNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVA--NNSQCGNSKRIRYSLQ------NQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSG----DQDHN---FSIDEDTG--------KIYVTRYLDAD-VHDTVLLNIQATLPSGESNQTQVVIFI----EDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMT-LFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGID-EKLGNVYTKRSIDREVISHVDISIVAEDKGVPP-RSSTASARISVLDVNDNPPSCL---------------------SITPIVVPAG--SPLSTAIGTIVAMDPDKGLNGSVLYRAQ------LQSSLF-VVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 2 Score: 119.398 bits (298), Expect = 1.108e-26
Identity = 188/805 (23.35%), Postives = 333/805 (41.37%), Query Frame = 1
Query:   58 VLLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLITD-----IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLEEHNSRGPRLRLLIDI------DYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRY------ILLPMTNYFQINNDGELHLIQK-LDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPS----YILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE--KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +L+F ++++  IF      + KFT+ E+  I T +G I   ++      Y F +  D        +D +SG+I T+  +D E         K S    + V V      I ++   + + D +DN P F      +EI E   +      LP   D D    +      + G+ ++ F L    SR    +L  D+      D E + +Y   + A      +    +  ++++++ ND AP FS++ Y  SV  +IS+   +I V A DAD G+N R          P  + F I+  G +      L    H               + + + ITVL      P     +++      + E +  G +V ++++  +   +  R I  +       AL  ++    TD   +Y L     LDRET  +   +  F+    G   Q+       L + DINDNAP + SSQ  + +         L    A D D+G+N  I Y++   +D+ L  ID  TG + +   +D    ++    + A D       S   Q+   +LD     P+  +      I E+ PIG  +  ++A +   G + RI +  S+ +  + LTV+  +G++   + FD EK+    T +  +++   N  TS   + + + D NDN+P IF             + N Y           +++RE  K    + VV A+D D     ++SY++ + +S       F I+  +G++   +PL R   G   + V  +D G  S +++  I + ++D
Sbjct:    9 ILIFSLIFL--IFPTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKY-FVVFPDEQTSKFLKVDERSGEISTIAHLDYE---------KRSKFDIVAVKVEESGETIDIL---VEVDDENDNAPSFADQVVKLEISE-FAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLA---SRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSS-------ALCPQQ----TDQAHVYLLLLCGILDRETASEH--HLKFLLEKDG---QIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRTL---TAKDPDLGQNGWIRYSV---LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGG-SPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRY--SLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNA---NSETSTSLISIRLKDVNDNWP-IF-------------YPNEY----------HLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS------FSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVID 733          

HSP 3 Score: 108.227 bits (269), Expect = 2.324e-23
Identity = 145/679 (21.35%), Postives = 284/679 (41.83%), Query Frame = 1
Query:  388 VIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQINNDGELHLIQK-LDFEKHQSFSFTIQATDGEF-VAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTN----FICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            ++ I DI+DN P++     + +I   ++R         A D D+  +N  I Y +  D    ++++   R   + +   ID     + +F + A      ++S ++ V   +++     P+F K +++  + ED  +   ++KV A ++   N   +RY L     +  ++       IQK  DFEK +S+  T+ AT+     + S + I + DVND  P +  N   L + E  K    +  ++  D DS +                      ++S  IL     ++++ +  E      +        +    G  +    + +I + V D +   P F  S+Y++   E+   G  +         +G  + + Y+I        F ID  TG + + + LD +  +  +L I A    +   +S  TQ+ I + D NDN P+      + SI E+L +      + A DKD+ +N  + + +   H    + +++ TG L +  + D E       +++ +D  I    +S++++ +++LD NDN P+   +EK   T+   +  N+  +                  ++  V A D D     Q+ Y + N +        F ID+K G +   R + R++I    + ++ ED G P   S  +  + +LD+
Sbjct:  428 LLTIGDINDNAPQWH----SSQIHISLNRTQGGSRTLTAKDPDLG-QNGWIRYSVL-DTELVSIDKETGR---IFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFG--------------------EVSYHILSESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAI-------GSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQA---TLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPP-RSSNMTLFIHVLDVNDNAPE---FEKSWYTM--EVLENSPPKT-----------------IVGKVVARDKDSLENGQIVYRITNGSE------YFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDV 1038          

HSP 4 Score: 77.0258 bits (188), Expect = 7.697e-14
Identity = 135/614 (21.99%), Postives = 257/614 (41.86%), Query Frame = 1
Query:  607 LRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVY-EDISLDEIIIKVNAVDADGDN-LRYIL-LPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEP---PSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYK---LYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVH----DINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQ----PLDREKKNQYMLTIVAIDQAVHDRKS-GSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPL-HRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            + L   +D+E   ++  T+ A    D S     N+T+ V +IND AP FSK +Y+ +V     S  +   K+ A D D    L Y L    ++ F++  +    L  K+     + +  T+ ATD G     + + ++V+    EP   P +     +  + E +K G+ +G ++           G +  E ++  Q      D  ++ I  I K   L+    +DRE             +   I  ++ T+  +    H    D NDN P+F S  Y + +K++   G ++ Q  A+D+D G+N  ++Y I    D  +  ++  TG ++L +     LD      + + + A D     R + G  Q+++ +   + +AP   L  Y +  +LE+  +G  +  + A ++    N  +++ L        + V KTG L      D E +  +   + +SD   G      + + V  +DE                     F   +T+ S   Y +++ I    G  +  ++A D D      + Y + +      +QS   I++ +G I + +PL  R  + ++++ V+   S  P+ +S  T+ +EI
Sbjct: 1984 IHLTAPLDFEVLPEHTLTIKA---TDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSIFRVAPESGA-LFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLS-----------GEESREFHYRIQ------DPEASKIFSIDKFGRLFVAGPIDRE-------QRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVY-EVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDV-KTGELTLKTHLDWESEPIISMYLSVSDGN-GRSAVVPLKIVVEPVDE---------------------FAPVFTKSS---YTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISD------RQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSS--PTKQSKTTVYLEI 2534          

HSP 5 Score: 55.8398 bits (133), Expect = 2.465e-7
Identity = 165/780 (21.15%), Postives = 299/780 (38.33%), Query Frame = 1
Query:  106 FD-GVQKFTIEENQPIKTFVGRIKFAKQIDEE--LSYSFGLITDIFSIDPKSGDIHTLKVIDLEA-----LCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVI----HRKNMVIYLPAAVDKDISMKNKEIAYRM--SGDHSA---FNLEEHNSRGPRLRLLIDIDYEKQKQYRF---------TLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYI------LLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAP-LFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL----ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVED 2334
            FD G  +  I E+ P  + +  +      D    +SY F L+ D FSID  +GDI  +  +         L   +       T+ + VNV+                D++D+ P      F +    V+    +RK  +++   A+D D   K+ EI Y +  +G   A   F ++E +        +  ++        F         T+ A    D +      V L+  N +     F         +++   D  I+  +   +    L++       L+P + +F++ +     ++QK       +  FTI A   + +  S LKI V  V  EPP                S    G +T+ +   +   + I  T    E++  R + +     I       +V  LDRE   + ++    I  D G +     + ++ + V D NDN P L  S+  ++ + E++ +G  L + +A+D DIG+N   ++ +     SG   +   TG L L +         + + +  +D  V         L I+  +    A    E+   + L    E LP G +I  L      + E A + + +   ++    +V+  G + +N   DRE   +   ++  + S  G  + + V V VN L  NDN P   + +                        V  ++R  VG  +A V A   DV+N++ L Y+L  S S     + F+ID+ +G I +  PL  +++    + +   D
Sbjct: 1331 FDTGHLRVNIREDTPTGSIITTVNATVSDDSASPISYRFPLLIDNFSIDQFTGDITLIDTLHWHVTPTYNLIVEAFTSGPGTTLLVTVNVD----------------DVNDHTP------FIVSQPTVLLPSSYRKGGMVHRVVAIDLD---KDPEIRYSLKYAGSEVAKEFFKIDEKSGE------IFVVESSSALSTSFGGAGLPETLTIRATDLQDLTKFDEQKVLLKASNASRSTWHF---------FDEQHKDVTILSTSPQGSQILQLKFQEGVDLQLIPSSPHFELKSS---KIVQKSASVATGTQRFTIVAQKDDELDYSTLKIHVEPVFTEPPKI--------------SSTSCGVVTIEENVGIEDFKRILATGMTEESR-FRFQGNAPKFSINSTTGSISVLPLDREASQEHLLI--IILTDGGSRND---SCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFEL-LEDSSGSLDLVPETGDLVLRR---LSSLQSWKIKLRVVDHGVPGLYV-EKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL------QPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTGS--GQQIGTRVDVRVNNL--NDNVPSFPMSKPRR---------------------VPENLR--VGSYVATVGA--KDVDNLAPLRYFLV-SDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATD 2006          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 194.126 bits (492), Expect = 1.718e-49
Identity = 204/794 (25.69%), Postives = 342/794 (43.07%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFA-------KQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLP--AAVDKDISMKN-KEIAYRMSGDHSAFNLEEHNSRGPRLRLLID-IDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLP--MTNYFQI-NNDGELHLIQKLDFEKHQSFSFTIQATDGE--FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGL---------------FVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQ---AVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFK-LSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            ++ EN+P+   + ++  +         ++  +   F  +T+ F +   SG+I     +D E            ++    V    +  L +   I + + D++DN+P F   E+ + ++E     +     P  A V  D    N  +++YR+   + A       S G    +  D +    Q  +   +SA    +   +A+  V L +++     P F K  Y   V EDI    ++  V A   D  +   +RY +       YF I  N G + + + LD E        IQAT GE      +++ I V DVND  P +  +  ++ + E+ + G  +      D+DS S   G        E+       D  S  ++L   L    S  R T+    I T     D G+   L TN++I ++V D+NDN P+F   +Y V V E+  I  Q+ Q  A+D D G NA ITY I   VD+G+               F I   +GW+ L  PLDRE +++Y LT++A D    A H +    T++ + VLD NDN P+ ++   +F I ENL  G  +G + A D D GENA I +  L ++  +Q   V  TG + + +  DRE +      ++  D     V ++ V V +++ D NDN P+I   ++D                     VV +   +  G  +  V+A D D    + ++Y +      +    +F ID  SG I     L  +   + ++ V   D G+P  ++ + + VE+LD+
Sbjct:  619 SVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-FEVRSASGEICIAGELDFE----------RRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGS--SGQVTYSLVKESGKGLFAIDARSGHLILSQHL-DYESSQRHTL----IVT---ATDGGVP-SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRI---VDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK----TRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPV--TGEISTREPLDRELRELYDLVVEARDQGT-PVRSARVPVRIHVSDVNDNAPEIADPQED---------------------VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSD-GHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL 1358          

HSP 2 Score: 172.17 bits (435), Expect = 9.338e-43
Identity = 211/832 (25.36%), Postives = 355/832 (42.67%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQ---IDEELSYSF--GLITD---IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMV-----IYLPAAVDKDI---SMKNKEIAYRMSG-----DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY--QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILL---PMTN--------YFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITV------LDVNDEPPSYILNP-------EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID---------QAVHDRKS----GSTQ---------LTITVLDDNDNAPELREYTDF--SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKT-IMVEILDI 2391
            ++ E QP  T V R++   +    +  ++YS   G  +D   +FSIDP SG I T  V+D E              ++ +   N  +  + ++++ +  LD++DN+P F        ++E     ++V     I  PA V ++    S ++  + Y ++        +AF+++ H+      RLL   D E Q ++R  + A     ++   S+ + V ++V ++ND APE+ +   +  V E   +  II    A DAD G N  L+Y L+   P  N         F++++  G L L   LDFE  Q +   +QA D       +L+ +V      LD ND  P ++ +P         L I +  + G +V  I   D DS   + G    E        R   +  +  I L+  L        E +  G  +   I   D G      +++++ L V   ++N P F  + Y+  + EN   G  + Q  A      +NA ++Y I   V + LF +D + G +      DRE +  Y+L +   D          AV  ++S    G T          + ITV D NDN+PE R  + +  S+ EN   G  I T++A D DEG NA +++ ++  +L    +++ +    S +  DRE+ S+   QIQ SD         H ++ + + D+NDN P+  L          S +  +  E +             +G  +  + A D D+   ++L Y L N       Q  F ID +SG IT    L R+L       V+  D G   ++SA   + + +LDI
Sbjct: 1265 SVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLG------VAASDGGNPPRETVRMLRVEV--LDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLL---DREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFV-SPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG--DNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPA----TEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----------SKYTGSVQEDA------------PLGTSVVQISAVDADLGVNARLVYSLANET-----QWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDI 2050          

HSP 3 Score: 165.236 bits (417), Expect = 1.423e-40
Identity = 197/731 (26.95%), Postives = 325/731 (44.46%), Query Frame = 1
Query:  205 YSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCA-DKESATISLNVNVNRQK----TLISV------MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLEEHNSRGPRLRLLIDI----DYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN-------YFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPS----YILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVH-SLDRETIPDGIIYT-NFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRP 2283
            Y  G I D   ID  SG  +   +I  EA      A D+ +  I   V ++R+     +L+++      +++++ + D +DN P F +    +E  E   R+     LPA  D D+   N +    +SG+ + AF L  H  R   L L + I    D E    Y   + A       +   M V + + ++ND  P F+++ Y  +V E+ ++   +++V A D D D    +   +          F+I+   G +++ + LDFE  +     + A D GE   E+   + I V DVND  P+    ++ +     I E+ + G  V +I+V D DS +    +  T    +       +D        IY L  VH  LDRE + +   YT + +  D G    L+ + SI L + D+NDN P F    Y   V E  D G  + Q  A D D G N+ +TY++  + +  +  F ID +TG +     +D E +    LT+VA D  V    S +T L +T+ D NDN P   + + + S+ EN P+G  I  + A D D G NA + + +     HL +    + +G +      D E++S     +  +D      L++   + + + D NDN P +F   + + +L  S                K S +     ++AVV ATD D  N  Q+SY +    + N +  IF ID+ +G+I + RP
Sbjct:   94 YQIGYIGDFGGID--SGPPY---IIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPAR-DLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS------IY-LVIVHLPLDREIVSN---YTLSVVATDKGTP-PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVL-VTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRES---------------PKASSQASSTPIVAVV-ATDPDYGNFGQVSYRI---VAGN-EAGIFRIDRSTGEIFVVRP 782          

HSP 4 Score: 164.466 bits (415), Expect = 2.053e-40
Identity = 173/703 (24.61%), Postives = 312/703 (44.38%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSR---GPRLRLLI---DIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-----------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNK-----SGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAI--DQAVHDRKSGSTQLTITVLDDNDNAPELR-EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSI--------FDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I + I D++DN PEFE+  +   + EV      V+ +  A D+D  + N  + Y +     A   E H       P+  L+     ID E +   + T+ A       +S+   V + + ++ND  P F ++ Y  SV E+  +   I+KV+A D D           G+  ++    +T +   +  GE+ +  +LDFE+  S+ F + ATD G     + +K+ + DVND  P +     K+ + E+ K     S   +  +   D D  +  +        +E    R+  D+ + +I ++        L   T P  ++  N    D G  R    +  + L++ D     P+F  ++Y   VKE+   G  +    A   D+   + + Y+I      G F I++ +G +++ +PLD E K+Q +L I A   +  V+    G TQ+ I V D NDNAPE        S+ E+  +G  +    A DKD G + ++ + L  +       ++ ++G L  +Q  D E   +    +  +D  + + L++++++ V++ D NDN P   ++EKDE                   Y V +S    +   I  V A+D D  N ++++Y + ++  +N+  SI        F I   SG I +  PL R+     ++ V+  D+G P+  +   ++V +LD
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQV-LAHDRDEGL-NSALTYSL-----AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH----LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRI--DRSTGEIFVVRP----DMLSVRTQPMHML--NISATDGGNLRS-NADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVY----GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS-LSTNLTILVDVQDVNDNPP---VFEKDE-------------------YSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLD 1145          

HSP 5 Score: 163.31 bits (412), Expect = 4.491e-40
Identity = 203/789 (25.73%), Postives = 346/789 (43.85%), Query Frame = 1
Query:  217 LITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM--------SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND---ESMSANMNVTLQVVNINDCAPEF----SKTIYEESVY--EDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN--YFQINND-GELHLIQKL-----DFEKHQSFSFTIQATDGEFVAESK----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVF--------------------DRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDS---GIKRQLYTNISIPLNVHDINDNAPLF-PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL--ENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSS 2403
            LI   F ID  SG++   +++D E     S    E   +    + N Q + I+V    I + D++DN PE+ +    +++ E       +I+   A D D    N ++ YR+             A +L   +S    L L   +D+E  ++Y   + A  ++    E +  ++ V L++++ ND AP F    S      S++  +   + E++  + AVD D GDN  L Y +        F+IN+  G + L++ L     D EK   F+  I A D       K    L + V   ++ PP ++    +  I E   SG  V Q+T                      D   V   RGI  T         + +++  ++ +L +Y    V   +R++             DS       Q +   +I + V D+NDN+P F P S Y + V EN++ G  +    A+D D G NA + Y+I        F IDS +G L   +PLDRE+ ++Y L I A D+     + G   +TI V D NDNAP  +L +YT  S+ E+ P+G  +  + A D D G NAR+++ L+ +  +Q     ++G + +    DRE ++     +  +D     V ++ V V +N+LD NDN P   ++E+                     Y+ ++    + G  +  V+A D D+   +++ Y L  ENSA      + F I+  +G ++ ++ L  +   L  ++V+  D G+P   S   I + I + PQ +
Sbjct: 1421 LIEAAFDIDRHSGNLVVARLLDRE---VQSEFRLEIRALDTTASNNPQSSAITVK---IEVADVNDNAPEWPQDPIDLQVSEATP-VGTIIHNFTATDADTGT-NGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRG-------QFDRESQASYVLPVY----VRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG-SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP---IFER-------------------YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAV----SAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGT 2161          

HSP 6 Score: 108.612 bits (270), Expect = 2.473e-23
Identity = 158/706 (22.38%), Postives = 297/706 (42.07%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDI---SMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDIS----LDEIIIKVNAVDADGD----NLRYILLPMTNYFQINN-DGELHLI---QKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGI--KCTETNHETQALRLEKDQMSTDILLIYKLYTVHS-LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHY-----IGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS-GHPSLKSAKTIMVEILDI 2391
            L   M + I I D++DN+P F +  +   + E       V+ + A+ D D     +    I  R S     F ++    R   + +   +D+E ++ +   + A    ++ +     V+++V ++ND  P  +     +     IS      E + +++  D D      N+   L     +F +   D  ++L+     LD E   +++ ++ ATD       A   + + + DVND PP +  +     + E    G  V Q+   DRD   +N  +     ET  ET A   + D  +        L T  S +D ET P  +     +  D G+   L +  ++ + +HD+NDN P+F  S Y V V EN  +G  + +  A+D D G NA++ Y I         F + S +G + +   LD E+++ Y   ++A D+      S +  + + + D NDN P    REY   S+ E+           I  ++A D D G   ++ +++   +      +++ TG +F  +      +++    + +S +  GN+ ++  +V             +FL      ++I+++      E +  +Y VK  I    G V+  V A   DV + S + Y + +   +      F I+  SG I I +PL  D     +V + ++ + G P +     + +E+ D+
Sbjct:  266 LRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYAS-DTDADENGLVEYAINRRQSDKEQMFRID---PRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDE-GLNSALTYSLAETP-ETHAQWFQIDPQT-------GLITTRSHIDCETEP--VPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYK-VSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAV-------------VFL------SIIDAMQRPPIFEKARYNYYVKEDIPR--GTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY----FSIETNSGNIRIAKPL--DHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDV 924          

HSP 7 Score: 105.916 bits (263), Expect = 1.655e-22
Identity = 167/632 (26.42%), Postives = 253/632 (40.03%), Query Frame = 1
Query:  709 VTLQVVNINDCAPEFSK-TIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATD----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNF--ICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITY--NIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFK---------LSMDHLYQPLTVNKTGSL----FSNQVFD--------------------------REKKSKVCTQIQLSDS-------------AIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKK-SGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + + V ++ND +PEF   + Y  SV E+ S   +I  V A D D G N  L Y +    + N F I++  GEL   + LD E+H  ++  IQA+D            + I V D ND  P + L+     + E    G  V QI+  D D + +N  +  +  N ETQ  +   D  S  I       TV  LDRE         NF  +  D G        + + +NV DINDN P+F    Y   V      G  L + QA D D+G NA I Y  N + S  S  F I+  TG L   Q L  E      L +VA D+  +  +S    + + + +     P LR   E     + EN P G  +  ++A   D G   ++ F          LS+D L   + VNK   L    FS                               R +++   +   L++S             A    L S+  + + + DENDN P+                       S   +V  +S     G  +A V A D+D  + ++L Y++ +   +N     F I+   SG +  N  L R++  + K+K++  D G P +    TI V+I+D+
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD-LGVNARLVYSLAN-ETQ-WQFAIDGQSGLIT------TVGKLDRELQAS----YNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG-NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKF----------------------SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN----AFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDV 2421          

HSP 8 Score: 103.99 bits (258), Expect = 5.978e-22
Identity = 155/662 (23.41%), Postives = 271/662 (40.94%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDH-SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINN---------DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILN--PEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVH--SLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNAL--ITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIV-----AIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF--SILENLPIGHYIGTLIAFDKDE--GENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQ-IQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKIT 2271
            L S  ++VI + D +DN P+F + +F   + E  ++   V  +  A D D     +   + + G+H +AF +E   S    +R  I +D E +  Y+  + A  +    M+    + +Q+V++ND  P F       +V E   L  +I  ++A D D        L   +   I N          G+L L ++LD+E  Q +   + A+D    A + L + V D ND  P ++    P    I         + +    D D +++N     +E N+      +E  Q    +     + +V+   L       G  +   I  D+G K  L ++  + +  +D       F  +QY+  + E   +G  + Q       +G++AL      I  + +S   ++ S+   + L++PLDRE+ + Y L +V               S    + IT+LD NDN P       +   I E  P+ + I  L A D D+    N+ +++ ++  +     T++  TG LF N   D +  +K     I+  DS     L S     + + DENDN P+  L E                      YV  ++  E VG  +    A+D D     QL+Y +  + S+     +F +D +SG +T
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQV-HAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSG--IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE---ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG-KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQ-------LGQDALDQSLAIIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTE----------------------YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVT 2924          

HSP 9 Score: 90.8929 bits (224), Expect = 5.890e-18
Identity = 165/687 (24.02%), Postives = 298/687 (43.38%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDH-------SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSK-----------TIYEESVYEDISLDEIIIKVNAVDAD--GDNLR--YILLPMTNYFQIN-NDGELHL-IQKLDFEKHQSFSFTIQ-----ATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRET---IPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF-PSSQYQVGVKENNDIGYQLFQAQATDEDI--GKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREK-KNQYMLTIVAIDQAVHDRKSGSTQ-LTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL----SMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            +     I + I+D++DN+P F  P   + + E      ++  + +A D D       + YR+  +        S F L+ ++ +   L L   +DYE Q++Y   + A   +D +  A   +T++V + ND AP F              I E  + E +S+D  ++ VNA DAD  G+N +  YI+ P    F ++ ++G + + + +L      S  + ++     A      + + L++   D       ++ N  +  I E    G +V Q+    +D+  +++ +     N E+          + ++L    +  V  LDRE        ++ ++             + IS+ + + D NDN P+F  S++Y+  + E   + Y + Q QA D D     N+ + Y+I    D  +F ID  TG L +   LD +     Y L I A D   H R   S Q   + + D+NDN P+  L EY  F + EN P+G  +    A D D+G   ++ + +    S +  ++   V+ ++G + S  VFD E++ +   ++  SD  +G    S V+V V I   ++  PQ                   +TE +   +V+  ++    G+V+  V ATD+D     ++ Y L      +   S F +++ SG + I R L  D
Sbjct: 2408 MTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSI-SANDVDTY---PALTYRLGAESTVDIENMSIFALDRYSGK---LVLKRRLDYELQQEYELDVIA---SDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE--ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL---GQDA--LDQSLAIIAGNEES----------AFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSH-HQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF-LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--MGGKKAS-VAVRVEIESRDEFTPQ-------------------FTERT-YRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL------SAPHSHFKVNRSSGAVLIKRKLKLD 3035          

HSP 10 Score: 88.9669 bits (219), Expect = 2.691e-17
Identity = 177/798 (22.18%), Postives = 329/798 (41.23%), Query Frame = 1
Query:  202 SYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND-ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYIL------LPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEP---PSYILNPE--KLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDI------LLIYKLYTVHSLDRETIPDGIIYTNFICY-------DSGIKRQLYTNISIPLNVHDIND----------NAPLFPS-SQYQVGVKENNDIGYQLFQAQ-------------------ATDEDIGKNALITYNIQFSVDSGLFVIDSR-TGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLY--QPLTV----NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDV-NNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLI---GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            S + G + + FSID  SG++ + + +D E     +   + S       +  + K+      I I + D +DN P F+  ++T  ++E       V+ + +AVD D+ + N  + Y ++ +    F ++  +     +  +  +D E Q  Y F + A      E  SA + V + V++IND  P F +  Y   V   I   + ++KV A+DAD G N   +         ++  F+IN + G L   Q L  E  +     + A D     +S L +  L + + P   P      E  ++++ E + SG  + Q+     D             N +     L  D +S +I      LL Y  ++  S+   +    + Y   I         +S   ++  T+ S  L     N+          +AP   S ++  + +++ ND   +  Q Q                   A D D G NA + Y+I        FVI+   +G ++    LDRE ++ Y L I+A D+ V  + +G+  + + ++D NDN P        ++ E   +G  I ++ A D D      + ++L  +     + +++      +G L   +  D E + +    +  SD+A      +   + V + DENDN P +FL ++                 + +  + ++S    V F +  V ATD D   N S++ Y +E +      Q  F +   +G +++N    +  +   G   V+++ +D+G P+LKS+  + V+  D
Sbjct: 1885 SITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQAS-------DRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQI-SAVDADLGV-NARLVYSLANETQWQFAIDGQSGL---ITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGI---LSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGV-PQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAP-VFLAQQPPAYF------------AILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA------QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQAND 2640          

HSP 11 Score: 51.2174 bits (121), Expect = 8.097e-6
Identity = 129/588 (21.94%), Postives = 244/588 (41.50%), Query Frame = 1
Query:  646 QYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT--NYFQINN--DGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRD---SVSINRGIKCTE--TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF----PSSQYQV-----GVKENNDIGYQLFQAQATDEDI-GKNALITYNIQFSVDSGLFVIDSRTGWLKL----MQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLS-----DSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNV--SQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            + R  L A   +   +++   + +++ + ND +P+FS+  +  +V E  +    + +V+A D+D G N  LRY ++     N F I     G +     LD E    +   I ATD    +    + +++ ++DVND  P++   P  LV + E  + G ++  I+  D D   +++   G + T    N    AL     ++     L Y+L   + LD             I  D+  + +    +     V+D NDNAP+F    P + + +      + E+  + + L    ATD D  G N+ + Y I+ + +   F +    G + +    +QP        Y + I+A D      KS ST L +   D+     + L+      I E  P+G  +   +   +D  + +  +   + +  ++ L   ++ ++   +  DRE+      ++ LS             +S +SV + ILD NDN+P               +F+ +        Y  ++S    + + IA ++A D D  N   S++ Y + +   E++    F ID  +G + +N  L  D
Sbjct: 2287 EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELD------------VIASDAAHEARTVLTV----RVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPA-VSSSGDYFVRIIAKDAGKPALKS-STLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV---LQLGQDALDQSLAIIAGNEESAFELL---QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP---------------IFDRS------AKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM----FTIDLVTGVLFVNNRLDYD 2821          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 194.126 bits (492), Expect = 1.718e-49
Identity = 204/794 (25.69%), Postives = 342/794 (43.07%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFA-------KQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLP--AAVDKDISMKN-KEIAYRMSGDHSAFNLEEHNSRGPRLRLLID-IDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLP--MTNYFQI-NNDGELHLIQKLDFEKHQSFSFTIQATDGE--FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGL---------------FVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQ---AVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFK-LSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            ++ EN+P+   + ++  +         ++  +   F  +T+ F +   SG+I     +D E            ++    V    +  L +   I + + D++DN+P F   E+ + ++E     +     P  A V  D    N  +++YR+   + A       S G    +  D +    Q  +   +SA    +   +A+  V L +++     P F K  Y   V EDI    ++  V A   D  +   +RY +       YF I  N G + + + LD E        IQAT GE      +++ I V DVND  P +  +  ++ + E+ + G  +      D+DS S   G        E+       D  S  ++L   L    S  R T+    I T     D G+   L TN++I ++V D+NDN P+F   +Y V V E+  I  Q+ Q  A+D D G NA ITY I   VD+G+               F I   +GW+ L  PLDRE +++Y LT++A D    A H +    T++ + VLD NDN P+ ++   +F I ENL  G  +G + A D D GENA I +  L ++  +Q   V  TG + + +  DRE +      ++  D     V ++ V V +++ D NDN P+I   ++D                     VV +   +  G  +  V+A D D    + ++Y +      +    +F ID  SG I     L  +   + ++ V   D G+P  ++ + + VE+LD+
Sbjct:  619 SVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE-FEVRSASGEICIAGELDFE----------RRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGS--SGQVTYSLVKESGKGLFAIDARSGHLILSQHL-DYESSQRHTL----IVT---ATDGGVP-SLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRI---VDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK----TRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPV--TGEISTREPLDRELRELYDLVVEARDQGT-PVRSARVPVRIHVSDVNDNAPEIADPQED---------------------VVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSD-GHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDL 1358          

HSP 2 Score: 172.17 bits (435), Expect = 9.338e-43
Identity = 211/832 (25.36%), Postives = 355/832 (42.67%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQ---IDEELSYSF--GLITD---IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMV-----IYLPAAVDKDI---SMKNKEIAYRMSG-----DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY--QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILL---PMTN--------YFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITV------LDVNDEPPSYILNP-------EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID---------QAVHDRKS----GSTQ---------LTITVLDDNDNAPELREYTDF--SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKT-IMVEILDI 2391
            ++ E QP  T V R++   +    +  ++YS   G  +D   +FSIDP SG I T  V+D E              ++ +   N  +  + ++++ +  LD++DN+P F        ++E     ++V     I  PA V ++    S ++  + Y ++        +AF+++ H+      RLL   D E Q ++R  + A     ++   S+ + V ++V ++ND APE+ +   +  V E   +  II    A DAD G N  L+Y L+   P  N         F++++  G L L   LDFE  Q +   +QA D       +L+ +V      LD ND  P ++ +P         L I +  + G +V  I   D DS   + G    E        R   +  +  I L+  L        E +  G  +   I   D G      +++++ L V   ++N P F  + Y+  + EN   G  + Q  A      +NA ++Y I   V + LF +D + G +      DRE +  Y+L +   D          AV  ++S    G T          + ITV D NDN+PE R  + +  S+ EN   G  I T++A D DEG NA +++ ++  +L    +++ +    S +  DRE+ S+   QIQ SD         H ++ + + D+NDN P+  L          S +  +  E +             +G  +  + A D D+   ++L Y L N       Q  F ID +SG IT    L R+L       V+  D G   ++SA   + + +LDI
Sbjct: 1265 SVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLG------VAASDGGNPPRETVRMLRVEV--LDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLL---DREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFV-SPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSG--DNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPA----TEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKL----------SKYTGSVQEDA------------PLGTSVVQISAVDADLGVNARLVYSLANET-----QWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDI 2050          

HSP 3 Score: 165.236 bits (417), Expect = 1.423e-40
Identity = 197/731 (26.95%), Postives = 325/731 (44.46%), Query Frame = 1
Query:  205 YSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCA-DKESATISLNVNVNRQK----TLISV------MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLEEHNSRGPRLRLLIDI----DYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN-------YFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPS----YILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVH-SLDRETIPDGIIYT-NFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRP 2283
            Y  G I D   ID  SG  +   +I  EA      A D+ +  I   V ++R+     +L+++      +++++ + D +DN P F +    +E  E   R+     LPA  D D+   N +    +SG+ + AF L  H  R   L L + I    D E    Y   + A       +   M V + + ++ND  P F+++ Y  +V E+ ++   +++V A D D D    +   +          F+I+   G +++ + LDFE  +     + A D GE   E+   + I V DVND  P+    ++ +     I E+ + G  V +I+V D DS +    +  T    +       +D        IY L  VH  LDRE + +   YT + +  D G    L+ + SI L + D+NDN P F    Y   V E  D G  + Q  A D D G N+ +TY++  + +  +  F ID +TG +     +D E +    LT+VA D  V    S +T L +T+ D NDN P   + + + S+ EN P+G  I  + A D D G NA + + +     HL +    + +G +      D E++S     +  +D      L++   + + + D NDN P +F   + + +L  S                K S +     ++AVV ATD D  N  Q+SY +    + N +  IF ID+ +G+I + RP
Sbjct:   94 YQIGYIGDFGGID--SGPPY---IIVAEAGVETDLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPAR-DLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNS------IY-LVIVHLPLDREIVSN---YTLSVVATDKGTP-PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVL-VTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRES---------------PKASSQASSTPIVAVV-ATDPDYGNFGQVSYRI---VAGN-EAGIFRIDRSTGEIFVVRP 782          

HSP 4 Score: 164.466 bits (415), Expect = 2.053e-40
Identity = 173/703 (24.61%), Postives = 312/703 (44.38%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSR---GPRLRLLI---DIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-----------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNK-----SGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAI--DQAVHDRKSGSTQLTITVLDDNDNAPELR-EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSI--------FDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I + I D++DN PEFE+  +   + EV      V+ +  A D+D  + N  + Y +     A   E H       P+  L+     ID E +   + T+ A       +S+   V + + ++ND  P F ++ Y  SV E+  +   I+KV+A D D           G+  ++    +T +   +  GE+ +  +LDFE+  S+ F + ATD G     + +K+ + DVND  P +     K+ + E+ K     S   +  +   D D  +  +        +E    R+  D+ + +I ++        L   T P  ++  N    D G  R    +  + L++ D     P+F  ++Y   VKE+   G  +    A   D+   + + Y+I      G F I++ +G +++ +PLD E K+Q +L I A   +  V+    G TQ+ I V D NDNAPE        S+ E+  +G  +    A DKD G + ++ + L  +       ++ ++G L  +Q  D E   +    +  +D  + + L++++++ V++ D NDN P   ++EKDE                   Y V +S    +   I  V A+D D  N ++++Y + ++  +N+  SI        F I   SG I +  PL R+     ++ V+  D+G P+  +   ++V +LD
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQV-LAHDRDEGL-NSALTYSL-----AETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKH----LTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRI--DRSTGEIFVVRP----DMLSVRTQPMHML--NISATDGGNLRS-NADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVY----GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS-LSTNLTILVDVQDVNDNPP---VFEKDE-------------------YSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLD 1145          

HSP 5 Score: 163.31 bits (412), Expect = 4.491e-40
Identity = 203/789 (25.73%), Postives = 346/789 (43.85%), Query Frame = 1
Query:  217 LITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM--------SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND---ESMSANMNVTLQVVNINDCAPEF----SKTIYEESVY--EDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN--YFQINND-GELHLIQKL-----DFEKHQSFSFTIQATDGEFVAESK----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVF--------------------DRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDS---GIKRQLYTNISIPLNVHDINDNAPLF-PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL--ENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSS 2403
            LI   F ID  SG++   +++D E     S    E   +    + N Q + I+V    I + D++DN PE+ +    +++ E       +I+   A D D    N ++ YR+             A +L   +S    L L   +D+E  ++Y   + A  ++    E +  ++ V L++++ ND AP F    S      S++  +   + E++  + AVD D GDN  L Y +        F+IN+  G + L++ L     D EK   F+  I A D       K    L + V   ++ PP ++    +  I E   SG  V Q+T                      D   V   RGI  T         + +++  ++ +L +Y    V   +R++             DS       Q +   +I + V D+NDN+P F P S Y + V EN++ G  +    A+D D G NA + Y+I        F IDS +G L   +PLDRE+ ++Y L I A D+     + G   +TI V D NDNAP  +L +YT  S+ E+ P+G  +  + A D D G NAR+++ L+ +  +Q     ++G + +    DRE ++     +  +D     V ++ V V +N+LD NDN P   ++E+                     Y+ ++    + G  +  V+A D D+   +++ Y L  ENSA      + F I+  +G ++ ++ L  +   L  ++V+  D G+P   S   I + I + PQ +
Sbjct: 1421 LIEAAFDIDRHSGNLVVARLLDRE---VQSEFRLEIRALDTTASNNPQSSAITVK---IEVADVNDNAPEWPQDPIDLQVSEATP-VGTIIHNFTATDADTGT-NGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRG-------QFDRESQASYVLPVY----VRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG-SVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP---IFER-------------------YPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAV----SAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGT 2161          

HSP 6 Score: 108.612 bits (270), Expect = 2.473e-23
Identity = 158/706 (22.38%), Postives = 297/706 (42.07%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDI---SMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDIS----LDEIIIKVNAVDADGD----NLRYILLPMTNYFQINN-DGELHLI---QKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGI--KCTETNHETQALRLEKDQMSTDILLIYKLYTVHS-LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHY-----IGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS-GHPSLKSAKTIMVEILDI 2391
            L   M + I I D++DN+P F +  +   + E       V+ + A+ D D     +    I  R S     F ++    R   + +   +D+E ++ +   + A    ++ +     V+++V ++ND  P  +     +     IS      E + +++  D D      N+   L     +F +   D  ++L+     LD E   +++ ++ ATD       A   + + + DVND PP +  +     + E    G  V Q+   DRD   +N  +     ET  ET A   + D  +        L T  S +D ET P  +     +  D G+   L +  ++ + +HD+NDN P+F  S Y V V EN  +G  + +  A+D D G NA++ Y I         F + S +G + +   LD E+++ Y   ++A D+      S +  + + + D NDN P    REY   S+ E+           I  ++A D D G   ++ +++   +      +++ TG +F  +      +++    + +S +  GN+ ++  +V             +FL      ++I+++      E +  +Y VK  I    G V+  V A   DV + S + Y + +   +      F I+  SG I I +PL  D     +V + ++ + G P +     + +E+ D+
Sbjct:  266 LRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYAS-DTDADENGLVEYAINRRQSDKEQMFRID---PRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDE-GLNSALTYSLAETP-ETHAQWFQIDPQT-------GLITTRSHIDCETEP--VPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPREYK-VSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAV-------------VFL------SIIDAMQRPPIFEKARYNYYVKEDIPR--GTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY----FSIETNSGNIRIAKPL--DHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDV 924          

HSP 7 Score: 105.916 bits (263), Expect = 1.655e-22
Identity = 167/632 (26.42%), Postives = 253/632 (40.03%), Query Frame = 1
Query:  709 VTLQVVNINDCAPEFSK-TIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATD----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNF--ICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITY--NIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFK---------LSMDHLYQPLTVNKTGSL----FSNQVFD--------------------------REKKSKVCTQIQLSDS-------------AIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKK-SGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + + V ++ND +PEF   + Y  SV E+ S   +I  V A D D G N  L Y +    + N F I++  GEL   + LD E+H  ++  IQA+D            + I V D ND  P + L+     + E    G  V QI+  D D + +N  +  +  N ETQ  +   D  S  I       TV  LDRE         NF  +  D G        + + +NV DINDN P+F    Y   V      G  L + QA D D+G NA I Y  N + S  S  F I+  TG L   Q L  E      L +VA D+  +  +S    + + + +     P LR   E     + EN P G  +  ++A   D G   ++ F          LS+D L   + VNK   L    FS                               R +++   +   L++S             A    L S+  + + + DENDN P+                       S   +V  +S     G  +A V A D+D  + ++L Y++ +   +N     F I+   SG +  N  L R++  + K+K++  D G P +    TI V+I+D+
Sbjct: 1833 IYITVGDVNDNSPEFRPGSCYGLSVPEN-SEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD-LGVNARLVYSLAN-ETQ-WQFAIDGQSGLIT------TVGKLDRELQAS----YNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG-NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKF----------------------SQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDN----AFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDV 2421          

HSP 8 Score: 103.99 bits (258), Expect = 5.978e-22
Identity = 155/662 (23.41%), Postives = 271/662 (40.94%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDH-SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINN---------DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILN--PEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVH--SLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNAL--ITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIV-----AIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF--SILENLPIGHYIGTLIAFDKDE--GENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQ-IQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKIT 2271
            L S  ++VI + D +DN P+F + +F   + E  ++   V  +  A D D     +   + + G+H +AF +E   S    +R  I +D E +  Y+  + A  +    M+    + +Q+V++ND  P F       +V E   L  +I  ++A D D        L   +   I N          G+L L ++LD+E  Q +   + A+D    A + L + V D ND  P ++    P    I         + +    D D +++N     +E N+      +E  Q    +     + +V+   L       G  +   I  D+G K  L ++  + +  +D       F  +QY+  + E   +G  + Q       +G++AL      I  + +S   ++ S+   + L++PLDRE+ + Y L +V               S    + IT+LD NDN P       +   I E  P+ + I  L A D D+    N+ +++ ++  +     T++  TG LF N   D +  +K     I+  DS     L S     + + DENDN P+  L E                      YV  ++  E VG  +    A+D D     QL+Y +  + S+     +F +D +SG +T
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQV-HAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSG--IVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE---ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAG-KPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQ-------LGQDALDQSLAIIAGNEESAFELLQSKA--IVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTE----------------------YVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVT 2924          

HSP 9 Score: 90.8929 bits (224), Expect = 5.890e-18
Identity = 165/687 (24.02%), Postives = 298/687 (43.38%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDH-------SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSK-----------TIYEESVYEDISLDEIIIKVNAVDAD--GDNLR--YILLPMTNYFQIN-NDGELHL-IQKLDFEKHQSFSFTIQ-----ATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRET---IPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF-PSSQYQVGVKENNDIGYQLFQAQATDEDI--GKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREK-KNQYMLTIVAIDQAVHDRKSGSTQ-LTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL----SMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            +     I + I+D++DN+P F  P   + + E      ++  + +A D D       + YR+  +        S F L+ ++ +   L L   +DYE Q++Y   + A   +D +  A   +T++V + ND AP F              I E  + E +S+D  ++ VNA DAD  G+N +  YI+ P    F ++ ++G + + + +L      S  + ++     A      + + L++   D       ++ N  +  I E    G +V Q+    +D+  +++ +     N E+          + ++L    +  V  LDRE        ++ ++             + IS+ + + D NDN P+F  S++Y+  + E   + Y + Q QA D D     N+ + Y+I    D  +F ID  TG L +   LD +     Y L I A D   H R   S Q   + + D+NDN P+  L EY  F + EN P+G  +    A D D+G   ++ + +    S +  ++   V+ ++G + S  VFD E++ +   ++  SD  +G    S V+V V I   ++  PQ                   +TE +   +V+  ++    G+V+  V ATD+D     ++ Y L      +   S F +++ SG + I R L  D
Sbjct: 2408 MTGTATIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSI-SANDVDTY---PALTYRLGAESTVDIENMSIFALDRYSGK---LVLKRRLDYELQQEYELDVIA---SDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISE--ISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL---GQDA--LDQSLAIIAGNEES----------AFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSH-HQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF-LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD--MGGKKAS-VAVRVEIESRDEFTPQ-------------------FTERT-YRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL------SAPHSHFKVNRSSGAVLIKRKLKLD 3035          

HSP 10 Score: 88.9669 bits (219), Expect = 2.691e-17
Identity = 177/798 (22.18%), Postives = 329/798 (41.23%), Query Frame = 1
Query:  202 SYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND-ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYIL------LPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEP---PSYILNPE--KLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDI------LLIYKLYTVHSLDRETIPDGIIYTNFICY-------DSGIKRQLYTNISIPLNVHDIND----------NAPLFPS-SQYQVGVKENNDIGYQLFQAQ-------------------ATDEDIGKNALITYNIQFSVDSGLFVIDSR-TGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLY--QPLTV----NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDV-NNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLI---GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            S + G + + FSID  SG++ + + +D E     +   + S       +  + K+      I I + D +DN P F+  ++T  ++E       V+ + +AVD D+ + N  + Y ++ +    F ++  +     +  +  +D E Q  Y F + A      E  SA + V + V++IND  P F +  Y   V   I   + ++KV A+DAD G N   +         ++  F+IN + G L   Q L  E  +     + A D     +S L +  L + + P   P      E  ++++ E + SG  + Q+     D             N +     L  D +S +I      LL Y  ++  S+   +    + Y   I         +S   ++  T+ S  L     N+          +AP   S ++  + +++ ND   +  Q Q                   A D D G NA + Y+I        FVI+   +G ++    LDRE ++ Y L I+A D+ V  + +G+  + + ++D NDN P        ++ E   +G  I ++ A D D      + ++L  +     + +++      +G L   +  D E + +    +  SD+A      +   + V + DENDN P +FL ++                 + +  + ++S    V F +  V ATD D   N S++ Y +E +      Q  F +   +G +++N    +  +   G   V+++ +D+G P+LKS+  + V+  D
Sbjct: 1885 SITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQAS-------DRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQI-SAVDADLGV-NARLVYSLANETQWQFAIDGQSGL---ITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGI---LSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGV-PQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAP-VFLAQQPPAYF------------AILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA------QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQAND 2640          

HSP 11 Score: 51.2174 bits (121), Expect = 8.097e-6
Identity = 129/588 (21.94%), Postives = 244/588 (41.50%), Query Frame = 1
Query:  646 QYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT--NYFQINN--DGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRD---SVSINRGIKCTE--TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF----PSSQYQV-----GVKENNDIGYQLFQAQATDEDI-GKNALITYNIQFSVDSGLFVIDSRTGWLKL----MQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLS-----DSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNV--SQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            + R  L A   +   +++   + +++ + ND +P+FS+  +  +V E  +    + +V+A D+D G N  LRY ++     N F I     G +     LD E    +   I ATD    +    + +++ ++DVND  P++   P  LV + E  + G ++  I+  D D   +++   G + T    N    AL     ++     L Y+L   + LD             I  D+  + +    +     V+D NDNAP+F    P + + +      + E+  + + L    ATD D  G N+ + Y I+ + +   F +    G + +    +QP        Y + I+A D      KS ST L +   D+     + L+      I E  P+G  +   +   +D  + +  +   + +  ++ L   ++ ++   +  DRE+      ++ LS             +S +SV + ILD NDN+P               +F+ +        Y  ++S    + + IA ++A D D  N   S++ Y + +   E++    F ID  +G + +N  L  D
Sbjct: 2287 EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELD------------VIASDAAHEARTVLTV----RVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPA-VSSSGDYFVRIIAKDAGKPALKS-STLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVV---LQLGQDALDQSLAIIAGNEESAFELL---QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFP---------------IFDRS------AKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM----FTIDLVTGVLFVNNRLDYD 2821          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 186.037 bits (471), Expect = 4.797e-47
Identity = 197/683 (28.84%), Postives = 320/683 (46.85%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD----HSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYK----LYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARI-MFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++I + D +DN P+F+   ++  + E    K + +   +A D D +  N +I Y +  D     + F+++ ++     + LL  +D E Q +Y F + A         A + VT+++V+ ND AP F   I   SV+E+     ++I +  +D D +        ++      FQI   GEL + + LD E+   ++ +I ATDG+F A++ ++I V D+ND  P Y L P   +   TN+S I +G   V           +K  + + +++ LR        D   I K    L    +LDRET P   +  + +       ++ ++ I I +N  DINDN P+F  +QY+V V E+  +   + +  A D+D G N  I Y++    +   F I   TG ++L + LDRE  + + LT+ A D  V    S +T + + +LD NDN PE  +R+Y+   ILEN   G  +  + A   D G NA I  F +S +   +    + TG L  N   D E        IQ  D      L+++  V ++ILD NDN P              +   N Y  + N D          VG  I  VKATD D +    ++Y +E    +N+ Q  F ID K+G I+++RPL R+ I    +++   D G P   ++  I + ILD
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAEN-SEKVISLVKVSATDAD-TGPNGDIRYYLESDTENIQNIFDIDIYSGW---ITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP-YCLKPRYHI--STNES-ISIGTTLV----------EVKAIDFDFQSK-LRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAH-VQDGKDFTQECFSEIIITVN--DINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSL-MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIAT-VAVNILDINDNPPEFSMRQYS-CKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP-LSNNAYVNISILDINDNSP--------------TFLQNLYRINVNEDIF--------VGSKILDVKATDEDSDVNGLVTYNIER--GDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILD 3475          

HSP 2 Score: 160.999 bits (406), Expect = 2.544e-39
Identity = 194/722 (26.87%), Postives = 323/722 (44.74%), Query Frame = 1
Query:  247 KSGDIHTLKVIDLEALCF---NSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT-NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL-------IYKLY--TVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL--ENLPIGHYIGTLIAFDKDEGENAR-IMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS-IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS 2337
            KSG++   K +D E L F   +  A     T   NV ++              + DI+DN P   KP + +   E I     ++ +  A+D D   K   + + +SG  +  F++ + +     L++   +D E   +Y+         D +      + + V +IND  P FS   Y  SV ED  L+ +I KV+A+D D G N  ++Y L+    +YF+I+ + G + L + LD E    F+ T++A D    +  + + + + +LD+ND PP + +      I E    G  V ++     D + +N  I     +   Q  + + D  + D++L       + K Y  T+ ++D  T P              +    Y NISI     DINDN+P F  + Y++ V E+  +G ++   +ATDED   N L+TYNI+   + G F ID + G + + +PLDRE  + Y L I A DQ    ++  S  + I +LD NDNAP +   +++S++  EN  +G+   T    D DE  N     F +   +      + + GSL +   F+   + +   Q+++ D+     L S   V V I++E+   P +   E      INS F + ++                 G  I  V A+D D     +L++ L +   +  Q S +F+I   +GKI     L    IGL K+ V V D 
Sbjct: 3018 KSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEID--------------VKDINDNTPYCLKPRYHISTNESISIGTTLVEV-KAIDFDFQSK---LRFYLSGKGADDFSIGKESGI---LKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID-IGVNADIHYFIMSGNEQG-KFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP--------------LSNNAYVNISI----LDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQG-DPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPP-LYSDAWVVVKIIEESQYPPIVTPLE----VTINS-FEDDFS-----------------GAFIGKVHASDQD--KYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSDG 3668          

HSP 3 Score: 159.458 bits (402), Expect = 8.873e-39
Identity = 195/773 (25.23%), Postives = 344/773 (44.50%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-------DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRF--TLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRY-ILLPMTN-YFQINNDGELHLIQKLDF---EKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVF-----DRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            I EN PI TFV ++          +   G I + F I+P +G I     ID E++             +L V         S   I+I ILD +DN P F + E+   + E     + V+ +  +    ++++ K+    ++G       D  A N  + +S    + LL  +DYE    Y F  T+S   K     +   +VT++V+N+NDC P F++     +++     +  + +V+A DAD D LR+ I+   TN  FQI     +   +  +    E  + ++  ++A+DG F A   +KI VL   D   ++     +    E N     +G + V      +     I    +  +    + AL+        ++  +Y+L+      +  + DG+        +S ++R +    SI ++V D+NDN PLF +  Y   V  ++  G  + Q +A D D  +N  + Y ++   +  LF +D ++G L + Q ++   +N Y LT+ A D A+    S    L + V+D +    E + YT  S+ E++ +  Y    ++ + +      +++ +S +     +  N TGS+F     D EK S     I+ +DS  G  + + V + V+I+D ND YP+I   E D       ++N T  E+++             G  I  + ATDND    ++LSYY+E+   +N    +F ID   G + +  PL  + I    + V V+D G PSL S   + + + D+
Sbjct: 1726 IFENLPIGTFVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESI----------KVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEA---KSMLYDGM--------NSNVRRAV---TSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG-NGELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAI-TPCSSEAPLQVKVIDRSMPVFEKQFYT-VSVKEDVEM--YSALSVSIEAESPLGRSLIYTISSESQSFEIDYN-TGSIFVVNELDYEKISSHDVSIRATDSLSG--VYAEVVLSVSIMDVNDCYPEI---ESD-------IYNLTIPENAS------------FGTQILKINATDNDSGANAKLSYYIESINGQN-NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDL 2442          

HSP 4 Score: 149.058 bits (375), Expect = 1.110e-35
Identity = 188/731 (25.72%), Postives = 312/731 (42.68%), Query Frame = 1
Query:  418 KPEFEK-PEFTMEIKEVIHRKNMVIYLPA----AVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND----ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNY----FQINN-DGELHLIQKLDFEK-HQSFSFTIQATDGEFV----AESKLKITVLDVNDEPPSYILNPEKL-VIDETNKSGILVGQITV------------------------FDRDSVSINRGIKC-----TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGII---YTNFICYDSGIKRQL-------------------YTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            KPE +  P FT EI EV   +   I +P       D D+  KN  +   + G +       +   G  L     +D EK+  Y  T+SA  + +    +  SA + +++Q +N ND  P F       S+ E+      ++K+ A D D     YI   + N     F+I++  G +     LDFE   +++   I+A+D         E KL I V D+ND  P +    E++    +  KS  +  ++ V                        F+ D  S +  I C     T TN   +    +    S D+++      VH +  +   D  I   + +F C ++G+ R+L                   ++++S+  + +  N + P F +   ++ + E+  +G  +   +A D D+G N  + + I       +F ID   G L+++  LDRE++N+Y+L I   D   +  KS S  L IT+LD NDN P +++    F + E+  IG  +  L A D D G NA++ + LS++      TVN  TG L  N+  DREK+      I   D     VL+S   V V + D NDN P   + E                      Y+ K+      G V+AV++A D D+   +++ + L+    E   + +F IDK +G I     L  +   +  + V   D G PSL S  +I++ I+D+
Sbjct:  391 KPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLG-KNALVYLEIVGGNEGDEFRINPDSG-MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDND--PIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF----ERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLII-----NVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLG-NPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVE--CSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG-SPVLSSEALVYVLVDDVNDNAPVFGVQE----------------------YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLK---EETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV 1079          

HSP 5 Score: 145.591 bits (366), Expect = 1.539e-34
Identity = 175/640 (27.34%), Postives = 285/640 (44.53%), Query Frame = 1
Query:  529 NKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLID-------IDYEKQKQYRFTLSAY----QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFV-------AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE-TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPELREYTD-FSILENLPIGHYIGTLIAFDKDEGENARIMFKLS--------MDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGH 2343
            N E+ YR+ SGD       E    G    L I        ++ EK ++Y   + A+     +N  S     N+ ++V++ ND +P F  T Y   + ED    + I+KV A DAD G N  + Y LL  + YF I+   GE+ L+Q+L + ++  F  T+ A D G +V       +++K+ I+V  VN   P         V   +N   ++ G + V D+D+  IN  I   E  +       L K   + D   I +L     L+++     I     +  D G  R+ +   S+P+ +   + N P+F    Y+V + E   I   + + + +D D+GKNAL+   I    +   F I+  +G L   + LD EKK+ Y LT+ AIDQA V  RK  S ++ I+V D NDN P         SI EN   G ++  L A D+D GEN+ I + ++        +DH      + KT SL   +   R  +      I+ SD  +     + + + + + D NDN PQ   +E+                   V+   K++    +G  + V  A D D  ++  +SY L    S+  +   F++D  SG ++I+  L +  +  + +KV   D  H
Sbjct:   97 NAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNP--LIYGIVRVNDKDT-GINGNIGRLEIVDGNPDGTFLLKAAETKDEYYI-ELNQFAHLNQQHF---IYNLTLLAEDLGTPRR-FAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS---GIVKTTSLLDFETMKRNYE----LIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ---FER-------------------VNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRL----SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH 693          

HSP 6 Score: 144.436 bits (363), Expect = 3.329e-34
Identity = 189/736 (25.68%), Postives = 312/736 (42.39%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTL-KVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGP-RLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESV--YEDISLDEIIIKVNAVDADGDNLRYILLPMT--NYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQI----FLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            G +   F ID K+G I T  + +D E        ++    + + ++ N    L S  +IV+ +LDI+DN PEF++  + +++       N  I+   A+D D S +N  I Y +            + RG   +   +D D E +   +   +   K  ++   N+ V     N  + AP   +   E  V   E+     ++ ++ AVD D D L Y +      N F I  D G + L + LD+E  QS++ TI  TDG F A + L + V+D+ND PP +  +   + I E  +   ++ Q+   DRD    +   +  T+        R+  D +S ++++  +L      D E     I+   F+       ++ Y  I +  NVHD ND+ P F +   Q  V E+  IG +L + +A D D G NA I Y+I       +F ID   G + L   L+  K  +YML + A+D       S      I  + +ND            I ENLPIG ++  + A       ++ I F +   ++ +   +N  TG +  N   D E        ++ ++ A     +S  ++ ++ILD NDN P      ++    E+  I S             YV+K+    K    + V    D DV     + Y++     ++L ++ F ID  +G I + R L  +        V V D G P L S  T  V I
Sbjct: 1235 GNLVGYFEIDSKTGVIKTTERKLDRE--------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA-TVNQSIFQVHAIDSD-SGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQN-APLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI--DSISGNVIVTQRL------DFEKTAQHILIV-FVKDQGAPGKRNYAKIIV--NVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA-----RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGS-------------YVLKVHDSSKDHLTLQV---KDADVGVNGMVEYHI----VDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTI 1920          

HSP 7 Score: 140.584 bits (353), Expect = 5.014e-33
Identity = 175/605 (28.93%), Postives = 267/605 (44.13%), Query Frame = 1
Query:  658 TLSAYQKND-----ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILL----PMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-----VSINRGIKCTE--TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV-DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDN--APELREYT-DFSILENLPIGHYIGTLIAFDKDEGE-NARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            TLS  +KN+      S+ +++++T      N   PEF     E S+ E + L E +  + A D D G N + +         + F+I+ D GEL +I  LD E+   +   I   D     +S    L IT+LDVND  P          + E+ + G +V  +   D DS     V+    ++C++   N  T  LRL K                  LDRE   +   Y   I    G    L +   + + V D+NDNAP+F   +Y   V+E+   G  L   +A DEDIG NA I ++++    D  LF ID  TG ++    LD E K  + L + AID       S    + I ++D N+N  APE  ++  +  + EN P G ++  + A D D  + N++I + ++         VN  GS+ S    D E K+     +   D AI   L++ V V + + +ENDN P   L +K    +     N T     NV+              I  +KA D D++    ++Y   N  S NL    F+ID K+G I T  R L R+      ++V + D+G P L S   I+V +LDI
Sbjct:  736 TLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNK-----------------PLDREKQDN---YALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTS-DMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVP-LSNCVEVYIQVENENDNIP---LTDKPVYYV-----NVTEASVENVE--------------IITLKAFDPDIDPTQTITY---NIVSGNLV-GYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDI 1292          

HSP 8 Score: 139.428 bits (350), Expect = 1.048e-32
Identity = 199/792 (25.13%), Postives = 341/792 (43.06%), Query Frame = 1
Query:  118 QKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLI--------TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNV----NRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN---YFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDE--PPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQ-PLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVK--------MSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            Q+ +I E+  +   V  I+ AK  D +L Y+  L+          +F IDP  G++  +  +D E         +++  + LN+ V    N  K+   ++ I I  LD++DN+P  +K   T  + E   R   V++   A D D S  N ++ Y +S + S F +   N+    LRL   +D EKQ  Y   ++A       +S+   V + V ++ND AP F    Y   V ED+    ++  + AVD D G N  +++ L   T     F+I+ + G +     LD+E  Q  +  + A DG      ++  + I ++DVN+    P +     +  + E    G  V  +T  D D+V +N  I  + T  +   +    DQ S        + ++  LD ET      Y   +C        L   + + + V + NDN PL     Y V V E +    ++   +A D DI     ITYNI      G F IDS+TG +K  +  LDRE + +++L  VAI        S ++++ ++VLD NDN+PE  +      +  +  +   I  + A D D GEN RI + +            K+G          + K+K     Q     I   L S     ++I  E++  P+     K +T  +N +         N   +V+        ++  +K GF++  + A D+D +   QL Y + N   +N     F I + +G I +++ L  +      + + V D    +  +   ++V+++DI
Sbjct:  777 QELSINESVQLGETVAWIE-AK--DRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---------RQNEYV-LNITVYDLGNPTKSTSKMLPITI--LDVNDNRPVIQKTLATFRLTESA-RIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTV---NATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGS--------ITSLSQLDAET---KNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILE-VAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI------------KSG----------KGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPK-----KSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDND---QLWYNISNGNDDN----TFYIGQDNGNILLSKYLDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDI 1499          

HSP 9 Score: 137.117 bits (344), Expect = 5.022e-32
Identity = 181/768 (23.57%), Postives = 348/768 (45.31%), Query Frame = 1
Query:  187 IDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNIND--CAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRY-ILLPMTN-----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAES---KLKITVLDVND-----EPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKL--------YTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQ---LTITVLDDNDNAPELREYTDFSIL---ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I+ +++Y+  +    F+++  +G +   K +D E         +++  + +         L S   + +++ D++DN P F   E+  +++E + R   V+ +  AVD+DI   N EI + +   + D   F +++H      +R    +DYE ++ +   +SA    D S++++M++ + ++++N+   APEF   +YE  V E+      ++ V A D D  +L   I   +T       F +N+ G +  + +LD E    +  T+ A D   V  S   ++ I V + ND     + P Y +N     + E +   + +  +  FD D       I  T+T        +  + +S +++  +++         T   LDRE   + I+       D+G    L +   I ++V DINDN+P F    Y+V V  +  +   +FQ  A D D G+N  ITY+I+       F IDS+ G + + +PLD +  N++ + I A D  +  +KS + +   + + V  ++ NAP +   T  +++   EN   G  +  ++A D D   N ++ + +S  +      + +  G++  ++  D E +      I ++D       T+  ++ V ++D NDN PQ   + KD               H N    +  +I E+   VI  + ATD D +   +L Y+L ++  +    ++F ID  SG + + + L  +      + V V+D G P  ++   I+V + D
Sbjct:  908 INAQVTYALSVECSDFTVNATTGCLRLNKPLDREK--------QDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPR-GTVLAVIEAVDEDIG-PNAEIQFSLKEETQDEELFRIDKHTGA---IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVN-----VTEASVENVEIITLKAFDPD-------IDPTQT--------ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHIL--EVAISDNG-SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGI-PKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGT----FTAFTNLLVQVIDINDNPPQ---FAKD-------------VYHVN----ISENIEEES--VIMQLHATDRDED--KKLFYHL-HATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHD 1604          

HSP 10 Score: 136.346 bits (342), Expect = 9.009e-32
Identity = 196/774 (25.32%), Postives = 331/774 (42.76%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRIK-FAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVI------DLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMS-GDHSAFNLEEHNSRGPRLRLLIDIDYEKQ-KQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISL-DEIIIKVNAVDADGDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG--EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS---VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +F+  EN      +G +      +DE + Y     T +F I   SG + T  VI      DL  L   +   K      +N NV R     +V  I I +LD++DN P F    +   +  +   K  +I    A+D D S +N E+ Y +  G+   F L+  +       L I    E   + Y  T++AY       S+     LQV  I+   P F K  Y  SV ED+ +   + + + A    G +L Y +   +  F+I+ N G + ++ +LD+EK  S   +I+ATD      AE  L ++++DVND  P    +   L I E    G  + +I   D DS     ++  I+     + ++   ++     TD      LY    LD E I    I  N    D G    L +  ++ + V D+NDNAP F    Y   V      G  +   +A D+DI     + Y I +  +   + ID  TG + L   L+   K+  +L I ++   VH   +   +L I++L +N  +P   + T +  + ENL  GH I T+ A D D G  A + +++  + + +   +++T  + +++V FDREKK +    +++SD   G       S+ V ++D NDN P   L E                      Y + +S   +    I  VKA D+D+ +   + + +   +++   + + +I++K+G I          +   +  V   D G P   S   + +EI++
Sbjct: 2039 RFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEA---KSMLYDGMNSNVRR-----AVTSIDISVLDVNDNCPLFVNMPYYATVS-IDDPKGTIIMQVKAIDLD-SAENGEVRYELKKGNGELFKLDRKSGE-----LSIKQHVEGHNRNYELTVAAYDGAITPCSSE--APLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYID----VTD----GNLYLKTPLDYEQIKYHHIVVNV--KDHG-SPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNI-SVSDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSD---GGGKFGFASLKVIVVDVNDNVPYFLLKE----------------------YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIE 2755          

HSP 11 Score: 129.798 bits (325), Expect = 9.240e-30
Identity = 179/689 (25.98%), Postives = 286/689 (41.51%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISM-KNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT----NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITV--LDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD-QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL-SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S + + I I++ D N P FEK    ++I E           P  V   + M  N    + ++ D   F +    S    L L   +D E+Q+ +   + A         A  +V + V + ND  P+F  T Y  SV E+      ++KV+A DAD G N  +RY L   T    N F I+   G + L+  LD E    ++F + A D G    ++K+ +T+  +D ND  P + L  E L + E    G ++  + + D D               E     +  D Q    I    +L+    LDRE +   + Y   I    G   +     ++ ++V DINDN P     +Y +   E+  IG  L + +A D D  ++ L  Y      D   F I   +G LK+   LDRE   +Y L +  +       +   +++ ITV D NDN P   + +Y   S+ E+  +   I  + A DKD G N +I + L   +H Y  ++   TG +  ++  DRE  S     ++  D  +   L S  +V VNILD NDN P                      E S   Y  K+      G  +  V AT  D+   + + Y++ +      +Q  F +D  +G + +N  L  ++     + +   D G P L +   + + ILDI
Sbjct: 2745 SEVPVSIEIIETDANIPTFEKSSVLLKIIESTP--------PGTVLTKLHMIGNYTFKFSIAADQDHFMI----SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-----------EKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQL---MFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF-QSKLRFYLSGKGADD--FSIGKESGILKVASALDRETTPKYKL-VAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYR-VSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKIS-KSTGIIRLHKSLDRETISLFNLTVKAEDCGVPK-LHSIATVAVNILDINDNPP----------------------EFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGN----EQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDI 3371          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 186.037 bits (471), Expect = 4.797e-47
Identity = 197/683 (28.84%), Postives = 320/683 (46.85%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD----HSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYK----LYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARI-MFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++I + D +DN P+F+   ++  + E    K + +   +A D D +  N +I Y +  D     + F+++ ++     + LL  +D E Q +Y F + A         A + VT+++V+ ND AP F   I   SV+E+     ++I +  +D D +        ++      FQI   GEL + + LD E+   ++ +I ATDG+F A++ ++I V D+ND  P Y L P   +   TN+S I +G   V           +K  + + +++ LR        D   I K    L    +LDRET P   +  + +       ++ ++ I I +N  DINDN P+F  +QY+V V E+  +   + +  A D+D G N  I Y++    +   F I   TG ++L + LDRE  + + LT+ A D  V    S +T + + +LD NDN PE  +R+Y+   ILEN   G  +  + A   D G NA I  F +S +   +    + TG L  N   D E        IQ  D      L+++  V ++ILD NDN P              +   N Y  + N D          VG  I  VKATD D +    ++Y +E    +N+ Q  F ID K+G I+++RPL R+ I    +++   D G P   ++  I + ILD
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAEN-SEKVISLVKVSATDAD-TGPNGDIRYYLESDTENIQNIFDIDIYSGW---ITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP-YCLKPRYHI--STNES-ISIGTTLV----------EVKAIDFDFQSK-LRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAH-VQDGKDFTQECFSEIIITVN--DINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSL-MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIAT-VAVNILDINDNPPEFSMRQYS-CKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP-LSNNAYVNISILDINDNSP--------------TFLQNLYRINVNEDIF--------VGSKILDVKATDEDSDVNGLVTYNIER--GDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILD 3475          

HSP 2 Score: 160.999 bits (406), Expect = 2.544e-39
Identity = 194/722 (26.87%), Postives = 323/722 (44.74%), Query Frame = 1
Query:  247 KSGDIHTLKVIDLEALCF---NSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT-NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL-------IYKLY--TVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL--ENLPIGHYIGTLIAFDKDEGENAR-IMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS-IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS 2337
            KSG++   K +D E L F   +  A     T   NV ++              + DI+DN P   KP + +   E I     ++ +  A+D D   K   + + +SG  +  F++ + +     L++   +D E   +Y+         D +      + + V +IND  P FS   Y  SV ED  L+ +I KV+A+D D G N  ++Y L+    +YF+I+ + G + L + LD E    F+ T++A D    +  + + + + +LD+ND PP + +      I E    G  V ++     D + +N  I     +   Q  + + D  + D++L       + K Y  T+ ++D  T P              +    Y NISI     DINDN+P F  + Y++ V E+  +G ++   +ATDED   N L+TYNI+   + G F ID + G + + +PLDRE  + Y L I A DQ    ++  S  + I +LD NDNAP +   +++S++  EN  +G+   T    D DE  N     F +   +      + + GSL +   F+   + +   Q+++ D+     L S   V V I++E+   P +   E      INS F + ++                 G  I  V A+D D     +L++ L +   +  Q S +F+I   +GKI     L    IGL K+ V V D 
Sbjct: 3018 KSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEID--------------VKDINDNTPYCLKPRYHISTNESISIGTTLVEV-KAIDFDFQSK---LRFYLSGKGADDFSIGKESGI---LKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID-IGVNADIHYFIMSGNEQG-KFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP--------------LSNNAYVNISI----LDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQG-DPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPP-LYSDAWVVVKIIEESQYPPIVTPLE----VTINS-FEDDFS-----------------GAFIGKVHASDQD--KYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSDG 3668          

HSP 3 Score: 159.458 bits (402), Expect = 8.873e-39
Identity = 195/773 (25.23%), Postives = 344/773 (44.50%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-------DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRF--TLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRY-ILLPMTN-YFQINNDGELHLIQKLDF---EKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVF-----DRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            I EN PI TFV ++          +   G I + F I+P +G I     ID E++             +L V         S   I+I ILD +DN P F + E+   + E     + V+ +  +    ++++ K+    ++G       D  A N  + +S    + LL  +DYE    Y F  T+S   K     +   +VT++V+N+NDC P F++     +++     +  + +V+A DAD D LR+ I+   TN  FQI     +   +  +    E  + ++  ++A+DG F A   +KI VL   D   ++     +    E N     +G + V      +     I    +  +    + AL+        ++  +Y+L+      +  + DG+        +S ++R +    SI ++V D+NDN PLF +  Y   V  ++  G  + Q +A D D  +N  + Y ++   +  LF +D ++G L + Q ++   +N Y LT+ A D A+    S    L + V+D +    E + YT  S+ E++ +  Y    ++ + +      +++ +S +     +  N TGS+F     D EK S     I+ +DS  G  + + V + V+I+D ND YP+I   E D       ++N T  E+++             G  I  + ATDND    ++LSYY+E+   +N    +F ID   G + +  PL  + I    + V V+D G PSL S   + + + D+
Sbjct: 1726 IFENLPIGTFVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESI----------KVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEA---KSMLYDGM--------NSNVRRAV---TSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG-NGELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAI-TPCSSEAPLQVKVIDRSMPVFEKQFYT-VSVKEDVEM--YSALSVSIEAESPLGRSLIYTISSESQSFEIDYN-TGSIFVVNELDYEKISSHDVSIRATDSLSG--VYAEVVLSVSIMDVNDCYPEI---ESD-------IYNLTIPENAS------------FGTQILKINATDNDSGANAKLSYYIESINGQN-NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDL 2442          

HSP 4 Score: 149.058 bits (375), Expect = 1.110e-35
Identity = 188/731 (25.72%), Postives = 312/731 (42.68%), Query Frame = 1
Query:  418 KPEFEK-PEFTMEIKEVIHRKNMVIYLPA----AVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND----ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNY----FQINN-DGELHLIQKLDFEK-HQSFSFTIQATDGEFV----AESKLKITVLDVNDEPPSYILNPEKL-VIDETNKSGILVGQITV------------------------FDRDSVSINRGIKC-----TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGII---YTNFICYDSGIKRQL-------------------YTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            KPE +  P FT EI EV   +   I +P       D D+  KN  +   + G +       +   G  L     +D EK+  Y  T+SA  + +    +  SA + +++Q +N ND  P F       S+ E+      ++K+ A D D     YI   + N     F+I++  G +     LDFE   +++   I+A+D         E KL I V D+ND  P +    E++    +  KS  +  ++ V                        F+ D  S +  I C     T TN   +    +    S D+++      VH +  +   D  I   + +F C ++G+ R+L                   ++++S+  + +  N + P F +   ++ + E+  +G  +   +A D D+G N  + + I       +F ID   G L+++  LDRE++N+Y+L I   D   +  KS S  L IT+LD NDN P +++    F + E+  IG  +  L A D D G NA++ + LS++      TVN  TG L  N+  DREK+      I   D     VL+S   V V + D NDN P   + E                      Y+ K+      G V+AV++A D D+   +++ + L+    E   + +F IDK +G I     L  +   +  + V   D G PSL S  +I++ I+D+
Sbjct:  391 KPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLG-KNALVYLEIVGGNEGDEFRINPDSG-MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDND--PIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF----ERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLII-----NVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLG-NPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVE--CSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG-SPVLSSEALVYVLVDDVNDNAPVFGVQE----------------------YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLK---EETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV 1079          

HSP 5 Score: 145.591 bits (366), Expect = 1.539e-34
Identity = 175/640 (27.34%), Postives = 285/640 (44.53%), Query Frame = 1
Query:  529 NKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLID-------IDYEKQKQYRFTLSAY----QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFV-------AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE-TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPELREYTD-FSILENLPIGHYIGTLIAFDKDEGENARIMFKLS--------MDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGH 2343
            N E+ YR+ SGD       E    G    L I        ++ EK ++Y   + A+     +N  S     N+ ++V++ ND +P F  T Y   + ED    + I+KV A DAD G N  + Y LL  + YF I+   GE+ L+Q+L + ++  F  T+ A D G +V       +++K+ I+V  VN   P         V   +N   ++ G + V D+D+  IN  I   E  +       L K   + D   I +L     L+++     I     +  D G  R+ +   S+P+ +   + N P+F    Y+V + E   I   + + + +D D+GKNAL+   I    +   F I+  +G L   + LD EKK+ Y LT+ AIDQA V  RK  S ++ I+V D NDN P         SI EN   G ++  L A D+D GEN+ I + ++        +DH      + KT SL   +   R  +      I+ SD  +     + + + + + D NDN PQ   +E+                   V+   K++    +G  + V  A D D  ++  +SY L    S+  +   F++D  SG ++I+  L +  +  + +KV   D  H
Sbjct:   97 NAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNP--LIYGIVRVNDKDT-GINGNIGRLEIVDGNPDGTFLLKAAETKDEYYI-ELNQFAHLNQQHF---IYNLTLLAEDLGTPRR-FAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS---GIVKTTSLLDFETMKRNYE----LIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ---FER-------------------VNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRL----SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH 693          

HSP 6 Score: 144.436 bits (363), Expect = 3.329e-34
Identity = 189/736 (25.68%), Postives = 312/736 (42.39%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTL-KVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGP-RLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESV--YEDISLDEIIIKVNAVDADGDNLRYILLPMT--NYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQI----FLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            G +   F ID K+G I T  + +D E        ++    + + ++ N    L S  +IV+ +LDI+DN PEF++  + +++       N  I+   A+D D S +N  I Y +            + RG   +   +D D E +   +   +   K  ++   N+ V     N  + AP   +   E  V   E+     ++ ++ AVD D D L Y +      N F I  D G + L + LD+E  QS++ TI  TDG F A + L + V+D+ND PP +  +   + I E  +   ++ Q+   DRD    +   +  T+        R+  D +S ++++  +L      D E     I+   F+       ++ Y  I +  NVHD ND+ P F +   Q  V E+  IG +L + +A D D G NA I Y+I       +F ID   G + L   L+  K  +YML + A+D       S      I  + +ND            I ENLPIG ++  + A       ++ I F +   ++ +   +N  TG +  N   D E        ++ ++ A     +S  ++ ++ILD NDN P      ++    E+  I S             YV+K+    K    + V    D DV     + Y++     ++L ++ F ID  +G I + R L  +        V V D G P L S  T  V I
Sbjct: 1235 GNLVGYFEIDSKTGVIKTTERKLDRE--------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA-TVNQSIFQVHAIDSD-SGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQN-APLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI--DSISGNVIVTQRL------DFEKTAQHILIV-FVKDQGAPGKRNYAKIIV--NVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA-----RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGS-------------YVLKVHDSSKDHLTLQV---KDADVGVNGMVEYHI----VDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTI 1920          

HSP 7 Score: 140.584 bits (353), Expect = 5.014e-33
Identity = 175/605 (28.93%), Postives = 267/605 (44.13%), Query Frame = 1
Query:  658 TLSAYQKND-----ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILL----PMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-----VSINRGIKCTE--TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV-DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDN--APELREYT-DFSILENLPIGHYIGTLIAFDKDEGE-NARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            TLS  +KN+      S+ +++++T      N   PEF     E S+ E + L E +  + A D D G N + +         + F+I+ D GEL +I  LD E+   +   I   D     +S    L IT+LDVND  P          + E+ + G +V  +   D DS     V+    ++C++   N  T  LRL K                  LDRE   +   Y   I    G    L +   + + V D+NDNAP+F   +Y   V+E+   G  L   +A DEDIG NA I ++++    D  LF ID  TG ++    LD E K  + L + AID       S    + I ++D N+N  APE  ++  +  + EN P G ++  + A D D  + N++I + ++         VN  GS+ S    D E K+     +   D AI   L++ V V + + +ENDN P   L +K    +     N T     NV+              I  +KA D D++    ++Y   N  S NL    F+ID K+G I T  R L R+      ++V + D+G P L S   I+V +LDI
Sbjct:  736 TLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNK-----------------PLDREKQDN---YALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTS-DMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVP-LSNCVEVYIQVENENDNIP---LTDKPVYYV-----NVTEASVENVE--------------IITLKAFDPDIDPTQTITY---NIVSGNLV-GYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDI 1292          

HSP 8 Score: 139.428 bits (350), Expect = 1.048e-32
Identity = 199/792 (25.13%), Postives = 341/792 (43.06%), Query Frame = 1
Query:  118 QKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLI--------TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNV----NRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN---YFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDE--PPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQ-PLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVK--------MSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            Q+ +I E+  +   V  I+ AK  D +L Y+  L+          +F IDP  G++  +  +D E         +++  + LN+ V    N  K+   ++ I I  LD++DN+P  +K   T  + E   R   V++   A D D S  N ++ Y +S + S F +   N+    LRL   +D EKQ  Y   ++A       +S+   V + V ++ND AP F    Y   V ED+    ++  + AVD D G N  +++ L   T     F+I+ + G +     LD+E  Q  +  + A DG      ++  + I ++DVN+    P +     +  + E    G  V  +T  D D+V +N  I  + T  +   +    DQ S        + ++  LD ET      Y   +C        L   + + + V + NDN PL     Y V V E +    ++   +A D DI     ITYNI      G F IDS+TG +K  +  LDRE + +++L  VAI        S ++++ ++VLD NDN+PE  +      +  +  +   I  + A D D GEN RI + +            K+G          + K+K     Q     I   L S     ++I  E++  P+     K +T  +N +         N   +V+        ++  +K GF++  + A D+D +   QL Y + N   +N     F I + +G I +++ L  +      + + V D    +  +   ++V+++DI
Sbjct:  777 QELSINESVQLGETVAWIE-AK--DRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---------RQNEYV-LNITVYDLGNPTKSTSKMLPITI--LDVNDNRPVIQKTLATFRLTESA-RIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTV---NATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGS--------ITSLSQLDAET---KNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILE-VAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI------------KSG----------KGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPK-----KSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDDND---QLWYNISNGNDDN----TFYIGQDNGNILLSKYLDYETQQSYNLTISVTDG---TFTAFTNLLVQVIDI 1499          

HSP 9 Score: 137.117 bits (344), Expect = 5.022e-32
Identity = 181/768 (23.57%), Postives = 348/768 (45.31%), Query Frame = 1
Query:  187 IDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNIND--CAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRY-ILLPMTN-----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAES---KLKITVLDVND-----EPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKL--------YTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQ---LTITVLDDNDNAPELREYTDFSIL---ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I+ +++Y+  +    F+++  +G +   K +D E         +++  + +         L S   + +++ D++DN P F   E+  +++E + R   V+ +  AVD+DI   N EI + +   + D   F +++H      +R    +DYE ++ +   +SA    D S++++M++ + ++++N+   APEF   +YE  V E+      ++ V A D D  +L   I   +T       F +N+ G +  + +LD E    +  T+ A D   V  S   ++ I V + ND     + P Y +N     + E +   + +  +  FD D       I  T+T        +  + +S +++  +++         T   LDRE   + I+       D+G    L +   I ++V DINDN+P F    Y+V V  +  +   +FQ  A D D G+N  ITY+I+       F IDS+ G + + +PLD +  N++ + I A D  +  +KS + +   + + V  ++ NAP +   T  +++   EN   G  +  ++A D D   N ++ + +S  +      + +  G++  ++  D E +      I ++D       T+  ++ V ++D NDN PQ   + KD               H N    +  +I E+   VI  + ATD D +   +L Y+L ++  +    ++F ID  SG + + + L  +      + V V+D G P  ++   I+V + D
Sbjct:  908 INAQVTYALSVECSDFTVNATTGCLRLNKPLDREK--------QDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPR-GTVLAVIEAVDEDIG-PNAEIQFSLKEETQDEELFRIDKHTGA---IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVN-----VTEASVENVEIITLKAFDPD-------IDPTQT--------ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHIL--EVAISDNG-SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGI-PKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGT----FTAFTNLLVQVIDINDNPPQ---FAKD-------------VYHVN----ISENIEEES--VIMQLHATDRDED--KKLFYHL-HATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHD 1604          

HSP 10 Score: 136.346 bits (342), Expect = 9.009e-32
Identity = 196/774 (25.32%), Postives = 331/774 (42.76%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRIK-FAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVI------DLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMS-GDHSAFNLEEHNSRGPRLRLLIDIDYEKQ-KQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISL-DEIIIKVNAVDADGDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG--EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS---VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +F+  EN      +G +      +DE + Y     T +F I   SG + T  VI      DL  L   +   K      +N NV R     +V  I I +LD++DN P F    +   +  +   K  +I    A+D D S +N E+ Y +  G+   F L+  +       L I    E   + Y  T++AY       S+     LQV  I+   P F K  Y  SV ED+ +   + + + A    G +L Y +   +  F+I+ N G + ++ +LD+EK  S   +I+ATD      AE  L ++++DVND  P    +   L I E    G  + +I   D DS     ++  I+     + ++   ++     TD      LY    LD E I    I  N    D G    L +  ++ + V D+NDNAP F    Y   V      G  +   +A D+DI     + Y I +  +   + ID  TG + L   L+   K+  +L I ++   VH   +   +L I++L +N  +P   + T +  + ENL  GH I T+ A D D G  A + +++  + + +   +++T  + +++V FDREKK +    +++SD   G       S+ V ++D NDN P   L E                      Y + +S   +    I  VKA D+D+ +   + + +   +++   + + +I++K+G I          +   +  V   D G P   S   + +EI++
Sbjct: 2039 RFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEA---KSMLYDGMNSNVRR-----AVTSIDISVLDVNDNCPLFVNMPYYATVS-IDDPKGTIIMQVKAIDLD-SAENGEVRYELKKGNGELFKLDRKSGE-----LSIKQHVEGHNRNYELTVAAYDGAITPCSSE--APLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYID----VTD----GNLYLKTPLDYEQIKYHHIVVNV--KDHG-SPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNI-SVSDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSD---GGGKFGFASLKVIVVDVNDNVPYFLLKE----------------------YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIE 2755          

HSP 11 Score: 129.798 bits (325), Expect = 9.240e-30
Identity = 179/689 (25.98%), Postives = 286/689 (41.51%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISM-KNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT----NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITV--LDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD-QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL-SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S + + I I++ D N P FEK    ++I E           P  V   + M  N    + ++ D   F +    S    L L   +D E+Q+ +   + A         A  +V + V + ND  P+F  T Y  SV E+      ++KV+A DAD G N  +RY L   T    N F I+   G + L+  LD E    ++F + A D G    ++K+ +T+  +D ND  P + L  E L + E    G ++  + + D D               E     +  D Q    I    +L+    LDRE +   + Y   I    G   +     ++ ++V DINDN P     +Y +   E+  IG  L + +A D D  ++ L  Y      D   F I   +G LK+   LDRE   +Y L +  +       +   +++ ITV D NDN P   + +Y   S+ E+  +   I  + A DKD G N +I + L   +H Y  ++   TG +  ++  DRE  S     ++  D  +   L S  +V VNILD NDN P                      E S   Y  K+      G  +  V AT  D+   + + Y++ +      +Q  F +D  +G + +N  L  ++     + +   D G P L +   + + ILDI
Sbjct: 2745 SEVPVSIEIIETDANIPTFEKSSVLLKIIESTP--------PGTVLTKLHMIGNYTFKFSIAADQDHFMI----SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-----------EKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQL---MFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF-QSKLRFYLSGKGADD--FSIGKESGILKVASALDRETTPKYKL-VAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYR-VSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKIS-KSTGIIRLHKSLDRETISLFNLTVKAEDCGVPK-LHSIATVAVNILDINDNPP----------------------EFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGN----EQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDI 3371          
BLAST of Protocadherin gamma vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332722)

HSP 1 Score: 186.037 bits (471), Expect = 5.363e-47
Identity = 197/680 (28.97%), Postives = 317/680 (46.62%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAF-NLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYK----LYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARI-MFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++I + D +DN P+F+   ++  + E    K + +   +A D D +  N +I Y +  D     N+ + +     + LL  +D E Q +Y F + A         A + VT+++V+ ND AP F   I   SV+E+     ++I +  +D D +        ++      FQI   GEL + + LD E+   ++ +I ATDG+F A++ ++I V D+ND  P Y L P   +   TN+S I +G   V           +K  + + +++ LR        D   I K    L    +LDRET P   +  + +       ++ ++ I I +N  DINDN P+F  +QY+V V E+  +   + +  A D+D G N  I Y++    +   F I   TG ++L + LDRE  + + LT+ A D  V    S +T + + +LD NDN PE  +R+Y+   ILEN   G  +  + A   D G NA I  F +S +   +    + TG L  N   D E        IQ  D      L+++  V ++ILD NDN P              +   N Y  + N D          VG  I  VKATD D +    ++Y +E    +N+ Q  F ID K+G I+++RPL R+ I    +++   D G P   ++  I + ILD
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAEN-SEKVISLVKVSATDAD-TGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTP-YCLKPRYHI--STNES-ISIGTTLV----------EVKAIDFDFQSK-LRFYLSGKGADDFSIGKESGILKVASALDRETTPKYKLVAH-VQDGKDFTQECFSEIIITVN--DINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSL-MGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIAT-VAVNILDINDNPPEFSMRQYS-CKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP-LSNNAYVNISILDINDNSP--------------TFLQNLYRINVNEDIF--------VGSKILDVKATDEDSDVNGLVTYNIER--GDNIGQ--FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILD 3475          

HSP 2 Score: 160.999 bits (406), Expect = 2.842e-39
Identity = 194/722 (26.87%), Postives = 323/722 (44.74%), Query Frame = 1
Query:  247 KSGDIHTLKVIDLEALCF---NSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT-NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL-------IYKLY--TVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL--ENLPIGHYIGTLIAFDKDEGENAR-IMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS-IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS 2337
            KSG++   K +D E L F   +  A     T   NV ++              + DI+DN P   KP + +   E I     ++ +  A+D D   K   + + +SG  +  F++ + +     L++   +D E   +Y+         D +      + + V +IND  P FS   Y  SV ED  L+ +I KV+A+D D G N  ++Y L+    +YF+I+ + G + L + LD E    F+ T++A D    +  + + + + +LD+ND PP + +      I E    G  V ++     D + +N  I     +   Q  + + D  + D++L       + K Y  T+ ++D  T P              +    Y NISI     DINDN+P F  + Y++ V E+  +G ++   +ATDED   N L+TYNI+   + G F ID + G + + +PLDRE  + Y L I A DQ    ++  S  + I +LD NDNAP +   +++S++  EN  +G+   T    D DE  N     F +   +      + + GSL +   F+   + +   Q+++ D+     L S   V V I++E+   P +   E      INS F + ++                 G  I  V A+D D     +L++ L +   +  Q S +F+I   +GKI     L    IGL K+ V V D 
Sbjct: 3018 KSGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEID--------------VKDINDNTPYCLKPRYHISTNESISIGTTLVEV-KAIDFDFQSK---LRFYLSGKGADDFSIGKESGI---LKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSID-IGVNADIHYFIMSGNEQG-KFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPP--------------LSNNAYVNISI----LDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQG-DPQRCNSVPININILDTNDNAP-IFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPP-LYSDAWVVVKIIEESQYPPIVTPLE----VTINS-FEDDFS-----------------GAFIGKVHASDQD--KYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD---IGLYKLNVSVSDG 3668          

HSP 3 Score: 159.458 bits (402), Expect = 8.293e-39
Identity = 195/773 (25.23%), Postives = 344/773 (44.50%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-------DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRF--TLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRY-ILLPMTN-YFQINNDGELHLIQKLDF---EKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVF-----DRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            I EN PI TFV ++          +   G I + F I+P +G I     ID E++             +L V         S   I+I ILD +DN P F + E+   + E     + V+ +  +    ++++ K+    ++G       D  A N  + +S    + LL  +DYE    Y F  T+S   K     +   +VT++V+N+NDC P F++     +++     +  + +V+A DAD D LR+ I+   TN  FQI     +   +  +    E  + ++  ++A+DG F A   +KI VL   D   ++     +    E N     +G + V      +     I    +  +    + AL+        ++  +Y+L+      +  + DG+        +S ++R +    SI ++V D+NDN PLF +  Y   V  ++  G  + Q +A D D  +N  + Y ++   +  LF +D ++G L + Q ++   +N Y LT+ A D A+    S    L + V+D +    E + YT  S+ E++ +  Y    ++ + +      +++ +S +     +  N TGS+F     D EK S     I+ +DS  G  + + V + V+I+D ND YP+I   E D       ++N T  E+++             G  I  + ATDND    ++LSYY+E+   +N    +F ID   G + +  PL  + I    + V V+D G PSL S   + + + D+
Sbjct: 1726 IFENLPIGTFVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESI----------KVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDGIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEA---KSMLYDGM--------NSNVRRAV---TSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG-NGELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAI-TPCSSEAPLQVKVIDRSMPVFEKQFYT-VSVKEDVEM--YSALSVSIEAESPLGRSLIYTISSESQSFEIDYN-TGSIFVVNELDYEKISSHDVSIRATDSLSG--VYAEVVLSVSIMDVNDCYPEI---ESD-------IYNLTIPENAS------------FGTQILKINATDNDSGANAKLSYYIESINGQN-NSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDL 2442          

HSP 4 Score: 149.058 bits (375), Expect = 1.092e-35
Identity = 188/731 (25.72%), Postives = 312/731 (42.68%), Query Frame = 1
Query:  418 KPEFEK-PEFTMEIKEVIHRKNMVIYLPA----AVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKND----ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNY----FQINN-DGELHLIQKLDFEK-HQSFSFTIQATDGEFV----AESKLKITVLDVNDEPPSYILNPEKL-VIDETNKSGILVGQITV------------------------FDRDSVSINRGIKC-----TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGII---YTNFICYDSGIKRQL-------------------YTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            KPE +  P FT EI EV   +   I +P       D D+  KN  +   + G +       +   G  L     +D EK+  Y  T+SA  + +    +  SA + +++Q +N ND  P F       S+ E+      ++K+ A D D     YI   + N     F+I++  G +     LDFE   +++   I+A+D         E KL I V D+ND  P +    E++    +  KS  +  ++ V                        F+ D  S +  I C     T TN   +    +    S D+++      VH +  +   D  I   + +F C ++G+ R+L                   ++++S+  + +  N + P F +   ++ + E+  +G  +   +A D D+G N  + + I       +F ID   G L+++  LDRE++N+Y+L I   D   +  KS S  L IT+LD NDN P +++    F + E+  IG  +  L A D D G NA++ + LS++      TVN  TG L  N+  DREK+      I   D     VL+S   V V + D NDN P   + E                      Y+ K+      G V+AV++A D D+   +++ + L+    E   + +F IDK +G I     L  +   +  + V   D G PSL S  +I++ I+D+
Sbjct:  391 KPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLG-KNALVYLEIVGGNEGDEFRINPDSG-MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDND--PIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF----ERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLII-----NVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLG-NPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVE--CSDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGG-SPVLSSEALVYVLVDDVNDNAPVFGVQE----------------------YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLK---EETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDV 1079          

HSP 5 Score: 145.206 bits (365), Expect = 1.676e-34
Identity = 175/640 (27.34%), Postives = 285/640 (44.53%), Query Frame = 1
Query:  529 NKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLID-------IDYEKQKQYRFTLSAY----QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFV-------AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE-TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPELREYTD-FSILENLPIGHYIGTLIAFDKDEGENARIMFKLS--------MDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGH 2343
            N E+ YR+ SGD       E    G    L I        ++ EK ++Y   + A+     +N  S     N+ ++V++ ND +P F  T Y   + ED    + I+KV A DAD G N  + Y LL  + YF I+   GE+ L+Q+L + ++  F  T+ A D G +V       +++K+ I+V  VN   P         V   +N   ++ G + V D+D+  IN  I   E  +       L K   + D   I +L     L+++     I     +  D G  R+ +   S+P+ +   + N P+F    Y+V + E   I   + + + +D D+GKNAL+   I    +   F I+  +G L   + LD EKK+ Y LT+ AIDQA V  RK  S ++ I+V D NDN P         SI EN   G ++  L A D+D GEN+ I + ++        +DH      + KT SL   +   R  +      I+ SD  +     + + + + + D NDN PQ   +E+                   V+   K++    +G  + V  A D D  ++  +SY L    S+  +   F++D  SG ++I+  L +  +  + +KV   D  H
Sbjct:   97 NAEVKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTKTFSSVTPTSNP--LIYGIVRVNDKDT-GINGNIGRLEIVDGNPDGTFLLKAAETKDEYYI-ELNQFAHLNQQHF---IYNLTLLAEDLGTPRR-FAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFS---GIVKTTSLLDFETMKRNYE----LIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQ---FER-------------------VNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRL----SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH 693          

HSP 6 Score: 144.05 bits (362), Expect = 3.879e-34
Identity = 189/736 (25.68%), Postives = 312/736 (42.39%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTL-KVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGP-RLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESV--YEDISLDEIIIKVNAVDADGDNLRYILLPMT--NYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQI----FLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            G +   F ID K+G I T  + +D E        ++    + + ++ N    L S  +IV+ +LDI+DN PEF++  + +++       N  I+   A+D D S +N  I Y +            + RG   +   +D D E +   +   +   K  ++   N+ V     N  + AP   +   E  V   E+     ++ ++ AVD D D L Y +      N F I  D G + L + LD+E  QS++ TI  TDG F A + L + V+D+ND PP +  +   + I E  +   ++ Q+   DRD    +   +  T+        R+  D +S ++++  +L      D E     I+   F+       ++ Y  I +  NVHD ND+ P F +   Q  V E+  IG +L + +A D D G NA I Y+I       +F ID   G + L   L+  K  +YML + A+D       S      I  + +ND            I ENLPIG ++  + A       ++ I F +   ++ +   +N  TG +  N   D E        ++ ++ A     +S  ++ ++ILD NDN P      ++    E+  I S             YV+K+    K    + V    D DV     + Y++     ++L ++ F ID  +G I + R L  +        V V D G P L S  T  V I
Sbjct: 1235 GNLVGYFEIDSKTGVIKTTERKLDRE--------NQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA-TVNQSIFQVHAIDSD-SGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQN-APLIVRKTSENVVDLTENDKPGFLVTQILAVDDDNDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRI--DSISGNVIVTQRL------DFEKTAQHILIV-FVKDQGAPGKRNYAKIIV--NVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTA-----RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMA---AESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGS-------------YVLKVHDSSKDHLTLQV---KDADVGVNGMVEYHI----VDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTI 1920          

HSP 7 Score: 140.584 bits (353), Expect = 5.459e-33
Identity = 175/605 (28.93%), Postives = 267/605 (44.13%), Query Frame = 1
Query:  658 TLSAYQKND-----ESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILL----PMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-----VSINRGIKCTE--TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV-DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDN--APELREYT-DFSILENLPIGHYIGTLIAFDKDEGE-NARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            TLS  +KN+      S+ +++++T      N   PEF     E S+ E + L E +  + A D D G N + +         + F+I+ D GEL +I  LD E+   +   I   D     +S    L IT+LDVND  P          + E+ + G +V  +   D DS     V+    ++C++   N  T  LRL K                  LDRE   +   Y   I    G    L +   + + V D+NDNAP+F   +Y   V+E+   G  L   +A DEDIG NA I ++++    D  LF ID  TG ++    LD E K  + L + AID       S    + I ++D N+N  APE  ++  +  + EN P G ++  + A D D  + N++I + ++         VN  GS+ S    D E K+     +   D AI   L++ V V + + +ENDN P   L +K    +     N T     NV+              I  +KA D D++    ++Y   N  S NL    F+ID K+G I T  R L R+      ++V + D+G P L S   I+V +LDI
Sbjct:  736 TLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDFTVNATTGCLRLNK-----------------PLDREKQDN---YALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTS-DMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVP-LSNCVEVYIQVENENDNIP---LTDKPVYYV-----NVTEASVENVE--------------IITLKAFDPDIDPTQTITY---NIVSGNLV-GYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDI 1292          

HSP 8 Score: 139.428 bits (350), Expect = 1.103e-32
Identity = 164/595 (27.56%), Postives = 267/595 (44.87%), Query Frame = 1
Query:  118 QKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLI--------TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNV----NRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN---YFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDE--PPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQ-PLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL 1821
            Q+ +I E+  +   V  I+ AK  D +L Y+  L+          +F IDP  G++  +  +D E         +++  + LN+ V    N  K+   ++ I I  LD++DN+P  +K   T  + E   R   V++   A D D S  N ++ Y +S + S F +   N+    LRL   +D EKQ  Y   ++A       +S+   V + V ++ND AP F    Y   V ED+    ++  + AVD D G N  +++ L   T     F+I+ + G +     LD+E  Q  +  + A DG      ++  + I ++DVN+    P +     +  + E    G  V  +T  D D+V +N  I  + T  +   +    DQ S        + ++  LD ET      Y   +C        L   + + + V + NDN PL     Y V V E +    ++   +A D DI     ITYNI      G F IDS+TG +K  +  LDRE + +++L  VAI        S ++++ ++VLD NDN+PE   R Y    +  +  +   I  + A D D GEN RI + +
Sbjct:  777 QELSINESVQLGETVAWIE-AK--DRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRE---------RQNEYV-LNITVYDLGNPTKSTSKMLPITI--LDVNDNRPVIQKTLATFRLTESA-RIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTV---NATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGS--------ITSLSQLDAET---KNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILE-VAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYK-VQVPSSATVNQSIFQVHAIDSDSGENGRITYSI 1338          

HSP 9 Score: 137.117 bits (344), Expect = 5.514e-32
Identity = 181/768 (23.57%), Postives = 348/768 (45.31%), Query Frame = 1
Query:  187 IDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNIND--CAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRY-ILLPMTN-----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAES---KLKITVLDVND-----EPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKL--------YTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQ---LTITVLDDNDNAPELREYTDFSIL---ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I+ +++Y+  +    F+++  +G +   K +D E         +++  + +         L S   + +++ D++DN P F   E+  +++E + R   V+ +  AVD+DI   N EI + +   + D   F +++H      +R    +DYE ++ +   +SA    D S++++M++ + ++++N+   APEF   +YE  V E+      ++ V A D D  +L   I   +T       F +N+ G +  + +LD E    +  T+ A D   V  S   ++ I V + ND     + P Y +N     + E +   + +  +  FD D       I  T+T        +  + +S +++  +++         T   LDRE   + I+       D+G    L +   I ++V DINDN+P F    Y+V V  +  +   +FQ  A D D G+N  ITY+I+       F IDS+ G + + +PLD +  N++ + I A D  +  +KS + +   + + V  ++ NAP +   T  +++   EN   G  +  ++A D D   N ++ + +S  +      + +  G++  ++  D E +      I ++D       T+  ++ V ++D NDN PQ   + KD               H N    +  +I E+   VI  + ATD D +   +L Y+L ++  +    ++F ID  SG + + + L  +      + V V+D G P  ++   I+V + D
Sbjct:  908 INAQVTYALSVECSDFTVNATTGCLRLNKPLDREK--------QDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPR-GTVLAVIEAVDEDIG-PNAEIQFSLKEETQDEELFRIDKHTGA---IRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVN-----VTEASVENVEIITLKAFDPD-------IDPTQT--------ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHIL--EVAISDNG-SPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGI-PKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGT----FTAFTNLLVQVIDINDNPPQ---FAKD-------------VYHVN----ISENIEEES--VIMQLHATDRDED--KKLFYHL-HATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHD 1604          

HSP 10 Score: 136.346 bits (342), Expect = 1.006e-31
Identity = 196/774 (25.32%), Postives = 331/774 (42.76%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRIK-FAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVI------DLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMS-GDHSAFNLEEHNSRGPRLRLLIDIDYEKQ-KQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISL-DEIIIKVNAVDADGDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG--EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS---VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +F+  EN      +G +      +DE + Y     T +F I   SG + T  VI      DL  L   +   K      +N NV R     +V  I I +LD++DN P F    +   +  +   K  +I    A+D D S +N E+ Y +  G+   F L+  +       L I    E   + Y  T++AY       S+     LQV  I+   P F K  Y  SV ED+ +   + + + A    G +L Y +   +  F+I+ N G + ++ +LD+EK  S   +I+ATD      AE  L ++++DVND  P    +   L I E    G  + +I   D DS     ++  I+     + ++   ++     TD      LY    LD E I    I  N    D G    L +  ++ + V D+NDNAP F    Y   V      G  +   +A D+DI     + Y I +  +   + ID  TG + L   L+   K+  +L I ++   VH   +   +L I++L +N  +P   + T +  + ENL  GH I T+ A D D G  A + +++  + + +   +++T  + +++V FDREKK +    +++SD   G       S+ V ++D NDN P   L E                      Y + +S   +    I  VKA D+D+ +   + + +   +++   + + +I++K+G I          +   +  V   D G P   S   + +EI++
Sbjct: 2039 RFSAFENNTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEA---KSMLYDGMNSNVRR-----AVTSIDISVLDVNDNCPLFVNMPYYATVS-IDDPKGTIIMQVKAIDLD-SAENGEVRYELKKGNGELFKLDRKSGE-----LSIKQHVEGHNRNYELTVAAYDGAITPCSSE--APLQVKVIDRSMPVFEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYID----VTD----GNLYLKTPLDYEQIKYHHIVVNV--KDHG-SPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNI-SVSDGVH---TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSD---GGGKFGFASLKVIVVDVNDNVPYFLLKE----------------------YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIE 2755          

HSP 11 Score: 129.798 bits (325), Expect = 9.890e-30
Identity = 177/689 (25.69%), Postives = 287/689 (41.65%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISM-KNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT----NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITV--LDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD-QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL-SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S + + I I++ D N P FEK    ++I E           P  V   + M  N    + ++ D   F +    S    L L   +D E+Q+ +   + A         A  +V + V + ND  P+F  T Y  SV E+      ++KV+A DAD G N  +RY L   T    N F I+   G + L+  LD E    ++F + A D G    ++K+ +T+  +D ND  P + L  E L + E    G ++  + + D D               E     +  D Q    I    +L+    LDRE +   + Y   I    G   +     ++ ++V DINDN P     +Y +   E+  IG  L + +A D D  ++ L  Y      D   F I   +G LK+   LDRE   +Y L +  +       +   +++ ITV D NDN P   + +Y   S+ E+  +   I  + A DKD G N +I + L   +H Y  ++   TG +  ++  DRE  S     ++  D  +   L S  +V VNILD NDN P+  + +                      Y  K+      G  +  V AT  D+   + + Y++ +      +Q  F +D  +G + +N  L  ++     + +   D G P L +   + + ILDI
Sbjct: 2745 SEVPVSIEIIETDANIPTFEKSSVLLKIIESTP--------PGTVLTKLHMIGNYTFKFSIAADQDHFMI----SDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-----------EKQEMDFFIVSGDKQAQFQIGKSGELFIAKPLDREQL---MFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF-QSKLRFYLSGKGADD--FSIGKESGILKVASALDRETTPKYKL-VAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYR-VSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKIS-KSTGIIRLHKSLDRETISLFNLTVKAEDCGVPK-LHSIATVAVNILDINDNPPEFSMRQ----------------------YSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGN----EQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDI 3371          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 244.973 bits (624), Expect = 1.816e-66
Identity = 228/775 (29.42%), Postives = 363/775 (46.84%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADK-ESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA---FNLEEHNSRG---PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYN-IQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP  T +G +   + + D    Y   +      +D K+GDI T ++ ID E L    C +K +   +   V+V    Q     +++  I + DI+DN P+F  P  T+ + E  H    +  +P A DKD + +N    Y ++    A   F L+    RG   P+L +L  +D E +  Y  T+ A    +    ++  + + + + ND AP+F K+ YE  V E+  +   +++V A D+D G N      L   + P+    +I+ + G +++   LD E+  +  F + A D G     SK  + I V D ND  P+  +    LV        I E    G  V  + V D+D    N  + C         LR   D  S D    Y L T   LD E + D       +  DSG      TN S+ + V D NDN+P+F  + ++V   E N  G ++ +  A+D D G NA + Y+ I  S   GLF ID  +G ++   PLDRE K++Y   + A D+ V   + G+  + I VLD NDN P+  L  Y+ FS+LEN+P    +G +   D DEGENA++   +  D + + +  N TG++ S+  FDREK+S    +++  D       +S+V V +N+LDENDN P +                   T+ SN  + +++S       V+ VV+A D D  + ++L Y +      +L    F I   +G+IT+ + L R   GL ++ + V D G PS
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--KDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHM-GALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDE-GENAVVTCVVAGDVPFQLRPASDS-SVDNKRKYFLQTTTPLDYERVRD--YRVEIVAVDSGNPALSSTN-SLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHR-GTATVVIKVLDRNDNDPKFMLSGYS-FSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPD-VGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVV-------------------TKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDL----FYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPS 764          

HSP 2 Score: 136.346 bits (342), Expect = 5.865e-32
Identity = 136/483 (28.16%), Postives = 221/483 (45.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P +      L + E    G L       D+D+     G+         +A+ L   Q++ D    + +L  + SLDRE + D   Y   I    G     Y++  + + + D NDNAP F  S Y+  V EN+ IG+ + Q +A D D+G N  I Y +  ++D    L  ID  +G + +  PLDRE+ N     +VA D+     KS  T ++I V D NDNAP  E+R      ++D   +I E++P+G  +  +   DKDEGENA +   ++ D  +Q    + +         L +    D E+      +I   DS  GN  L+S  S+ V + D NDN P               +F+ T  E       V+ +   + G  +  V A+D D    ++L Y +    +++  + +F+ID  SG++    PL R+     + +V   D G PS +   T+++++LD
Sbjct:  118 RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTE--RNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRE-LKDS--YDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKG-PSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDS--GNPALSSTNSLKVQVTDTNDNSP---------------IFSPTLFE-------VEFAEENQPGEKVVEVVASDADSGTNAELVYSI---IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLD 567          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 245.358 bits (625), Expect = 3.843e-66
Identity = 229/775 (29.55%), Postives = 362/775 (46.71%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADK-ESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA---FNLEEHNSRG---PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYN-IQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP  T +G +   + + D    Y   +      +D K+GDI T ++ ID E L    C +K +   +   V+V    Q     +++  I + DI+DN P+F  P  T+ + E  H    +  +P A DKD + +N    Y ++    A   F L+    RG   P+L +L  +D E +  Y  T+ A    +    ++  + + + + ND AP+F K+ YE  V E+  +   +++V A D+D G N      L   + P+    +I+ + G +++   LD E+  +  F + A D G     SK  + I V D ND  P+  +    LV        I E    G  V  + V D+D    N  + C         LR   D  S D    Y L T   LD E + D       +  DSG      TN S+ + V D NDN+P+F  + ++V   E N  G ++ +  A+D D G NA + Y+ I  S   GLF ID  +G ++   PLDRE K++Y   + A D+ V   + G+  + I VLD NDN P+  L  Y+ FS+LEN+P    +G +   D DEGENA++   +  D + + +  N TG++ S+  FDREK+S    +++  D       +S+V V +N+LDENDN P +       T   NS F             +++S       V+ VV+A D D  + ++L Y +      +L    F I   +G+IT+ + L R   GL ++ + V D G PS
Sbjct:   27 YRVHEEQPPSTLIGSLAADQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETL--KDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTH-MGALFSIPLATDKD-TERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDE-GENAVVTCVVAGDVPFQLRPASDS-SVDNKRKYFLQTTTPLDYERVRD--YRVEIVAVDSGNPALSSTN-SLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHR-GTATVVIKVLDRNDNDPKFMLSGYS-FSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPD-VGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVV-------TKPSNSSF-------------IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDL----FYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPS 764          

HSP 2 Score: 136.346 bits (342), Expect = 8.102e-32
Identity = 136/483 (28.16%), Postives = 221/483 (45.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P +      L + E    G L       D+D+     G+         +A+ L   Q++ D    + +L  + SLDRE + D   Y   I    G     Y++  + + + D NDNAP F  S Y+  V EN+ IG+ + Q +A D D+G N  I Y +  ++D    L  ID  +G + +  PLDRE+ N     +VA D+     KS  T ++I V D NDNAP  E+R      ++D   +I E++P+G  +  +   DKDEGENA +   ++ D  +Q    + +         L +    D E+      +I   DS  GN  L+S  S+ V + D NDN P               +F+ T  E       V+ +   + G  +  V A+D D    ++L Y +    +++  + +F+ID  SG++    PL R+     + +V   D G PS +   T+++++LD
Sbjct:  118 RIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTE--RNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRE-LKDS--YDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSP-KSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDS--GNPALSSTNSLKVQVTDTNDNSP---------------IFSPTLFE-------VEFAEENQPGEKVVEVVASDADSGTNAELVYSI---IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLD 567          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 219.164 bits (557), Expect = 7.986e-58
Identity = 227/809 (28.06%), Postives = 366/809 (45.24%), Query Frame = 1
Query:   58 VLLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLK-VIDLEAL--CFNSCADKESATISLNVNVN--RQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
             +L  IL +     N  + +  + + E QP  T +G +   + + D    Y   +      +D K+GDI+T +  ID E+L  C N   + +   +   V++    + T   +++  I ILD +DN P+F  P  T+ I E  H    +  +P A D+D S  N    Y ++    A NL      ++ + + P+L +L ++D E +  Y   +           ++  + + + + ND  P+F ++ YE  + E+  +   +++V A D+D G N      L     P+     I+ N G + +   +D E+     F +QA D G     SK  + ITV D ND  PS  +    LV        I E    G  V  + V DRD    N  + C         LR    +   D    Y L T   LD E I +  I    +  DSG      TN S+ + V D+NDNAP+F  + Y+V   E N  G ++    ATD D G NA +TY+I   SV  GLF I+  TG +++M  LDRE+ + Y   + A D+ V   + G+  + + VLD NDN P+  L  Y+ FS+ EN+P    +G +   D DEGENAR+   +  D+  + +  N T ++ S   FDREK+S    +++  D       +S+V + +N+LDENDN P +                   T+ +N  Y   +  R      +  V+A D D+   S+L + +       L    F I  + G+IT+ +      IGL ++ V V+D G P  ++   + + +
Sbjct:   32 AMLVWILLLLCCSANVVNTIL-YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRN-LFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTH-VGALFAIPVATDRD-SGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGE-NAVVTCVVAGDVPFQLR-SASETGNDRKRKYFLQTTTLLDYERIKEYRI--EIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLR-GTATVVVKVLDRNDNDPKFMLNGYS-FSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDN-GKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGG-DPPRSSYVGITINVLDENDNAPYV-------------------TKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGL----FRISSE-GEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 802          

HSP 2 Score: 129.413 bits (324), Expect = 9.346e-30
Identity = 136/485 (28.04%), Postives = 220/485 (45.36%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIK---CTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ--FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---------EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I +LD ND  P +      L I E    G L       DRDS S   GI     T     T    L+  Q S + L   +L  + +LDRE + D     N    D G   +  + + + + + D NDN P F  S Y+  + EN+ +G+ + Q +A D D+G N  +TY++    S    L  ID  TG + +   +DRE+ +     + A D      KS    +TITV D NDNAP +R         E    +I E++P+G  +  +   D+DEGENA +   ++ D  +Q  + ++TG+       L +  + D E+  +   +I   DS  GN  L+S  S+ V + D NDN P               +F+ T        Y V+     + G  +  V ATD D    ++L+Y +   +   + + +F+I+  +G++ +   L R+ +   +  V   D G PSL+   T++V++LD
Sbjct:  146 RIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGS--NGIADYALTTGPEATNLFSLQVAQDSDEKLP--QLIVLGNLDRE-LRDSYDL-NIKVVDGGSPPRQSSAL-LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQS-KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDS--GNPALSSTNSLKVQVTDMNDNAP---------------VFSPTL-------YEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS---VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLD 595          

HSP 3 Score: 99.3673 bits (246), Expect = 1.643e-20
Identity = 94/365 (25.75%), Postives = 164/365 (44.93%), Query Frame = 1
Query: 1351 LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVI------DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQP-------LTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGK--ITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + + D NDN P F S    + + EN  +G       ATD D G N +  Y +    ++  LF +      D +   L ++  LDRE ++ Y L I  +D     R+S S  L IT+ D NDN P+  R + +  + EN P+GH +  + A D D G N  + + L     +QP       L++++ TG +F     DRE+ S +   +Q  D+      +S   V + + D+NDN P I +      T              + D V  +S    VG  +A+V+ +D D    + ++  +       L+ +    + +  K  +     L  + I   +++++  DSG+P+L S  ++ V++ D+
Sbjct:  147 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQS-SALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL-----HQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVT--------------HEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDM 490          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 218.394 bits (555), Expect = 9.172e-58
Identity = 227/809 (28.06%), Postives = 366/809 (45.24%), Query Frame = 1
Query:   58 VLLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLK-VIDLEAL--CFNSCADKESATISLNVNVN--RQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
             +L  IL +     N  + +  + + E QP  T +G +   + + D    Y   +      +D K+GDI+T +  ID E+L  C N   + +   +   V++    + T   +++  I ILD +DN P+F  P  T+ I E  H    +  +P A D+D S  N    Y ++    A NL      ++ + + P+L +L ++D E +  Y   +           ++  + + + + ND  P+F ++ YE  + E+  +   +++V A D+D G N      L     P+     I+ N G + +   +D E+     F +QA D G     SK  + ITV D ND  PS  +    LV        I E    G  V  + V DRD    N  + C         LR    +   D    Y L T   LD E I +  I    +  DSG      TN S+ + V D+NDNAP+F  + Y+V   E N  G ++    ATD D G NA +TY+I   SV  GLF I+  TG +++M  LDRE+ + Y   + A D+ V   + G+  + + VLD NDN P+  L  Y+ FS+ EN+P    +G +   D DEGENAR+   +  D+  + +  N T ++ S   FDREK+S    +++  D       +S+V + +N+LDENDN P +                   T+ +N  Y   +  R      +  V+A D D+   S+L + +       L    F I  + G+IT+ +      IGL ++ V V+D G P  ++   + + +
Sbjct:   14 AMLVWILLLLCCSANVVNTIL-YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRN-LFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTH-VGALFAIPVATDRD-SGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGE-NAVVTCVVAGDVPFQLR-SASETGNDRKRKYFLQTTTLLDYERIKEYRI--EIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLR-GTATVVVKVLDRNDNDPKFMLNGYS-FSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDN-GKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGG-DPPRSSYVGITINVLDENDNAPYV-------------------TKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGL----FRISSE-GEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 784          

HSP 2 Score: 129.798 bits (325), Expect = 6.888e-30
Identity = 144/515 (27.96%), Postives = 231/515 (44.85%), Query Frame = 1
Query:  928 FEKHQSF-SFTIQATD-----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIK---CTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ--FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---------EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            FE    F  F +  TD     G  + E +++I  LD ND  P +      L I E    G L       DRDS S   GI     T     T    L+  Q S + L   +L  + +LDRE + D     N    D G   +  + + + + + D NDN P F  S Y+  + EN+ +G+ + Q +A D D+G N  +TY++    S    L  ID  TG + +   +DRE+ +     + A D      KS    +TITV D NDNAP +R         E    +I E++P+G  +  +   D+DEGENA +   ++ D  +Q  + ++TG+       L +  + D E+  +   +I   DS  GN  L+S  S+ V + D NDN P               +F+ T        Y V+     + G  +  V ATD D    ++L+Y +   +   + + +F+I+  +G++ +   L R+ +   +  V   D G PSL+   T++V++LD
Sbjct:  100 FEGDPCFLEFEVSITDLMKGTGPRLIEGRIEI--LDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGS--NGIADYALTTGPEATNLFSLQVAQDSDEKLP--QLIVLGNLDRE-LRDSYDL-NIKVVDGGSPPRQSSAL-LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQS-KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDS--GNPALSSTNSLKVQVTDMNDNAP---------------VFSPTL-------YEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS---VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLD 577          

HSP 3 Score: 99.3673 bits (246), Expect = 1.495e-20
Identity = 94/365 (25.75%), Postives = 164/365 (44.93%), Query Frame = 1
Query: 1351 LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVI------DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQP-------LTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGK--ITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + + D NDN P F S    + + EN  +G       ATD D G N +  Y +    ++  LF +      D +   L ++  LDRE ++ Y L I  +D     R+S S  L IT+ D NDN P+  R + +  + EN P+GH +  + A D D G N  + + L     +QP       L++++ TG +F     DRE+ S +   +Q  D+      +S   V + + D+NDN P I +      T              + D V  +S    VG  +A+V+ +D D    + ++  +       L+ +    + +  K  +     L  + I   +++++  DSG+P+L S  ++ V++ D+
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQS-SALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL-----HQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVT--------------HEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDM 472          
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 218.394 bits (555), Expect = 1.241e-57
Identity = 227/809 (28.06%), Postives = 366/809 (45.24%), Query Frame = 1
Query:   58 VLLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLK-VIDLEAL--CFNSCADKESATISLNVNVN--RQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
             +L  IL +     N  + +  + + E QP  T +G +   + + D    Y   +      +D K+GDI+T +  ID E+L  C N   + +   +   V++    + T   +++  I ILD +DN P+F  P  T+ I E  H    +  +P A D+D S  N    Y ++    A NL      ++ + + P+L +L ++D E +  Y   +           ++  + + + + ND  P+F ++ YE  + E+  +   +++V A D+D G N      L     P+     I+ N G + +   +D E+     F +QA D G     SK  + ITV D ND  PS  +    LV        I E    G  V  + V DRD    N  + C         LR    +   D    Y L T   LD E I +  I    +  DSG      TN S+ + V D+NDNAP+F  + Y+V   E N  G ++    ATD D G NA +TY+I   SV  GLF I+  TG +++M  LDRE+ + Y   + A D+ V   + G+  + + VLD NDN P+  L  Y+ FS+ EN+P    +G +   D DEGENAR+   +  D+  + +  N T ++ S   FDREK+S    +++  D       +S+V + +N+LDENDN P +                   T+ +N  Y   +  R      +  V+A D D+   S+L + +       L    F I  + G+IT+ +      IGL ++ V V+D G P  ++   + + +
Sbjct:   35 AMLVWILLLLCCSANVVNTIL-YQVTEEQPPNTLIGSLASDQGLPDTGHLYKLEVGAPYLRVDGKTGDIYTTENSIDRESLKDCRN-LFEGDPCFLEFEVSITDLMKGTGPRLIEGRIEILDENDNTPQFSSPVLTLSIPENTH-VGALFAIPVATDRD-SGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGE-NAVVTCVVAGDVPFQLR-SASETGNDRKRKYFLQTTTLLDYERIKEYRI--EIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLR-GTATVVVKVLDRNDNDPKFMLNGYS-FSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDN-GKFMIQNGTYTILSTISFDREKESTYSFRLKAVDGG-DPPRSSYVGITINVLDENDNAPYV-------------------TKPANSSYKF-LDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGL----FRISSE-GEITLAKEFTPKHIGLHRLVVKVKDKGTPPRQTTALVHIYV 805          

HSP 2 Score: 129.413 bits (324), Expect = 8.119e-30
Identity = 136/485 (28.04%), Postives = 220/485 (45.36%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIK---CTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ--FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---------EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I +LD ND  P +      L I E    G L       DRDS S   GI     T     T    L+  Q S + L   +L  + +LDRE + D     N    D G   +  + + + + + D NDN P F  S Y+  + EN+ +G+ + Q +A D D+G N  +TY++    S    L  ID  TG + +   +DRE+ +     + A D      KS    +TITV D NDNAP +R         E    +I E++P+G  +  +   D+DEGENA +   ++ D  +Q  + ++TG+       L +  + D E+  +   +I   DS  GN  L+S  S+ V + D NDN P               +F+ T        Y V+     + G  +  V ATD D    ++L+Y +   +   + + +F+I+  +G++ +   L R+ +   +  V   D G PSL+   T++V++LD
Sbjct:  149 RIEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGS--NGIADYALTTGPEATNLFSLQVAQDSDEKLP--QLIVLGNLDRE-LRDSYDL-NIKVVDGGSPPRQSSAL-LRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGPQS-KSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDS--GNPALSSTNSLKVQVTDMNDNAP---------------VFSPTL-------YEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGS---VPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLD 598          

HSP 3 Score: 99.3673 bits (246), Expect = 1.601e-20
Identity = 94/365 (25.75%), Postives = 164/365 (44.93%), Query Frame = 1
Query: 1351 LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVI------DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQP-------LTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGK--ITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + + D NDN P F S    + + EN  +G       ATD D G N +  Y +    ++  LF +      D +   L ++  LDRE ++ Y L I  +D     R+S S  L IT+ D NDN P+  R + +  + EN P+GH +  + A D D G N  + + L     +QP       L++++ TG +F     DRE+ S +   +Q  D+      +S   V + + D+NDN P I +      T              + D V  +S    VG  +A+V+ +D D    + ++  +       L+ +    + +  K  +     L  + I   +++++  DSG+P+L S  ++ V++ D+
Sbjct:  150 IEILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQS-SALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSL-----HQPSSPVMRLLSIDRNTGIIFVKGSVDREEISILKFYVQAKDNGP-QSKSSKALVTITVKDQNDNAPSIRIRGIGLVT--------------HEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDM 493          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 220.705 bits (561), Expect = 2.994e-58
Identity = 219/786 (27.86%), Postives = 364/786 (46.31%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKF-AKQIDEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADKESA-TISLNVNVNRQKTLISVMKIV---IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD--------------GDNLRYILLPMTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP    +G +       D +  Y   L      +D K+GDI+T +  ID E+L    C + E      L   V+    +  V +++   I I+DI+DN P F  P  T+ I E  +   M+  +PAA D+D S  N   +Y +     A +L      E+ + + P+L ++  +D E++  Y  T+        + +++  + + +++ ND AP+F K  YE  + E+  +   +++V A D+D               D +R +L        ++    L  +Q  +D E   +  F++ A D       A +++ IT+ D ND  P   +    LV  +   + I         V  + V D D   +N  + C         L+   D  S D    Y L T  +LD E++ +  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENNDI   + +  ATD D G N+ + Y+I     + G+F I+  +G +++   LDRE++  Y   +VA+D+ +   K G+  + ITVLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA I   +   S + + Q    N TG++ S+  FDRE +S    +++  D       +S+V V +N+LDENDN P I +                    SN+ Y   ++ +   G  +  V+A D D    ++L Y +   AS N  + +F I   +G++T+ + + R   GL ++ V V D G PS
Sbjct:   71 YRVPEEQPPNILIGSLASDYGYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTN-IGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL-------HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTI--EIVAVDSGNPPLSSTN-SLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKFMLNGY-NFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQ----NGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVV-------------------PSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSI---ASGNPFE-LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 129.413 bits (324), Expect = 1.386e-29
Identity = 140/487 (28.75%), Postives = 218/487 (44.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE--TNHETQ---ALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I ++D+ND  P++      L I E    G+L       DRDS  +N G+   E     E Q    L++ +DQ      LI     +  LDRE       Y   I    G      ++  + +++ D NDNAP F    Y+  + EN+ +G+ + Q +A D D G NA I Y+   + D+   L  +D  TG + +  P+DRE       ++VA D+   + K+  TQ+TIT+ D NDN P  E+R +   +       I E++P+   +  +   D DEG NA +   ++ D  +Q   V+ TGS       L +    D E   +   +I   DS  GN  L+S  S+ V + D NDN P              SL    + E+++++ +V              V ATD D    SQL Y +    S    + IF I+  SG+I +N  L R+        V+  D G PSLK   ++++ +LD
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDS-GVN-GVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI----VMGMLDREQRDS---YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS--GNPPLSSTNSLKVQVTDVNDNAP----------VFSQSLMEVVFPENNDINDLVME------------VSATDADSGPNSQLHYSILPDPS---ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLD 612          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 221.09 bits (562), Expect = 3.168e-58
Identity = 219/786 (27.86%), Postives = 364/786 (46.31%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKF-AKQIDEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADKESA-TISLNVNVNRQKTLISVMKIV---IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD--------------GDNLRYILLPMTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP    +G +       D +  Y   L      +D K+GDI+T +  ID E+L    C + E      L   V+    +  V +++   I I+DI+DN P F  P  T+ I E  +   M+  +PAA D+D S  N   +Y +     A +L      E+ + + P+L ++  +D E++  Y  T+        + +++  + + +++ ND AP+F K  YE  + E+  +   +++V A D+D               D +R +L        ++    L  +Q  +D E   +  F++ A D       A +++ IT+ D ND  P   +    LV  +   + I         V  + V D D   +N  + C         L+   D  S D    Y L T  +LD E++ +  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENNDI   + +  ATD D G N+ + Y+I     + G+F I+  +G +++   LDRE++  Y   +VA+D+ +   K G+  + ITVLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA I   +   S + + Q    N TG++ S+  FDRE +S    +++  D       +S+V V +N+LDENDN P I +                    SN+ Y   ++ +   G  +  V+A D D    ++L Y +   AS N  + +F I   +G++T+ + + R   GL ++ V V D G PS
Sbjct:   71 YRVPEEQPPNILIGSLASDYGYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTN-IGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL-------HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTI--EIVAVDSGNPPLSSTN-SLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKFMLNGY-NFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQ----NGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVV-------------------PSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSI---ASGNPFE-LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 129.028 bits (323), Expect = 1.562e-29
Identity = 140/487 (28.75%), Postives = 218/487 (44.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE--TNHETQ---ALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I ++D+ND  P++      L I E    G+L       DRDS  +N G+   E     E Q    L++ +DQ      LI     +  LDRE       Y   I    G      ++  + +++ D NDNAP F    Y+  + EN+ +G+ + Q +A D D G NA I Y+   + D+   L  +D  TG + +  P+DRE       ++VA D+   + K+  TQ+TIT+ D NDN P  E+R +   +       I E++P+   +  +   D DEG NA +   ++ D  +Q   V+ TGS       L +    D E   +   +I   DS  GN  L+S  S+ V + D NDN P              SL    + E+++++ +V              V ATD D    SQL Y +    S    + IF I+  SG+I +N  L R+        V+  D G PSLK   ++++ +LD
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDS-GVN-GVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI----VMGMLDREQRDS---YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS--GNPPLSSTNSLKVQVTDVNDNAP----------VFSQSLMEVVFPENNDINDLVME------------VSATDADSGPNSQLHYSILPDPSA---RGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLD 612          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 220.32 bits (560), Expect = 3.649e-58
Identity = 219/786 (27.86%), Postives = 364/786 (46.31%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKF-AKQIDEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADKESA-TISLNVNVNRQKTLISVMKIV---IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD--------------GDNLRYILLPMTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP    +G +       D +  Y   L      +D K+GDI+T +  ID E+L    C + E      L   V+    +  V +++   I I+DI+DN P F  P  T+ I E  +   M+  +PAA D+D S  N   +Y +     A +L      E+ + + P+L ++  +D E++  Y  T+        + +++  + + +++ ND AP+F K  YE  + E+  +   +++V A D+D               D +R +L        ++    L  +Q  +D E   +  F++ A D       A +++ IT+ D ND  P   +    LV  +   + I         V  + V D D   +N  + C         L+   D  S D    Y L T  +LD E++ +  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENNDI   + +  ATD D G N+ + Y+I     + G+F I+  +G +++   LDRE++  Y   +VA+D+ +   K G+  + ITVLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA I   +   S + + Q    N TG++ S+  FDRE +S    +++  D       +S+V V +N+LDENDN P I +                    SN+ Y   ++ +   G  +  V+A D D    ++L Y +   AS N  + +F I   +G++T+ + + R   GL ++ V V D G PS
Sbjct:   71 YRVPEEQPPNILIGSLASDYGYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTN-IGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL-------HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTI--EIVAVDSGNPPLSSTN-SLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKFMLNGY-NFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQ----NGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVV-------------------PSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSI---ASGNPFE-LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 129.413 bits (324), Expect = 1.190e-29
Identity = 140/487 (28.75%), Postives = 218/487 (44.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE--TNHETQ---ALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I ++D+ND  P++      L I E    G+L       DRDS  +N G+   E     E Q    L++ +DQ      LI     +  LDRE       Y   I    G      ++  + +++ D NDNAP F    Y+  + EN+ +G+ + Q +A D D G NA I Y+   + D+   L  +D  TG + +  P+DRE       ++VA D+  +  K+  TQ+TIT+ D NDN P  E+R +   +       I E++P+   +  +   D DEG NA +   ++ D  +Q   V+ TGS       L +    D E   +   +I   DS  GN  L+S  S+ V + D NDN P              SL    + E+++++ +V              V ATD D    SQL Y +    S    + IF I+  SG+I +N  L R+        V+  D G PSLK   ++++ +LD
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDS-GVN-GVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI----VMGMLDREQRDS---YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANP-KTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS--GNPPLSSTNSLKVQVTDVNDNAP----------VFSQSLMEVVFPENNDINDLVME------------VSATDADSGPNSQLHYSILPDPS---ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLD 612          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 221.09 bits (562), Expect = 4.166e-58
Identity = 219/786 (27.86%), Postives = 364/786 (46.31%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKF-AKQIDEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADKESATIS-LNVNVNRQKTLISVMKIV---IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD--------------GDNLRYILLPMTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP    +G +       D +  Y   L      +D K+GDI+T +  ID E+L    C + E      L   V+    +  V +++   I I+DI+DN P F  P  T+ I E  +   M+  +PAA D+D S  N   +Y +     A +L      E+ + + P+L ++  +D E++  Y  T+        + +++  + + +++ ND AP+F K  YE  + E+  +   +++V A D+D               D +R +L        ++    L  +Q  +D E   +  F++ A D       A +++ IT+ D ND  P   +    LV  +   + I         V  + V D D   +N  + C         L+   D  S D    Y L T  +LD E++ +  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENNDI   + +  ATD D G N+ + Y+I     + G+F I+  +G +++   LDRE++  Y   +VA+D+ +   K G+  + ITVLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA I   +   S + + Q    N TG++ S+  FDRE +S    +++  D       +S+V V +N+LDENDN P I +                    SN+ Y   ++ +   G  +  V+A D D    ++L Y +   AS N  + +F I   +G++T+ + + R   GL ++ V V D G PS
Sbjct:   71 YRVPEEQPPNILIGSLASDYGYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTN-IGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL-------HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTI--EIVAVDSGNPPLSSTN-SLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKFMLNGY-NFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQ----NGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVV-------------------PSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSI---ASGNPFE-LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 809          

HSP 2 Score: 129.028 bits (323), Expect = 2.164e-29
Identity = 140/487 (28.75%), Postives = 218/487 (44.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE--TNHETQ---ALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I ++D+ND  P++      L I E    G+L       DRDS  +N G+   E     E Q    L++ +DQ      LI     +  LDRE       Y   I    G      ++  + +++ D NDNAP F    Y+  + EN+ +G+ + Q +A D D G NA I Y+   + D+   L  +D  TG + +  P+DRE       ++VA D+   + K+  TQ+TIT+ D NDN P  E+R +   +       I E++P+   +  +   D DEG NA +   ++ D  +Q   V+ TGS       L +    D E   +   +I   DS  GN  L+S  S+ V + D NDN P              SL    + E+++++ +V              V ATD D    SQL Y +    S    + IF I+  SG+I +N  L R+        V+  D G PSLK   ++++ +LD
Sbjct:  163 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDS-GVN-GVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI----VMGMLDREQRDS---YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS--GNPPLSSTNSLKVQVTDVNDNAP----------VFSQSLMEVVFPENNDINDLVME------------VSATDADSGPNSQLHYSILPDPS---ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLD 612          
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 220.705 bits (561), Expect = 4.959e-58
Identity = 219/786 (27.86%), Postives = 364/786 (46.31%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKF-AKQIDEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADKESATIS-LNVNVNRQKTLISVMKIV---IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD--------------GDNLRYILLPMTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            + + E QP    +G +       D +  Y   L      +D K+GDI+T +  ID E+L    C + E      L   V+    +  V +++   I I+DI+DN P F  P  T+ I E  +   M+  +PAA D+D S  N   +Y +     A +L      E+ + + P+L ++  +D E++  Y  T+        + +++  + + +++ ND AP+F K  YE  + E+  +   +++V A D+D               D +R +L        ++    L  +Q  +D E   +  F++ A D       A +++ IT+ D ND  P   +    LV  +   + I         V  + V D D   +N  + C         L+   D  S D    Y L T  +LD E++ +  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENNDI   + +  ATD D G N+ + Y+I     + G+F I+  +G +++   LDRE++  Y   +VA+D+ +   K G+  + ITVLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA I   +   S + + Q    N TG++ S+  FDRE +S    +++  D       +S+V V +N+LDENDN P I +                    SN+ Y   ++ +   G  +  V+A D D    ++L Y +   AS N  + +F I   +G++T+ + + R   GL ++ V V D G PS
Sbjct:   63 YRVPEEQPPNILIGSLASDYGYPDSKHLYKLELGHPYLRVDGKTGDIYTTETSIDRESL--RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTN-IGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLL-------HLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDE-GVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTI--EIVAVDSGNPPLSSTN-SLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLK-GTASVVITVLDRNDNDPKFMLNGY-NFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQ----NGTGTILSSISFDREHQSTYTFRLKAVDGG-DPPRSSYVGVTINVLDENDNAPVIVV-------------------PSNISYKY-LTPQTHPGTPVNWVRAEDMDTGINAELDYSI---ASGNPFE-LFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPS 801          

HSP 2 Score: 128.642 bits (322), Expect = 2.642e-29
Identity = 140/487 (28.75%), Postives = 218/487 (44.76%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE--TNHETQ---ALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I ++D+ND  P++      L I E    G+L       DRDS  +N G+   E     E Q    L++ +DQ      LI     +  LDRE       Y   I    G      ++  + +++ D NDNAP F    Y+  + EN+ +G+ + Q +A D D G NA I Y+   + D+   L  +D  TG + +  P+DRE       ++VA D+   + K+  TQ+TIT+ D NDN P  E+R +   +       I E++P+   +  +   D DEG NA +   ++ D  +Q   V+ TGS       L +    D E   +   +I   DS  GN  L+S  S+ V + D NDN P              SL    + E+++++ +V              V ATD D    SQL Y +    S    + IF I+  SG+I +N  L R+        V+  D G PSLK   ++++ +LD
Sbjct:  155 QIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDS-GVN-GVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLI----VMGMLDREQRDS---YDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGA-NPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS--GNPPLSSTNSLKVQVTDVNDNAP----------VFSQSLMEVVFPENNDINDLVME------------VSATDADSGPNSQLHYSILPDPS---ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLD 604          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 226.868 bits (577), Expect = 1.735e-60
Identity = 212/778 (27.25%), Postives = 357/778 (45.89%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR----YILLP--MTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATDGEFV---AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDH---LYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            + + E QP  T +G +     + D    Y   +      +D K+GDI T +  ID E L  C N         +   V++    Q     +++  I + DI+DN P F  P  T+ I E  +  ++   +P A D+D +  N   +Y +     A  L      E+   + P+L ++ ++D E+   Y  T+      +   +++  + + V++ ND AP+F +  YE  + E+  +   +I+V A D+D G N      +   P  +    +++ +  L  +Q  +D E   +  F++ A D       A +++ +TV D+ND  P+  +    LV  +   + I         V  + V DRD    N  + C         LR +  +  +D    Y L T   LD E + D  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENN  G  + +  A+D D G NA + Y+++      GLF I    G +++   LDRE+++ Y L +VA D+     + G+  + + VLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENAR+   +  D+   + Q    N TG++ S+  FDRE++S    Q++  D  +    +++V V +N+LDENDN P I                   T  SN  + + ++ + ++G  ++ V A D D    ++L+Y +       L    F I   SG IT+ + + R   GL ++ V V D G P
Sbjct:   40 YKVPEEQPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGN-PCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSL-FPIPLATDRD-AGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDE-GENAAVTCVVAGDVPFQLR-QASETGSDSKKKYFLQTTTPLDYEKVKDYTI--EIVAVDSGNPPLSSTN-SLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQ-GTATVLVNVLDCNDNDPKFMLSGY-NFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGV-PPRSAYVGVTINVLDENDNAPFI-------------------TAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGL----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 778          

HSP 2 Score: 139.043 bits (349), Expect = 1.101e-32
Identity = 146/493 (29.61%), Postives = 219/493 (44.42%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-----LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNIS------IPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS--VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P++      L I E    G L       DRD+     G+   E     +A     L++ +DQ      LI     + +LDRE          +  YD  IK Q   N        + + V D NDNAP F    Y+  + EN+ IG+ + Q +A D D G NA I Y    +  V   L  +D  TG + +  P+DRE  +    +++A D+     KS   Q+ +TV D NDNAP  E+R      + D   +I E++     +  +   D+DEGENA +   ++ D  +Q    ++TGS       L +    D EK      +I   DS  GN  L+S  S+ V ++D NDN P               +F  + TE       V      K G V+A V A+D D  + ++L Y LE    E   Q +F I  ++G+I +   L R+     ++KV+  D G PSL+   T++V +LD
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGP--NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLI----VMGNLDRE---------RWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATP-KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS--GNPPLSSTNSLKVQVVDVNDNAP---------------VFTQSITE-------VAFPENNKPGEVVAEVTASDADSGSNAELVYSLE---PEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLD 582          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 226.868 bits (577), Expect = 1.735e-60
Identity = 212/778 (27.25%), Postives = 357/778 (45.89%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR----YILLP--MTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATDGEFV---AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDH---LYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            + + E QP  T +G +     + D    Y   +      +D K+GDI T +  ID E L  C N         +   V++    Q     +++  I + DI+DN P F  P  T+ I E  +  ++   +P A D+D +  N   +Y +     A  L      E+   + P+L ++ ++D E+   Y  T+      +   +++  + + V++ ND AP+F +  YE  + E+  +   +I+V A D+D G N      +   P  +    +++ +  L  +Q  +D E   +  F++ A D       A +++ +TV D+ND  P+  +    LV  +   + I         V  + V DRD    N  + C         LR +  +  +D    Y L T   LD E + D  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENN  G  + +  A+D D G NA + Y+++      GLF I    G +++   LDRE+++ Y L +VA D+     + G+  + + VLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENAR+   +  D+   + Q    N TG++ S+  FDRE++S    Q++  D  +    +++V V +N+LDENDN P I                   T  SN  + + ++ + ++G  ++ V A D D    ++L+Y +       L    F I   SG IT+ + + R   GL ++ V V D G P
Sbjct:   40 YKVPEEQPPNTLIGSLAADYGLPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGN-PCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSL-FPIPLATDRD-AGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDE-GENAAVTCVVAGDVPFQLR-QASETGSDSKKKYFLQTTTPLDYEKVKDYTI--EIVAVDSGNPPLSSTN-SLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQ-GTATVLVNVLDCNDNDPKFMLSGY-NFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGV-PPRSAYVGVTINVLDENDNAPFI-------------------TAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGL----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 778          

HSP 2 Score: 139.043 bits (349), Expect = 1.101e-32
Identity = 146/493 (29.61%), Postives = 219/493 (44.42%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-----LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNIS------IPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS--VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P++      L I E    G L       DRD+     G+   E     +A     L++ +DQ      LI     + +LDRE          +  YD  IK Q   N        + + V D NDNAP F    Y+  + EN+ IG+ + Q +A D D G NA I Y    +  V   L  +D  TG + +  P+DRE  +    +++A D+     KS   Q+ +TV D NDNAP  E+R      + D   +I E++     +  +   D+DEGENA +   ++ D  +Q    ++TGS       L +    D EK      +I   DS  GN  L+S  S+ V ++D NDN P               +F  + TE       V      K G V+A V A+D D  + ++L Y LE    E   Q +F I  ++G+I +   L R+     ++KV+  D G PSL+   T++V +LD
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGP--NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLI----VMGNLDRE---------RWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATP-KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS--GNPPLSSTNSLKVQVVDVNDNAP---------------VFTQSITE-------VAFPENNKPGEVVAEVTASDADSGSNAELVYSLE---PEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLD 582          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 212.616 bits (540), Expect = 1.026e-55
Identity = 188/677 (27.77%), Postives = 316/677 (46.68%), Query Frame = 1
Query:  409 DDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR----YILLP--MTNYFQINNDGELHLIQ-KLDFEKHQSFSFTIQATDGEFV---AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDH---LYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            +DN P F  P  T+ I E  +  ++   +P A D+D    N   +Y +     A  L      E+   + P+L ++ ++D E+   Y  T+      +   +++  + + V++ ND AP+F +  YE  + E+  +   +I+V A D+D G N      +   P  +    +++ +  L  +Q  +D E   +  F++ A D       A +++ +TV D+ND  P+  +    LV  +   + I         V  + V DRD    N  + C         LR +  +  +D    Y L T   LD E + D  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENN  G  + +  A+D D G NA + Y+++      GLF I    G +++   LDRE+++ Y L +VA D+     + G+  + + VLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENAR+   +  D+   + Q    N TG++ S+  FDRE++S    Q++  D  +    +++V V +N+LDENDN P I                   T  SN  + + ++ + ++G  ++ V A D D    ++L+Y +       L    F I   SG IT+ + + R   GL ++ V V D G P
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSL-FPIPLATDRDAG-PNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDE-GENAAVTCVVAGDVPFQLR-QASETGSDSKKKYFLQTTTPLDYEKVKDYTI--EIVAVDSGNPPLSSTN-SLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQ-GTATVLVNVLDCNDNDPKFMLSGY-NFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGV-PPRSAYVGVTINVLDENDNAPFI-------------------TAPSNTSHRL-LTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPYGL----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 639          

HSP 2 Score: 133.65 bits (335), Expect = 4.646e-31
Identity = 143/487 (29.36%), Postives = 214/487 (43.94%), Query Frame = 1
Query: 1021 NDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-----LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNIS------IPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS--VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            ND  P++      L I E    G L       DRD+     G+   E     +A     L++ +DQ      LI     + +LDRE          +  YD  IK Q   N        + + V D NDNAP F    Y+  + EN+ IG+ + Q +A D D G NA I Y    +  V   L  +D  TG + +  P+DRE  +    +++A D+     KS   Q+ +TV D NDNAP  E+R      + D   +I E++     +  +   D+DEGENA +   ++ D  +Q    ++TGS       L +    D EK      +I   DS  GN  L+S  S+ V ++D NDN P               +F  + TE       V      K G V+A V A+D D  + ++L Y LE    E   Q +F I  ++G+I +   L R+     ++KV+  D G PSL+   T++V +LD 
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGP--NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLI----VMGNLDRE---------RWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATP-KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS--GNPPLSSTNSLKVQVVDVNDNAP---------------VFTQSITE-------VAFPENNKPGEVVAEVTASDADSGSNAELVYSLE---PEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDC 444          

HSP 3 Score: 122.479 bits (306), Expect = 1.164e-27
Identity = 141/515 (27.38%), Postives = 218/515 (42.33%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLI----DIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPE-----FSKTIYEES---VYEDISLDEIIIKVNAVDAD-GDNLRYILLPMTNY-FQINNDGE----------LHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV--DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFS---ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLY 1839
            + +LD +DN P+FE+P +  E+ E     + VI +  A D D    N EI Y     H A  +     R  R   LI     +D E     RF++ A  +     SA   V + V ++ND AP           +++    + ED++ +  +  V   D D G+N     +   +  FQ+    E          L     LD+EK + ++  I A D       + + LK+ V+DVND  P +  +  ++   E NK G +V ++T  D DS S    +   E     Q L     +         ++    SLDRE           +  D G    L    ++ +NV D NDN P F  S Y   V EN      +      D D G+NA     +Q SV  D+G FVI + TG +      DRE+++ Y   + A+D  V  R S    +TI VLD+NDNAP +   ++ S   +     +G  +  + A D D G NA + + ++  + Y
Sbjct:  107 VTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQV-KANDSDQGA-NAEIDYTF---HQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENG-------EIRVKTSLDREQ--RDSYELKVVAADRG-SPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENA----RVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPR-SAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGNPY 601          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 209.149 bits (531), Expect = 5.378e-54
Identity = 210/758 (27.70%), Postives = 353/758 (46.57%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATIS---------LNVNVNRQKTLISVMKIV-IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGP---RLRLLIDIDYEKQKQYRFTLSAYQK-NDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAES-KLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS----LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDED----IGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV-HDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREK----KSKVCTQIQLSDSAIGNV---LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            IF++D  SG           AL  N   D+E+   S           +N +R  +  +V     I+++DI+DN PEF   E+++ I E+      +      VDKD  + +    Y +  +   F +   + +G    R+R+ I +DYE   +Y F L A +   D    A + +TL  +N ND  P FS+ +Y  S+YE+I++   ++ V A D D      + Y      + F ++ D G + LI +LD+E  Q F+ T+ A DG     + +++I VLDVND  P++  +     + E   S   + ++   D DS   N  I  +  N        +        + IY+ Y V S    LD E IP+G+IY   +  D+G    LY+ + + + V D NDN P F    Y V V EN   G  +    ATD D     G+ ++I Y+++    S  F I++R+G +     LDRE K++Y+L + A+D  V H++K+G   + +T+LD NDN P  ++   + +++E  P    + T++A D D GEN  +++ +   + +  L  + TG + +  V  DRE     ++++  +I +S +  G      TS  +V VN+LD NDN P                         N+ +V ++      G  +  V A D D      +SY ++      + +  F I+  SG +T    L R+ I   +++V+  D+G P+  S  T+ V +LD+
Sbjct:  283 IFALDYISG-----------ALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITL--INENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPP-NNLITYSIVNASAFGSYFD--------ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAG-NPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESII-YSLE---GSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLN-STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTF----------------------RNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ----VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDV 986          

HSP 2 Score: 164.081 bits (414), Expect = 4.395e-40
Identity = 179/703 (25.46%), Postives = 306/703 (43.53%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINR-GIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQY-QVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIA------------FDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE--KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS--IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S   + + +LD++DN P F    F  EI E      + +Y   A+D D  + N  ++YRM       +   +++ G  +    ++D E+  +Y+  + A      + S+   +T++V+++ND  P F   +Y  SV ED+  +  ++ +N  D D G N  L Y +    +   F +   D  +  +  LD E   +++  ++A D   V + +     + +TVLDVND  P ++ +  +  + E    G  + Q+   D D     R   +    NH     R+    + + +L+         LDRE     ++      +D G  R   +++ + + V D+ND AP+F   QY ++G++E   IG  +   +ATD+D G   L+ Y I  S   G F ID  TG +  +  LD E K  Y++ + A D A      G   + +T+L++ D A +    + +  I+ENL +G  I  + A            FD      A+ +FK+             TG +    + DREK       +   D   G  + S V V + +LDENDN P+ F +  D                        +S+ E   VG  +A VKA D D  +  Q+ + L   AS N+  +  I   +   G++ + +PL R+ +    +KV+  D G P  K    + V ILD+
Sbjct:  870 SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTP-AGVSVYQVVAIDLDEGL-NGLVSYRMQVGMPRMDFVINSTSG-VVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNN-FRI---HVGSGLLM----RGPRPLDRERNSSHVLMVEAYNHDLGPMR---SSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDKDTGDGGLVNYRI-LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATDGA-PPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDA----------ITGVITVKGLVDREKGDFYTLTVVADDG--GPKVDSTVKVYITVLDENDNSPR-FDFTSDS----------------------AISVPEDCPVGQRVATVKARDPDAGSNGQVVFSL---ASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV 1518          

HSP 3 Score: 163.31 bits (412), Expect = 7.019e-40
Identity = 188/699 (26.90%), Postives = 325/699 (46.49%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPR---LRLLIDIDYEKQKQYRFTLSAYQKN--DESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPM-----TNYFQINNDGELHL--IQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNP-EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAV--VKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            S   + + +LD++D  P F    + + + E + R+  V++L    D D+ + N E++Y ++    A N++   S G R   +R ++ +D E    Y   L A       +  +    V + V+++ND  P F ++ YE SV EDI     I+++ A DAD      +   +      N F+I+    L +   + LD E++ S    ++A +   G   +  ++ + V DVNDE P +      +L + ET  +GI    I V   D  + + G+         +  + E D+ ST +++     TV  LD ET    ++  N    D      Q + ++ + L ++++ D A  F ++ Y+  + EN  +G ++ + QA   D        ++   S  +  LF ID+ TG + +   +DREK + Y LT+VA D     +   + ++ ITVLD+NDN+P     +D   S+ E+ P+G  + T+ A D D G N +++F L+  ++   ++ +T N + G +F  +  DRE+      ++  SD         H+ + V ILD NDN P           +I S F               +S+ E VG   +V  V+ATD D+   S LSYY+    +E  +   F +D+ SG+I T   P  R+      + V VED G P+L +   + V I+D
Sbjct:  975 STSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWL-NCTDNDVGL-NAELSYFIT----AGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRET--AGIGTSVIVVRATDKDTGDGGLVNYRILSGAEG-KFEIDE-STGLIV-----TVDYLDYETKTSYLM--NVSATDGAPPFNQGFCSVYVTL-LNEL-DEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGG--PKVDSTVKVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHI-LQVTILDVNDNPP-----------VIESPFG------------YNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYI----TEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVD 1624          

HSP 4 Score: 156.377 bits (394), Expect = 8.361e-38
Identity = 211/811 (26.02%), Postives = 347/811 (42.79%), Query Frame = 1
Query:  109 DGVQKFTIEENQPIKTFVGRIK---FAKQIDEEL----SYSF-GLITDIFSIDPKSG--DIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMT-------------NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGE--------FVAESKLKITVLDVNDEPPSYILNPEKLV-----IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI--CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQ---AVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-YLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            +G  +  + EN P  T +  +     A   DE++    +Y   G  +D+F ID  +G   + +  +ID EA             + L +       L     + I ILD +DN P F  P +T+ + E       V+ +  A D+D  + N E+ YR+ +G    F +  H   G        ID E+Q+ YR T+ A  +    +S    VT+ + +IND  PEF   I   SV E      II  V A+D D    L Y ++ +              + F +N N G + +   L+ E   ++  T+   D           V  +KL + +LDVND  P +   P  +      + E    G  +  +   D D   +N  I  T  +      ++LE            K+    ++D E +     + NF     D+G   +    I + L + DINDN P+F    YQ  V E+  +G  + +  ATD D G  ALI Y++   VD  G F I+  TG + ++  LDREKK+ Y+LT +A D       +R+  S Q+ I VLD ND  P+  +     S+ EN P G  + T++A D+DEG N+++ + L    + +  +V+    L + Q   R  +S     + +  +  G   L     + V ++D NDN P +F+   + T L           H   +  ++ ++ E        V ATDND      + Y +L+ + + + +   F ID  SG I   + L R+   +  + ++  D G P   ++ + + V + DI
Sbjct: 1959 EGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFS--------PPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQV-TATDEDSGL-NGELVYRIEAGAQDRFLI--HPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF--KPFGITYYTERVLEGATPGTTLIAVAAVDPDK-GLNGLITYTLLDLTPPGYVQLEDSSAG-------KVIANRTVDYEEVH----WLNFTVRASDNGSPPRA-AEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSL---VDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGM-EAFSVDMDSGLVTTQ---RPLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRP-VFVRPPNGTIL-----------HIKEEIPLRSNVYE--------VYATDNDEGLNGAVRYSFLKTTGNRDWEY--FTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDI 2713          

HSP 5 Score: 154.836 bits (390), Expect = 2.679e-37
Identity = 180/697 (25.82%), Postives = 304/697 (43.62%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDI-SLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFE-KHQSFSFTIQATD------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL----IYKLYTVHSLDRETIPDGIIYTNFICY-DSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDR--KSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYI----GTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTG--SLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITI-NRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + ILD++DN P  E P  + + + E +     V+ +  A D+DI + N  ++Y ++  +           G         D E+Q  Y   ++   +   ++SA  +V + +V+ ND AP F +  YE  + E   +++  +I V A+D D G N  + Y ++   + N F+IN + G +   ++LD+E  H  ++  + ATD          + + + + V D+ND  P++  + E        + G  V      DRDS            N + +   ++ D +   ++     + ++     LDRETI     Y   IC  D G+   L + + + + V DINDN P+  +    V + EN+ +   +    A+D D G NAL+T+NI        F I++ TG + + +PLDRE+  +Y LT+   D   + R  +     L +++ D+NDN P   E T    ++EN P G  +    G ++A D DE   A + ++L   H    +  N TG  ++ S  + DRE  S    ++ L    IG  L     + + ILD+NDN+P                        S   Y V +      GF +  V ATD D     +L Y +E  A     Q  F I   +G I + N  + R+     ++ V+  D G   L     + + I DI
Sbjct: 1513 VTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQV-RATDRDIGI-NSVLSYYITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFLAHDRDS----------GPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETI---AFYNLTICARDRGVP-PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQ-LNGTAHLFITILDDNDNWPTF----------------------SPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGA-----QDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDI 2165          

HSP 6 Score: 141.354 bits (355), Expect = 4.060e-33
Identity = 142/544 (26.10%), Postives = 245/544 (45.04%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIH--RKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD--GEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF--PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV---DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID--QAVHDRKSGSTQLTITVLDDND----NAPELR-EYTDFSILENLPIGHYIGTLI-AFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLS 1935
            K+ + ILD++DN P+F+    T   + V+        +   AAVD D  + N  I Y +        ++  +S   ++     +DYE+     FT+ A        +A + V L++V+IND  P F +  Y+E+V+EDI++  +I++V A DAD  N   + Y L+     F IN N G++ ++  LD EK   +  T  A D  G+  +  +     + I VLDVND  P +        + E   +G  V  +   D+D  S       ++  +  +   +E   +  D  L+     + S +R  +         +  D G +  L+    + + V D+NDN P+F  P +   + +KE   +   +++  ATD D G N  + Y+   +    D   F ID  +G ++  Q LDREK+  Y L +VA D  Q V        Q+ +  +DDN+      P+   +Y   ++ E+ P G  +G +  A D DEG NA + + ++     +   +   G L   +  DRE ++     ++ S
Sbjct: 2276 KLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGL-NGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGS------NSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNL-------TVVATDGG-EPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKAS 2804          

HSP 7 Score: 141.354 bits (355), Expect = 4.164e-33
Identity = 171/652 (26.23%), Postives = 282/652 (43.25%), Query Frame = 1
Query:  196 ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEK--QKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-----GDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD-------SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDG--------IIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSA-IGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTL 2049
            E++Y F    D FS+D  +G I  +  +D E +             +L V         +  ++ I +LD++DN P F+K  +   ++E       ++ L  A D+D S  N  I Y +   S   S F++  +   G  + +   +DYE+        T+ A    +  + + + VT++V + ND  P FSK  Y  SV E+I     ++ +NA D D     G       L  ++ F+IN   GE+     LD E    +   ++A DG      K     + +T+LD+ND  P++   P  + + E       V  +   D D         SI+   K    N  T  +R      +T ++L          DRE  PD         II +   C    +K    ++ ++ +N+ D+NDN P F +  +   + E    G  ++Q  A D D G N L++Y +Q  +    FVI+S +G +     LDRE+  +Y L +VA D     + S ST LT+ VLD ND  P       + S+ E++P    +  L   D D G NA + + ++  ++    +V    ++    V  DRE  +     ++  D+  +G   T   +V V +LD NDN P IFL    E ++
Sbjct:  492 EVNYFFSDDPDRFSLDKDTGLIMLIARLDYELI----------QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRL-RATDED-SPPNNLITYSIVNASAFGSYFDISIYEGYG-VISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIR------TTHVML----------DREN-PDPVEAELMRKIIVSVTDCGRPPLKAT--SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTST-LTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRP-IFLQSSYEASV 1109          

HSP 8 Score: 136.732 bits (343), Expect = 1.035e-31
Identity = 174/650 (26.77%), Postives = 294/650 (45.23%), Query Frame = 1
Query:  523 MKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGE----FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-------RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQL-FQAQATDEDIGKNA-----LITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDID--KKSGKITINRPLHRDLI--GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            M N  + + +SG+ ++ F   E ++    LR  +D + + +    F++S +Q           V +QV ++ND AP F    Y   + E+  +   I  VNA D D   G ++ Y   P + +F I++  G + +IQ+LD+E  Q++  T+ ATD +        + L I + D+ D  P +I  P    I E +  G  V  IT  D+D     RGI  T  +  T ++    D +S  + L         LDRE   + +    FI    G +              +  + V DINDNAP F SS+Y V + E   +G+ L    Q  D+D G N+     L+  N    + S   V       +++  PLD E  ++Y   + A +++V D   G  ++ IT++++NDN P   +   + S+ EN+ +G  + T++A D D G    + +  S D      +++K TG +      D E   +    +   D   G   T  V   +N+LD NDN P    ++KD    + +L  N      +V  +V++             +ATD D    + ++Y + N+++     S FDI   +  G I+++RPL  + I  GL  + VM +D+G+P L S   + +E+ D
Sbjct:   60 MDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQG-----VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDK-GRPRGIGYTIVSGNTNSI-FALDYISGALTL------NGLLDRE---NPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFA-NESVPDH-VGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDP--DRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGG-GEETTGRVR--INVLDVNDNVPT---FQKD--AYVGALREN----EPSVTQLVRL-------------RATDEDSPPNNLITYSIVNASAFG---SYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFD 661          

HSP 9 Score: 126.716 bits (317), Expect = 1.160e-28
Identity = 185/799 (23.15%), Postives = 326/799 (40.80%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDE------ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIIL-DIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAV-----DKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-------------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVL---DVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRD-SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP-----LNVHDINDNAPLFPS---SQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVI-DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSH----VSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            TI EN P+ +FV  +  A   D         + + G     F I+  +G +   + +D E +       +   T+S+  N    +       ++++ L D +DN P F +  +  E+ E       +  L   +     D+D+      + Y++ G HS   + ++++    +R  I ID E        L    ++   ++   ++ + +++ ND  P FS   Y   + E+      +++V A D D             G   R+++ P+T   ++ N         +D E+ +S+  T+ ATD   V  S   I  +   D+ND  P + LNP + V + E+ + G ++  +T  D D +  +   I       +T  L  +++      +    +     L+RE +    +  + I   S +      ++S+P     +N+ D+NDN P F     + Y   V E    G  L    A D D G N LITY +      G   + DS  G +   + +D E+ +    T+ A D     R +    + + ++D NDN P   + +   ++ E++ +G  I  + A D D G  A I + L +D   +      TG +      DREKK          D+  G+V ++     V V + +LD ND  PQ   + K + +   S++ N                 E  G  +  + ATD D  + SQL+Y LE    E      F +D  SG +T  RPL         + V+  D G P L     ++VE++D+
Sbjct: 1857 TISENSPVSSFVAHV-LASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP------EYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGN-------ATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEF-LNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEH---SVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPR-AAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSL-VDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNP-GDVASNRRENSVQVVIRVLDVNDCRPQ---FSKPQFS--TSVYEN-----------------EPAGTSVITMLATDQDEGSNSQLTYSLEGPGME-----AFSVDMDSGLVTTQRPLQS--YERFNLTVVATDGGEPPLWGTTMLLVEVIDV 2602          

HSP 10 Score: 115.161 bits (287), Expect = 3.592e-25
Identity = 189/766 (24.67%), Postives = 307/766 (40.08%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN------YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGE---FVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSG----ILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI---YKLYTVHS---LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKD-----EGENARIMFKLSMDHLYQ----PLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIG----NVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            G I + F I+  +G I   K +D E +         +AT    +  +R   L S   +++ + DI+DN P F +  E   ++ E      +  +L  A D+D S  N ++ Y +  GD     +        R+R  +++D E    Y  T+ A  +    +S+ M V ++V++IND  P         ++ E+  +   +  V A DAD      +   +T       +F     G + + + LD E+   +  T+   D      +A      L +++ D ND  P +     +  + E + +G    +L G I   D D           E  +     +L      +D+ +I     + TV S   +DRE      +    +  D G   QL     + + + D NDN P F    Y V + EN   G+ + Q  ATDED G N  + Y I+       F+I   TG +++    +DRE++  Y LT+VA D+      SG+  +TI + D ND+ PE L      S+LE+   G  I  + A D D     E     I+ K   D L         VN  TGS+      +RE  +     + + D+A      +V   +  + VNILD NDN PQ               F  TY       Y  ++      G  +  V A D D      ++Y L +       Q     D  +GK+  NR +  + +      V   D+G P   +   + +EI+DI
Sbjct: 1675 GNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHR---LTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL--AHDRD-SGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDAD-----------EDVYAVVTYQLLGTH--SDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIG---QLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQD-RFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPL-SGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF------------KPFGITY-------YTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLE---DSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDI 2393          

HSP 11 Score: 107.071 bits (266), Expect = 1.176e-22
Identity = 187/810 (23.09%), Postives = 325/810 (40.12%), Query Frame = 1
Query:   94 FFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGL----ITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY-QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINN-DGELHLIQKLDFEK---HQSFSFTIQATD-------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQ-ITVFDRDSVSINRGIKCTETNHETQALRLEKD--QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP---------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL-ENLPIGHYIGTLIAFDKDEGENARIMFKL----SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVN---NVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS--GHPSLKSAKTIMVEILDI 2391
            FF+ +       I E+ P+ + V ++  A+ +D +    FG+     +  F+++P +G +   + +D E         K   T+  +V+ ++    +   K+ I + D++DN P F    +++ I E        I++  A D D+      + Y        F ++  ++RG  + ++ ++DYE  + Y+ T++A  Q     +S   N+ + + ++ D  P F    Y  ++YE       +  + AVD D    R I   +      + F ++   G L L   LD E       F  T++ T+        +    +   I V+D+ND  P +  +   + I E  + G  +   I V D+D   +N   +     + +    +     Q   DI    ++     LD ET+           YD      L+ N S+P         + + + NDN P+F    Y V + EN  +G  +    ATD D+G    + Y   FS D   F +D  TG + L+  LD E   ++ LT++A D    +    + ++ I VLD NDN P  ++      L EN P    +  L A D+D   N  I + +    +    +        G +  ++  D E+       + +     GN  L S V V + + DENDN P                   T+++ +   Y V +      G  +  + ATD D +       + Y LE S       S F I+ +SG+IT    L R+      + V   D   GH       T+ V +LDI
Sbjct:   35 FFDTY-----LLISEDTPVGSSVTQL-LARDMDND-PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRET--------KSEFTVEFSVSDHQG---VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTP-VGTPIFIVNATDPDLG-AGGSVLYSFQPPSPFFAID--SARG-IVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDE-GLNSMFEVYLVGNNSHHFIISPTSVQGKADI----RIRVAIPLDYETVDR---------YDF----DLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNY--FFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEET---TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPP-------------------TFSKPA---YFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGS-------SQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDI 769          

HSP 12 Score: 105.916 bits (263), Expect = 2.580e-22
Identity = 135/532 (25.38%), Postives = 224/532 (42.11%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVID--------LEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSK----TIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN-----YFQINN-DGELHLIQKLDFEKHQSFSFTIQATD-GEFV---AESKLKITVLDVNDEPPSYILNPEK------LVIDETNKSGILVGQITVFDRDSVSINRGIKC-----TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP--------------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF----------SVDSG-LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD 1641
            F+I+P +GDI  L  +D        L AL  ++  D  S         NR++  +   ++VI +LD++D +P+F KP+F+  + E       VI +  A D+D    N ++ Y + G    AF+++  +      R L     +  +++  T+ A    +  +     + ++V+++ND  P F +    TI    + E+I L   + +V A D D G N  +RY  L  T      YF I+   G +   Q+LD EK   +S  + A+D G+ V       L++ + D++D  P ++  P+       L + E +  G LVG +T     +V  + G             E +   L+ D          +L  +  LDRET        +FI   S  +         P              + + DIND  P F  ++Y  GV  +  +G +L Q  A D DIG N+L+ Y I            S D G +F + S  G L+            +++ IVA D A H+
Sbjct: 2446 FAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVAS---------NRRENSV---QVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITM-LATDQD-EGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPL-----QSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILH--IKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVT----GAVDADEGPNAIVYYFIAAGDEDKNFHLQPDG---------RLLVLRDLDRET----EATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARDLAGHN 2939          

HSP 13 Score: 98.9821 bits (245), Expect = 3.183e-20
Identity = 180/750 (24.00%), Postives = 298/750 (39.73%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDL--EALCFNS---CADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKD----------ISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNI---NDCAPEFSKTIYEESVYEDISLDEIIIKVN----AVDADGDN---LRYILLPM-TNYFQINNDGELHLIQKLDFEKHQSFS-----FTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-------VSINRGIKCTETNHE-TQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV-----------DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV----HDRKSGSTQLTITVLDDNDNAPELRE----YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            F I P  G +   K ++L  E + F +   CA                  L S M + I +LDI+DN P        + I E     + V ++ A+ D D          I+  N+E A+ ++       +               +D E+  +YR T+S     +    A  +  L +V++   ND  P F++  Y+  V E+      +  +N    A+DAD D    + Y LL   ++ F I+N   +  ++       ++FS       + A D G+    + L IT+LD ND  P++      + + E    G  V Q+T  D DS         I  G +     H  T  +R+    +  +    Y+L TV + DR T+P                  L     + + + DIND+ P F +    V V E+ + G  +    A D D+  N  + Y+I   V               F ++  TG + +  PL+RE    Y +T+  ID A     H     + +LT+ +LD NDN P+ +     Y    +LE    G  +  + A D D+G N  I + L +D     Y  L  +  G + +N+  D E+   +   ++ SD+       + + V + I+D NDN P IF    D+ +   ++F +                   VG VI  V ATD D  N + + Y L +   +      F I+  +G I++   L R+
Sbjct: 1790 FVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGV-----------PPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLAS-DADSGCNALLTFNITAGNRERAFFINATTGIVTVNRP------------LDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGNATIDREEQESYRL-TVVATDRGTVP------------------LSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTL-LDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNG-SPPRAAEIPVYLEIVDINDNNP-IF----DQPSYQEAVFEDI-----------------AVGTVILRVTATDADSGNFALIEYSLVDGEGK------FAINPNTGDISVLSSLDRE 2464          
BLAST of Protocadherin gamma vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 207.223 bits (526), Expect = 1.802e-53
Identity = 213/760 (28.03%), Postives = 356/760 (46.84%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATIS---------LNVNVNRQKTLISVMKIV-IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKD-ISMKNKEIAYRMSGDHS-AFNLEEHNSRGP---RLRLLIDIDYEKQKQYRFTLSAYQK-NDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAES-KLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS----LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDED----IGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV-HDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREK----KSKVCTQIQLSDSAIGNV---LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            IF++D  SG           AL  N   D+E+   S           +N +R  +  +V     I+++DI+DN PEF   E+++ I E+      +      VDKD +S  N      + G++S  F +   + +G    R+R+ I +DYE   +Y F L A +   D    A + +TL  +N ND  P FS+ +Y  S+YE+I++   ++ V A D D      + Y      + F ++ D G + LI +LD+E  Q F+ T+ A DG     + +++I VLDVND  P++  +     + E   S   + ++   D DS   N  I  +  N        +        + IY+ Y V S    LD E IP+G+IY   +  D+G    LY+ + + + V D NDN P F    Y V V EN   G  +    ATD D     G+ ++I Y+++    S  F I++R+G +     LDRE K++Y+L + A+D  V H++K+G   + +T+LD NDN P  ++   + +++E  P    + T++A D D GEN  +++ +   + +  L  + TG + +  V  DRE     ++++  +I +S +  G      TS  +V VN+LD NDN P                         N+ +V ++      G  +  V A D D      +SY ++      + +  F I+  SG +T    L R+ I   +++V+  D+G P+  S  T+ V +LD+
Sbjct:  283 IFALDYISG-----------ALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITL--INENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPP-NNLITYSIVNASAFGSYFD--------ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAG-NPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESII-YSLE---GSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLN-STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTF----------------------RNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ----VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDV 988          

HSP 2 Score: 165.236 bits (417), Expect = 1.637e-40
Identity = 191/699 (27.32%), Postives = 325/699 (46.49%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPR---LRLLIDIDYEKQKQYRFTLSAYQKN--DESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPM-----TNYFQINNDGELHL--IQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNP-EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAV--VKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            S   + + +LD++D  P F    + + + E + R+  V++L    D D+ + N E++Y ++    A N++   S G R   +R ++ +D E    Y   L A       +  +    V + V+++ND  P F ++ YE SV EDI     I+++ A DAD      +   +      N F+I+    L +   + LD E++ S    ++A +   G   +  ++ + V DVNDE P +      +L + ET  +GI    I V   D  + + G+         +  + E D+ ST +++     TV  LD ET    ++  N    D      Q + ++ + L ++++ D A  F ++ Y+  + EN  +G ++ + QA   D        ++   S  +  LF ID+ TG + +   +DREK + Y LT+VA D      K  ST + ITVLD+NDN+P     +D   S+ E+ P+G  + T+ A D D G N +++F L+  ++   ++ +T N + G +F  +  DRE+      ++  SD         H+ + V ILD NDN P           +I S F               +S+ E VG   +V  V+ATD D+   S LSYY+    +E  +   F +D+ SG+I T   P  R+      + V VED G P+L +   + V I+D
Sbjct:  977 STSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWL-NCTDNDVGL-NAELSYFIT----AGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRET--AGIGTSVIVVRATDKDTGDGGLVNYRILSGAEG-KFEIDE-STGLIV-----TVDYLDYETKTSYLM--NVSATDGAPPFNQGFCSVYVTL-LNEL-DEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGG---PKVDSTVVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHI-LQVTILDVNDNPP-----------VIESPFG------------YNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYI----TEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVD 1625          

HSP 3 Score: 159.844 bits (403), Expect = 7.286e-39
Identity = 177/703 (25.18%), Postives = 303/703 (43.10%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINR-GIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQY-QVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIA------------FDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE--KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS--IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S   + + +LD++DN P F    F  EI E      + +Y   A+D D  + N  ++YRM       +   +++ G  +    ++D E+  +Y+  + A      + S+   +T++V+++ND  P F   +Y  SV ED+  +  ++ +N  D D G N  L Y +    +   F +   D  +  +  LD E   +++  ++A D   V + +     + +TVLDVND  P ++ +  +  + E    G  + Q+   D D     R   +    NH     R+    + + +L+         LDRE     ++      +D G  R   +++ + + V D+ND AP+F   QY ++G++E   IG  +   +ATD+D G   L+ Y I  S   G F ID  TG +  +  LD E K  Y++ + A D A      G   + +T+L++ D A +    + +  I+ENL +G  I  + A            FD      A+ +FK+             TG +    + DREK       +   D   G        V + +LDENDN P+ F +  D                        +S+ E   VG  +A VKA D D  +  Q+ + L   AS N+  +  I   +   G++ + +PL R+ +    +KV+  D G P  K    + V ILD+
Sbjct:  872 SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTP-AGVSVYQVVAIDLDEGL-NGLVSYRMQVGMPRMDFVINSTSG-VVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNN-FRI---HVGSGLLM----RGPRPLDRERNSSHVLMVEAYNHDLGPMR---SSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDKDTGDGGLVNYRI-LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATDGA-PPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDA----------ITGVITVKGLVDREKGDFYTLTVVADD---GGPKVDSTVVYITVLDENDNSPR-FDFTSDS----------------------AISVPEDCPVGQRVATVKARDPDAGSNGQVVFSL---ASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV 1519          

HSP 4 Score: 156.377 bits (394), Expect = 8.291e-38
Identity = 212/812 (26.11%), Postives = 345/812 (42.49%), Query Frame = 1
Query:  109 DGVQKFTIEENQPIKTFVGRIK---FAKQIDEEL----SYSF-GLITDIFSIDPKSG--DIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMT-------------NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGE--------FVAESKLKITVLDVNDEPPSYILNPEKLV-----IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI--CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQ---AVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDND--VNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            +G  +  + EN P  T +  +     A   DE++    +Y   G  +D+F ID  +G   + +  +ID EA             + L +       L     + I ILD +DN P F  P +T+ + E       V+ +  A D+D  + N E+ YR+ +G    F +  H   G        ID E+Q+ YR T+ A  +    +S    VT+ + +IND  PEF   I   SV E      II  V A+D D    L Y ++ +              + F +N N G + +   L+ E   ++  T+   D           V  +KL + +LDVND  P +   P  +      + E    G  +  +   D D   +N  I  T  +      ++LE            K+    ++D E +     + NF     D+G   +    I + L + DINDN P+F    YQ  V E+  +G  + +  ATD D G  ALI Y++   VD  G F I+  TG + ++  LDREKK+ Y+LT +A D       +R+  S Q+ I VLD ND  P+  +     S+ EN P G  + T++A D+DEG N+++ + L    + +  +V+    L + Q   R  +S     + +  +  G   L     + V ++D NDN P +F+   + T L           H   +  ++ ++ E        V ATDND  +N   + S+      + N     F ID  SG I   + L R+   +  + ++  D G P   ++ + + V + DI
Sbjct: 1960 EGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFS--------PPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQV-TATDEDSGL-NGELVYRIEAGAQDRFLI--HPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF--KPFGITYYTERVLEGATPGTTLIAVAAVDPDK-GLNGLITYTLLDLTPPGYVQLEDSSAG-------KVIANRTVDYEEVH----WLNFTVRASDNGSPPRA-AEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSL---VDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGM-EAFSVDMDSGLVTTQ---RPLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRP-VFVRPPNGTIL-----------HIKEEIPLRSNVYE--------VYATDNDEGLNGAVRYSFL---KTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDI 2714          

HSP 5 Score: 154.836 bits (390), Expect = 2.634e-37
Identity = 180/697 (25.82%), Postives = 304/697 (43.62%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDI-SLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFE-KHQSFSFTIQATD------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL----IYKLYTVHSLDRETIPDGIIYTNFICY-DSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDR--KSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYI----GTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTG--SLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITI-NRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + ILD++DN P  E P  + + + E +     V+ +  A D+DI + N  ++Y ++  +           G         D E+Q  Y   ++   +   ++SA  +V + +V+ ND AP F +  YE  + E   +++  +I V A+D D G N  + Y ++   + N F+IN + G +   ++LD+E  H  ++  + ATD          + + + + V D+ND  P++  + E        + G  V      DRDS            N + +   ++ D +   ++     + ++     LDRETI     Y   IC  D G+   L + + + + V DINDN P+  +    V + EN+ +   +    A+D D G NAL+T+NI        F I++ TG + + +PLDRE+  +Y LT+   D   + R  +     L +++ D+NDN P   E T    ++EN P G  +    G ++A D DE   A + ++L   H    +  N TG  ++ S  + DRE  S    ++ L    IG  L     + + ILD+NDN+P                        S   Y V +      GF +  V ATD D     +L Y +E  A     Q  F I   +G I + N  + R+     ++ V+  D G   L     + + I DI
Sbjct: 1514 VTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQV-RATDRDIGI-NSVLSYYITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFLAHDRDS----------GPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETI---AFYNLTICARDRGVP-PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQ-LNGTAHLFITILDDNDNWPTF----------------------SPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGA-----QDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDI 2166          

HSP 6 Score: 141.354 bits (355), Expect = 3.958e-33
Identity = 171/652 (26.23%), Postives = 282/652 (43.25%), Query Frame = 1
Query:  196 ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEK--QKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-----GDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD-------SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDG--------IIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSA-IGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTL 2049
            E++Y F    D FS+D  +G I  +  +D E +             +L V         +  ++ I +LD++DN P F+K  +   ++E       ++ L  A D+D S  N  I Y +   S   S F++  +   G  + +   +DYE+        T+ A    +  + + + VT++V + ND  P FSK  Y  SV E+I     ++ +NA D D     G       L  ++ F+IN   GE+     LD E    +   ++A DG      K     + +T+LD+ND  P++   P  + + E       V  +   D D         SI+   K    N  T  +R      +T ++L          DRE  PD         II +   C    +K    ++ ++ +N+ D+NDN P F +  +   + E    G  ++Q  A D D G N L++Y +Q  +    FVI+S +G +     LDRE+  +Y L +VA D     + S ST LT+ VLD ND  P       + S+ E++P    +  L   D D G NA + + ++  ++    +V    ++    V  DRE  +     ++  D+  +G   T   +V V +LD NDN P IFL    E ++
Sbjct:  494 EVNYFFSDDPDRFSLDKDTGLIMLIARLDYELI----------QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRL-RATDED-SPPNNLITYSIVNASAFGSYFDISIYEGYG-VISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIR------TTHVML----------DREN-PDPVEAELMRKIIVSVTDCGRPPLKAT--SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTST-LTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRP-IFLQSSYEASV 1111          

HSP 7 Score: 141.354 bits (355), Expect = 4.094e-33
Identity = 142/544 (26.10%), Postives = 245/544 (45.04%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIH--RKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD--GEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF--PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV---DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID--QAVHDRKSGSTQLTITVLDDND----NAPELR-EYTDFSILENLPIGHYIGTLI-AFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLS 1935
            K+ + ILD++DN P+F+    T   + V+        +   AAVD D  + N  I Y +        ++  +S   ++     +DYE+     FT+ A        +A + V L++V+IND  P F +  Y+E+V+EDI++  +I++V A DAD  N   + Y L+     F IN N G++ ++  LD EK   +  T  A D  G+  +  +     + I VLDVND  P +        + E   +G  V  +   D+D  S       ++  +  +   +E   +  D  L+     + S +R  +         +  D G +  L+    + + V D+NDN P+F  P +   + +KE   +   +++  ATD D G N  + Y+   +    D   F ID  +G ++  Q LDREK+  Y L +VA D  Q V        Q+ +  +DDN+      P+   +Y   ++ E+ P G  +G +  A D DEG NA + + ++     +   +   G L   +  DRE ++     ++ S
Sbjct: 2277 KLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGL-NGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGS------NSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNL-------TVVATDGG-EPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKAS 2805          

HSP 8 Score: 134.035 bits (336), Expect = 6.849e-31
Identity = 174/652 (26.69%), Postives = 293/652 (44.94%), Query Frame = 1
Query:  523 MKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGE----FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-------RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQL---FQAQATDEDIGKNA-----LITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDID--KKSGKITINRPLHRDLI--GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            M N  + + +SG+ ++ F   E ++    LR  +D + + +    F++S +Q           V +QV ++ND AP F    Y   + E+  +   I  VNA D D   G ++ Y   P + +F I++  G + +IQ+LD+E  Q++  T+ ATD +        + L I + D+ D  P +I  P    I E +  G  V  IT  D+D     RGI  T  +  T ++    D +S  + L         LDRE   + +    FI    G +              +  + V DINDNAP F SS+Y V + E   +G+ L    Q    DE  G N+     L+  N    + S   V       +++  PLD E  ++Y   + A +++V D   G  ++ IT++++NDN P   +   + S+ EN+ +G  + T++A D D G    + +  S D      +++K TG +      D E   +    +   D   G   T  V   +N+LD NDN P    ++KD    + +L  N      +V  +V++             +ATD D    + ++Y + N+++     S FDI   +  G I+++RPL  + I  GL  + VM +D+G+P L S   + +E+ D
Sbjct:   60 MDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQG-----VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDK-GRPRGIGYTIVSGNTNSI-FALDYISGALTL------NGLLDRE---NPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFA-NESVPDH-VGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDP--DRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGG-GEETTGRVR--INVLDVNDNVPT---FQKD--AYVGALREN----EPSVTQLVRL-------------RATDEDSPPNNLITYSIVNASAFG---SYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFD 663          

HSP 9 Score: 126.716 bits (317), Expect = 1.093e-28
Identity = 185/799 (23.15%), Postives = 326/799 (40.80%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDE------ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIIL-DIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAV-----DKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-------------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVL---DVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRD-SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP-----LNVHDINDNAPLFPS---SQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVI-DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSH----VSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            TI EN P+ +FV  +  A   D         + + G     F I+  +G +   + +D E +       +   T+S+  N    +       ++++ L D +DN P F +  +  E+ E       +  L   +     D+D+      + Y++ G HS   + ++++    +R  I ID E        L    ++   ++   ++ + +++ ND  P FS   Y   + E+      +++V A D D             G   R+++ P+T   ++ N         +D E+ +S+  T+ ATD   V  S   I  +   D+ND  P + LNP + V + E+ + G ++  +T  D D +  +   I       +T  L  +++      +    +     L+RE +    +  + I   S +      ++S+P     +N+ D+NDN P F     + Y   V E    G  L    A D D G N LITY +      G   + DS  G +   + +D E+ +    T+ A D     R +    + + ++D NDN P   + +   ++ E++ +G  I  + A D D G  A I + L +D   +      TG +      DREKK          D+  G+V ++     V V + +LD ND  PQ   + K + +   S++ N                 E  G  +  + ATD D  + SQL+Y LE    E      F +D  SG +T  RPL         + V+  D G P L     ++VE++D+
Sbjct: 1858 TISENSPVSSFVAHV-LASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP------EYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGN-------ATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEF-LNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEH---SVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPR-AAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSL-VDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNP-GDVASNRRENSVQVVIRVLDVNDCRPQ---FSKPQFS--TSVYEN-----------------EPAGTSVITMLATDQDEGSNSQLTYSLEGPGME-----AFSVDMDSGLVTTQRPLQS--YERFNLTVVATDGGEPPLWGTTMLLVEVIDV 2603          

HSP 10 Score: 115.161 bits (287), Expect = 3.415e-25
Identity = 189/766 (24.67%), Postives = 307/766 (40.08%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN------YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGE---FVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSG----ILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI---YKLYTVHS---LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKD-----EGENARIMFKLSMDHLYQ----PLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIG----NVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            G I + F I+  +G I   K +D E +         +AT    +  +R   L S   +++ + DI+DN P F +  E   ++ E      +  +L  A D+D S  N ++ Y +  GD     +        R+R  +++D E    Y  T+ A  +    +S+ M V ++V++IND  P         ++ E+  +   +  V A DAD      +   +T       +F     G + + + LD E+   +  T+   D      +A      L +++ D ND  P +     +  + E + +G    +L G I   D D           E  +     +L      +D+ +I     + TV S   +DRE      +    +  D G   QL     + + + D NDN P F    Y V + EN   G+ + Q  ATDED G N  + Y I+       F+I   TG +++    +DRE++  Y LT+VA D+      SG+  +TI + D ND+ PE L      S+LE+   G  I  + A D D     E     I+ K   D L         VN  TGS+      +RE  +     + + D+A      +V   +  + VNILD NDN PQ               F  TY       Y  ++      G  +  V A D D      ++Y L +       Q     D  +GK+  NR +  + +      V   D+G P   +   + +EI+DI
Sbjct: 1676 GNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHR---LTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL--AHDRD-SGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDAD-----------EDVYAVVTYQLLGTH--SDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIG---QLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQD-RFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPL-SGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF------------KPFGITY-------YTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLE---DSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDI 2394          

HSP 11 Score: 109.768 bits (273), Expect = 1.495e-23
Identity = 189/811 (23.30%), Postives = 327/811 (40.32%), Query Frame = 1
Query:   94 FFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGL----ITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY-QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINN-DGELHLIQKLDFEK---HQSFSFTIQATD-------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQ-ITVFDRDSVS-INRGIKCTETNHETQALRLEKD--QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP---------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL-ENLPIGHYIGTLIAFDKDEGENARIMFKL----SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVN---NVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS--GHPSLKSAKTIMVEILDI 2391
            FF+ +       I E+ P+ + V ++  A+ +D +    FG+     +  F+++P +G +   + +D E         K   T+  +V+ ++    +   K+ I + D++DN P F    +++ I E        I++  A D D+      + Y        F ++  ++RG  + ++ ++DYE  + Y+ T++A  Q     +S   N+ + + ++ D  P F    Y  ++YE       +  + AVD D    R I   +      + F ++   G L L   LD E       F  T++ T+        +    +   I V+D+ND  P +  +   + I E  + G  +   I V D+D VS +N   +     + +    +     Q   DI    ++     LD ET+           YD      L+ N S+P         + + + NDN P+F    Y V + EN  +G  +    ATD D+G    + Y   FS D   F +D  TG + L+  LD E   ++ LT++A D    +    + ++ I VLD NDN P  ++      L EN P    +  L A D+D   N  I + +    +    +        G +  ++  D E+       + +     GN  L S V V + + DENDN P                   T+++ +   Y V +      G  +  + ATD D +       + Y LE S       S F I+ +SG+IT    L R+      + V   D   GH       T+ V +LDI
Sbjct:   35 FFDTY-----LLISEDTPVGSSVTQL-LARDMDND-PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRET--------KSEFTVEFSVSDHQG---VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTP-VGTPIFIVNATDPDLG-AGGSVLYSFQPPSPFFAID--SARG-IVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADI----RIRVAIPLDYETVDR---------YDF----DLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNY--FFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEET---TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPP-------------------TFSKPA---YFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGS-------SQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDI 771          

HSP 12 Score: 105.916 bits (263), Expect = 2.537e-22
Identity = 135/532 (25.38%), Postives = 224/532 (42.11%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVID--------LEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSK----TIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN-----YFQINN-DGELHLIQKLDFEKHQSFSFTIQATD-GEFV---AESKLKITVLDVNDEPPSYILNPEK------LVIDETNKSGILVGQITVFDRDSVSINRGIKC-----TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP--------------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF----------SVDSG-LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD 1641
            F+I+P +GDI  L  +D        L AL  ++  D  S         NR++  +   ++VI +LD++D +P+F KP+F+  + E       VI +  A D+D    N ++ Y + G    AF+++  +      R L     +  +++  T+ A    +  +     + ++V+++ND  P F +    TI    + E+I L   + +V A D D G N  +RY  L  T      YF I+   G +   Q+LD EK   +S  + A+D G+ V       L++ + D++D  P ++  P+       L + E +  G LVG +T     +V  + G             E +   L+ D          +L  +  LDRET        +FI   S  +         P              + + DIND  P F  ++Y  GV  +  +G +L Q  A D DIG N+L+ Y I            S D G +F + S  G L+            +++ IVA D A H+
Sbjct: 2447 FAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVAS---------NRRENSV---QVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITM-LATDQD-EGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPL-----QSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILH--IKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVT----GAVDADEGPNAIVYYFIAAGDEDKNFHLQPDG---------RLLVLRDLDRET----EATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARDLAGHN 2940          

HSP 13 Score: 98.9821 bits (245), Expect = 3.052e-20
Identity = 180/750 (24.00%), Postives = 298/750 (39.73%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDL--EALCFNS---CADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKD----------ISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNI---NDCAPEFSKTIYEESVYEDISLDEIIIKVN----AVDADGDN---LRYILLPM-TNYFQINNDGELHLIQKLDFEKHQSFS-----FTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-------VSINRGIKCTETNHE-TQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV-----------DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV----HDRKSGSTQLTITVLDDNDNAPELRE----YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            F I P  G +   K ++L  E + F +   CA                  L S M + I +LDI+DN P        + I E     + V ++ A+ D D          I+  N+E A+ ++       +               +D E+  +YR T+S     +    A  +  L +V++   ND  P F++  Y+  V E+      +  +N    A+DAD D    + Y LL   ++ F I+N   +  ++       ++FS       + A D G+    + L IT+LD ND  P++      + + E    G  V Q+T  D DS         I  G +     H  T  +R+    +  +    Y+L TV + DR T+P                  L     + + + DIND+ P F +    V V E+ + G  +    A D D+  N  + Y+I   V               F ++  TG + +  PL+RE    Y +T+  ID A     H     + +LT+ +LD NDN P+ +     Y    +LE    G  +  + A D D+G N  I + L +D     Y  L  +  G + +N+  D E+   +   ++ SD+       + + V + I+D NDN P IF    D+ +   ++F +                   VG VI  V ATD D  N + + Y L +   +      F I+  +G I++   L R+
Sbjct: 1791 FVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGV-----------PPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLAS-DADSGCNALLTFNITAGNRERAFFINATTGIVTVNRP------------LDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGNATIDREEQESYRL-TVVATDRGTVP------------------LSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTL-LDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNG-SPPRAAEIPVYLEIVDINDNNP-IF----DQPSYQEAVFEDI-----------------AVGTVILRVTATDADSGNFALIEYSLVDGEGK------FAINPNTGDISVLSSLDRE 2465          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 1.671e-58
Identity = 212/778 (27.25%), Postives = 352/778 (45.24%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQI-----NNDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGI--------LVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDH---LYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            + + E QP  T +G +       D    Y   +      +D K+GDI T +  ID E L  C N     +   +   V++    Q     +++  I + DI+DN P F  P  T+ I E  +  ++   +P A D+D +  N   +Y +     A  L      E+   + P+L ++ ++D E+   Y  T+          +++  + + V++ ND AP+F +  YE  + E+  +   +I+V A D+D G N  + Y         +       N G + +   +D E   +  F++ A D       A +++ +TV D+ND  P+  +    LV  +   + I         V  + V DRD    N  + C         LR +  +  +D    Y L T   LD E + D  I    +  DSG      TN S+ + V D+NDNAP+F  S  +V   ENN  G  + +  A+D D G NA + Y+++      GLF I   TG +++   LDRE++  Y L +VA D+     + G+  + + VLD NDN P+  L  Y +FS++EN+P    +G +   D D+GENA++   +  D+   + Q    N TG++ S+  FDRE++S    Q++  D  +    +++V V +N+LDENDN P I                   T  SN  + + ++ + ++G  ++ V A D D    ++L Y +       L    F I   SG IT+ + + R   GL ++ V V D G P
Sbjct:   62 YKVPEEQPPNTLIGSLAADYGFPDVGHLYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQLP-GDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSL-FPIPLASDRD-AGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDE-GENAAVTCVVAGDVPFQLR-QASETGSDSKKKYFLQTTTPLDYEKVKDYTI--EIVAVDSGNPPLSSTN-SLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQ-GTATVLVNVLDCNDNDPKFMLSGY-NFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQ----NGTGTILSSLSFDREQQSTYTFQLKAVDGGV-PPRSAYVGVTINVLDENDNAPYI-------------------TAPSNTSHKL-LTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPYGL----FQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKP 800          

HSP 2 Score: 137.887 bits (346), Expect = 1.420e-31
Identity = 144/493 (29.21%), Postives = 221/493 (44.83%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-----LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQ------LYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS--VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELR-----EYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P++      L I E    G L       DRD+     G+   E     +A     L++ +DQ      LI     + +LDRE          +  YD  IK Q        ++  + + V D NDNAP F    Y+  + EN+ IG+ + Q +A D D G NA I Y    +  V   L  +D  TG + +  P+DRE  +    +++A D+  +  KS   Q+ +TV D NDNAP  E+R      + D   +I E++     +  +   D+DEGENA +   ++ D  +Q    ++TGS       L +    D EK      +I   DS  GN  L+S  S+ V ++D NDN P               +F  + TE       V      K G VIA + A+D D  + ++L Y LE    E   + +F I  ++G+I +   L R+     ++KV+  D G PSL+   T++V +LD
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGP--NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLI----VMGNLDRE---------RWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNP-KSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS--GNPPLSSTNSLKVQVVDVNDNAP---------------VFTQSVTE-------VAFPENNKPGEVIAEITASDADSGSNAELVYSLE---PEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLD 604          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q2PZL6|FAT4_MOUSE (Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2)

HSP 1 Score: 206.838 bits (525), Expect = 1.743e-52
Identity = 231/827 (27.93%), Postives = 361/827 (43.65%), Query Frame = 1
Query:   64 LFQILYVYSIF--------FNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLI-----------------DIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPS-----YILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKC-TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKR----QLYTNI-SIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWL--KLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR--EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSM----DHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVS-VCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            L Q+L V+ +           A +  Q F + E QP  T VG I         LS S  L    F+I+  +G ++T   ID E+L         S  ++L V ++   T  +  ++ +++ D++DN P F  P   +  KE       VI L  A D DI             DH ++ +   N  G R RL I                  +D E   QY+  +    K +      + V + V +IND  P F  + Y+  V ED  +   +++V A DAD G N  +RY L      FQ++ + G + + + LDFE  + +S T+QATD         ++  I +LDVND  P      +        +DE  + G +V  +TV D DS + N  I       +E +   +++ ++    L + K+ +  +LDRE IP   + T  +  +SG       Q  +++ S+ + V+DIND+ P+F    Y+V + E    G  +    ATD D G NA + Y+I      G F I   +G +       LDRE  +Q +L I A DQ VH + S   QL +TVLD ND  P     E  + S++EN P G  +  L A D+D G+N  + F L        L++   V  +G L +    DRE+++  C  I  +D  +G+   S  + V V++LD NDN P  +                       V Y   +   E  G  +  V ATD D+     + Y +  SA +   +S F I  KSG I+    L R+     +++V+  D G+    +   + V +LD
Sbjct:   21 LCQLLRVWGLLSLLPGSARVQAAEQRQVFQVMEEQPPGTLVGTIPTRPGFTYRLSESHAL----FAINSSTGALYTTATIDRESL--------PSDVVNLVV-LSSSPTYPT--EVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVI-LDTATDSDIGSNGV--------DHHSYRIVSGNEAG-RFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPN--LSLIKVAS--ALDRERIPSYNL-TVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVS-YAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPV--SGRLSTASSLDREEQAFYCLSILATD--LGSPPQSSTAQVNVSLLDINDNSPVFY----------------------PVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSI--SAGD---RSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLD 785          

HSP 2 Score: 171.4 bits (433), Expect = 1.556e-41
Identity = 173/621 (27.86%), Postives = 281/621 (45.25%), Query Frame = 1
Query:  208 SFGLIT---DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHS--AFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMTNY--FQINNDGELHLIQKLDFEKHQSFSFTIQATD------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENL-PIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYP 2013
            ++ LI+   D F IDP+SGD+   K +D E         +   ++ +  +   Q    S M+I I I D++D+ P F +P ++ +I E     ++V  +  A D D S  N EI+Y +  D     F L   N       L   +DYE Q+ Y  T+ A  ++    S  +     ++++ND  P FS + Y  S+ E++ L   ++  N  DAD      L Y +    +   F ++  G L  ++ LD E    ++  IQ  D        F + +++ I +LDVND PP + L+P+   I E      +V +    D DS   N  I+ T  N       +          +  +++    LDRE + +  +    +  D G +  L ++  + + V DINDN P+F  + Y+V +KEN   G  + Q  A D D G N  + Y I        F IDS TG + + + LDRE    Y LT+ A D+    R    T + IT+LD ND  P  EL  Y+  ++ ENL  +   I  ++A D D+G N+++ + L   +      +  +G L   Q  DRE +      +  +D+     LT   ++ + + D NDN P
Sbjct: 1776 TYALISGADDSFRIDPESGDLIATKRLDRE--------HRSKYSLLVRADDGLQS---SDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAI-LATDDD-SGVNGEISYVVEEDDGDGVFFL---NLVTGVFNLTRALDYETQQYYILTVRA--EDGGGQSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMF-LSPKLTYIPENTPIDTVVFKAQATDPDS-GPNSYIEYTLLNPSGNKFSIGT--------IDGEVHLTGELDREEVSNYSL--TVVATDKG-QPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCT-VAITLLDMNDFVPVFELSPYS-VNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVVTAADAG-SPALTGTGTINIIVDDINDNVP 2362          

HSP 3 Score: 171.4 bits (433), Expect = 1.723e-41
Identity = 196/812 (24.14%), Postives = 359/812 (44.21%), Query Frame = 1
Query:   85 YSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQ---IDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL-----EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVD--------------ADGDNLRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-----VSIN------RGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTS---HVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDND-VNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +S  F+A+       + EN P+   V R+  + +   I+    YS    +  F+I+P +GDI   + ++ E          ++    + V+ +     +S   + I + DI+DN P F +P + ++  E+    + V  + +A D D    N ++ Y +      F +     E  N +  + + +         ++ F ++A  + + S+ +   VT+  V+ ND  P+F +  Y   V +++ +   +IKV AVD              +DG++L          F+++ND G + +   L  + +Q+F   + A D       +++ + ITV + N   P +  N     I E++  G +V  ++  DRD+     +S N       GI     N  T  + L K        L Y++ + H +       G +     C             S+ ++V D+NDN+P+F   ++   V EN   G  +    ATD D G NA+I Y +Q S DS LFVID   G +     LD E K  Y LT+ A +    ++ S +T + I +   N+  P  + +   F + E    G  +G + A D+D G +  + + +  +   +   +NK TG ++ + + DREK+ +V  ++   +   GN+  +    V+V + +LD ND  P +F                     S   Y V++S    +G  +  V A D+D + + S+ SY++  S +EN     F I+ ++G+IT+   L R+ + +  + V+  DSG PS   + +++V + DI
Sbjct: 2775 FSQIFSAY-------VSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNRE----------DTDRYRIRVSAHDSGWTVST-DVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQV-SATDPD-EGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHL--------GKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAI--NSSTGVVTLAK-------ALDYEMSSKHEMTISATDGGWVARTGYC-------------SLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQ-SSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFAT-VDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKN--FGNIRGADIDEVTVNITVLDAND--PPVF---------------------SLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFI-GSGNEN---GAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDI 3505          

HSP 4 Score: 165.622 bits (418), Expect = 1.080e-39
Identity = 184/730 (25.21%), Postives = 323/730 (44.25%), Query Frame = 1
Query:  118 QKFTIEENQPIKTFVGRIKFAKQIDEELSY--SFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNL--RYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS---LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDE-DIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKIT 2271
            Q F   ENQP+ T V  I  +    E LSY  + G + D F IDP +G +   + +D E +        +   + +           S  K+ I +LDI+DN P FE+  F  EI E +  + ++    +A DKD S  N ++ Y +   +   +   +++ G  +R +  +D EK   Y  T+ +  K   S S ++ V + +++ ND AP FS+ I+   V E+  L   + +V   D D G N   RY ++  +  F IN N G++ + + L+ E    +   + A D  +   + + I V D+ND  P +      L   E  + G  V Q++  D D  S  +     ++  E   +     ++    +L Y+  +  S   ++R +     I T     D G    L +  ++ +N  D NDN P F  ++Y   V +N  +G +L +  A D+ D G N+ + Y +      G F +D+ TGW+ +   L  +    +++ + A D+  +   S    + ITV ++N + PE  + +   +I E+  IG  + T+ A D+D   N  I + +   +      +N  TG +   +  D E  SK    I  +D       T + S+ V+++D NDN P +F+ ++   T++ +  + T   H N                     ATD D    + ++Y +++S S+     +F ID   G IT
Sbjct: 2574 QTFMFPENQPVGTLVTTITGSSLRGETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKI--------QKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTV--SATDKD-SGPNGQLDYEIVNGNQESSFTINHATG-EIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRFSQ-IFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHS----FIVT---ASDRG-NPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKG-NPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGW-VARTGYCSLTVSVIDVNDNSP-VFVPDEFFPTVMENAPSGTTVIHLN---------------------ATDADSGANAVIAYTVQSSDSD-----LFVIDPNMGVIT 3253          

HSP 5 Score: 154.066 bits (388), Expect = 4.002e-36
Identity = 181/716 (25.28%), Postives = 306/716 (42.74%), Query Frame = 1
Query:  313 DKESAT-ISLNVNVNRQKT--LISVMKIVIIILDIDDNKPEFEKPE-FTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRY-ILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQK------VKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            D+E A+ I LN++   Q     +S  ++V+ +LD++D KP F +PE + + + E       ++ L  A D+D+   N  + + +     D   F L+  + R   L     +D E+Q  Y  ++ A        S+   V + +++IND +P F    Y   + E+      +  V+A D D G N  ++Y I     + FQI+   G +     LD E+  ++   + ATDG   +   ++ + +TVLD  D PP +       V+ E    G  VG ++    D   +N  I    T  + + +            +  +L T   +DRE           +     +      NI+    V D+NDNAP F  +   +   EN   G+ +FQA+A D D G N  + Y+++ +  + LF I+ + G + L+  LD      Y + IVA D  V  + S S  LT+ V D NDN P   + + + ++ E+ P+      + A DKD G N  I + ++  +      +   G L+     DRE + +    +  SD A+   L++ V+V V + D NDN P               LFN+T       +Y       ++ G  +  V A D D     ++ Y  E      + Q  F++   +G+IT      R+ +  ++        V   D G P  LK   T+ V + DI
Sbjct:  541 DRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVL-GATDRDLG-DNGTVRFSLQEAENDQRLFRLDPVSGR---LSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMD---LNANISYLITTGDQRGMFAMNP-------VTGQLTTASVIDREE--QSFYQLKIVASGGAVTGDTVVNIT----VKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKN-LFTINEQNGNISLLGALDVH-AGSYQVEIVASDMGV-PQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAV-EPLSATVNVTVLLEDVNDNRP---------------LFNST-------NYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFE------VTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDI 1203          

HSP 6 Score: 149.443 bits (376), Expect = 1.050e-34
Identity = 198/763 (25.95%), Postives = 331/763 (43.38%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMS----GDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINN-DGELHLIQKLDFEK------HQSFSFTIQATDGEFVAESKLKITV----LDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVS---INRGIKCTETNHETQALRLEKDQMSTDILLIYKL----YTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKL----------SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNIL--DENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAK--TIMVEILDIP 2394
            ++F+I+ ++G+I  L  +D+ A  +      +   ++ ++ V +   L S + + + + D++DN P F++  + + + E     N   +   A DKD S  N EIAY ++    GD  AF +        +L +  ++D E Q +Y   + A  +  E +SA +NVT+ + ++ND  P F+ T Y     E+      + KV+AVD D G N  +RY        F+++   GE+    K D E          FSFT+ A D       K + TV     D+ND  P ++ +  +  + ET  +   V +++  D D  S   I+  I   + N E Q      D  S  + L+ KL     + +SL  + +  G I  N  C             ++ +++ D NDN P FP S   V V EN  IG  +    ATD D G NA + Y I  S + G F I   TG + L + LD E ++ Y L I A DQ    R S +  + I V D NDN P       F SI+EN+P+G  + ++ A D D   N ++ + +          S+D +         G+++++   DRE  +     ++ +D A+      +    V IL  D NDN P +F+ +                        +       +G V+  + A D D     ++ Y + N  ++      F +D+ SG + +   L    + +  + V   D G    KS    T++++ LD P
Sbjct:  938 NLFTINEQNGNISLLGALDVHAGSY------QVEIVASDMGVPQ---LSSSILLTVYVHDVNDNPPVFDQISYEVTLSES-EPVNSRFFKVQASDKD-SGANGEIAYTITDGNNGD--AFGIFPDG----QLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSI--LKGNEERQ---FAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTC-------------TLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSS-TMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEV--------KGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVP-MFISQN----------------------ALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDT-----FTVDRYSGDLRVASALVPSQL-IYNLIVSATDLGPERRKSTTELTVILQGLDGP 1627          

HSP 7 Score: 147.132 bits (370), Expect = 4.711e-34
Identity = 183/684 (26.75%), Postives = 296/684 (43.27%), Query Frame = 1
Query:  397 ILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDH-SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY---QKNDESMSANMNVTLQVVNINDCAPEF--SKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILL-PMTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVS---INRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKEN-NDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKV--KVMVEDSGHPSLKSAKTIMVE 2379
            ILD++DN P F    ++  + E +   + V+      D D  + N +++Y + SGD    F +++H      L+ L  +D E Q  Y   +  +   Q      ++   V++ ++++ND  P F   K  Y   + E+  +D ++ K  A D D G N  + Y LL P  N F I   DGE+HL  +LD E+  ++S T+ ATD       + +++ + VLD+ND  P +     ++ I E   +G  + Q++  D D  +   +  GI    T+ E    R++         +   +    SLDRET P    YT  +            + ++ + + D+ND  P+F  S Y V V EN   +   + Q  A D+D G N+ ++Y +    +   FV+ + +G L++ Q LDRE ++ ++L + A D A     +G+  + I V D NDN P         SI E+   G  +  L+    D    A  +   S+       T+N  TG + ++ + DRE K      +  SD+     L+S  SV V I D NDN P+                   +  H    YV  +      G  +  V  TD D+ + S+L Y L    SE      F ID   G I    PL     G  +V   V V+D G      + T+ V 
Sbjct: 1934 ILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVF-NVTDADDGV-NSQLSYSIASGDSLGQFAVDKHGV----LKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTY---IPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNKFSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQE---FRIDS--------VTGAITVAKSLDRETTP---AYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVL-TASGELRVTQSLDREARDHFVLVVTAAD-AGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDV--LLVNASDADAAANAVISYSIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPR-------------------FQHHP---YVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEK-----FHIDPLRGAIMAAGPLS----GASEVTFSVHVKDGGSFPKTDSTTVTVR 2559          

HSP 8 Score: 139.813 bits (351), Expect = 7.745e-32
Identity = 198/760 (26.05%), Postives = 338/760 (44.47%), Query Frame = 1
Query:  187 IDEELSYSF--GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVN-----RQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNY--FQINN-DGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIY-KLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFS-ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNT--YTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVE--DSGHPSLKSAKTIMVEILDI 2391
            ++ +LSYS   G     F++D K G + TLK +D E+  F           +L + V+           S  ++ II+LD++DN P F  P+ T  I E     + V++   A D D S  N  I Y +   SG+  +    +       + L  ++D E+   Y  T+ A  K    +S++  V + V++IND  P F++ +Y   + E+I     II+V+A D D G N  +RY ++    +  F+I++  G + + + LD E   +++ T+QATD           + IT+LD+ND  P + L+P  + + E N   +    + V  RD    ++G      N +   + L  ++ +  +L    +L    SLDRE     ++       D+G    L    +I + V DINDN P F ++ Y   + E+   G  +    A+D D   NA+I+Y+I     +  F I+  TG +     LDRE K+ Y L +VA D    +  S ST + +T+ D NDN P  + +   + I    P G ++  +   D D G N+ + + LS  +              S +      +  +     LS +       S V+  V++ D          + K ++T +   F N   + +    +        + VG ++  +  +         LSYY+   AS NL  + F ID  +G+++I++PL  D   +QK  V +E  D G P   S + + + +LDI
Sbjct: 1975 VNSQLSYSIASGDSLGQFAVD-KHGVLKTLKALDRESQSF----------YNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTY-IPENTP-IDTVVFKAQATDPD-SGPNSYIEYTLLNPSGNKFSIGTIDG-----EVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPE-NLGTLPRAILQVVARDD---DQG-----PNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVVT--AADAG-SPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGG--NSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRN--------------SEKFHIDPLRGAIMAAGPLSGA-------SEVTFSVHVKDGGS-------FPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQPVGTLVTTITGSS---LRGETLSYYI---ASGNLGDT-FQIDPLTGQVSISQPL--DFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDI 2664          

HSP 9 Score: 139.428 bits (350), Expect = 1.069e-31
Identity = 201/799 (25.16%), Postives = 337/799 (42.18%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFA---KQIDEELSYSFGLITDI-----FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMK-----IVIIILDIDDNKPEF-EKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYR-MSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN--LRYILLPM-------TNYFQINN-----------DGE----LHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL-SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSD--SAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +I EN P+ T V  +        I+ +LSY+  +I  +     FSID   G I+T   ID E           +    L V  N Q   I   +     + I++ D++DN P F  +     +   +I     V+    A D D    N E+ Y  ++GD   F ++ ++     LR+   +    Q  Y   +SA     E   +   +T+ +  ++   P F++T Y   + E   +   +I + A    G    + Y ++ +          F I             D E    L+L+     EK  +F  T +A         +++IT+ D+ND PP +  +   L ++E    G  + Q+T  D D    N  +     +    + R+  D  S D++   +      LDRE       Y+  +  D G++    +++ I + + D+ND+ P F    Y   + E+   G  +    ATD+D G N  I+Y ++     G+F ++  TG   L + LD E +  Y+LT+ A D      +S + +    +LD NDN P   +  Y+  S++ENLP+G  +      D D+G N+++ + + S D L Q   V+K G L + +  DRE +S     IQ+ D      +  TS   V + +LD NDN P +FL  K   T I         E++ +D VV  +            +ATD D    S + Y L N +        F I    G++ +   L R+ +    + V+  D G P L S+  ++V +LDI
Sbjct: 1428 SIVENIPLGTSVISVTAHDPDADINGQLSYA--IIQQMPRGNHFSIDEVKGTIYTSAEIDREF----------ANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMI---GSVLTTIMAADPD-EGANGEVEYEILNGDTDTFTVDRYSGD---LRVASAL-VPSQLIYNLIVSATDLGPERRKSTTELTVILQGLD--GPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRA---------EVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADE-GANALVTYALISGADDSFRI--DPESGDLIATKR------LDREHRSK---YSLLVRADDGLQS---SDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGG---GQSTTIRAYFNILDVNDNPPVFSMSSYST-SLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQ-FAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDN-PPMFLSPK--LTYI--------PENTPIDTVVFKA------------QATDPDSGPNSYIEYTLLNPSGNK-----FSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDI 2147          

HSP 10 Score: 128.642 bits (322), Expect = 2.086e-28
Identity = 146/566 (25.80%), Postives = 251/566 (44.35%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPM----TNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQA---TDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRET---IPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDED-IGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIM--FKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ 2016
            L S   + I + + + + PEF +   +  I E  H    V+   +A D+D +M N  I+Y + SG+    F +   NS    + L   +DYE   ++  T+SA      + +   ++T+ V+++ND +P F    +  +V E+      +I +NA DAD      I   +    ++ F I+ N G +     LDFE  QS+  T++A    D E  + + + I +   N+  P ++       + E    G  VG++   DRD  +          N   +  ++ K        +  ++Y    LDRE    +   ++  NF      I+      +++ + V D ND  P+F  S Y+V + E   IG  +    A D D I   +  +Y I    ++G F I+ +TG + +   LDRE    Y LT++A+D       +GS  L +T+ D NDN P L   ++  +LEN   G  + TL + D D   N      + LS        +++  G L + +  DRE+ +     +   DS     ++S  +V + +LD+NDN  Q
Sbjct: 3071 LSSQAVVHITVTEENYHTPEFSQNHISATIPES-HSIGSVVRTVSARDRDTAM-NGLISYNIISGNEEGIFAI---NSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINK--------MTGQIYVSGLLDREKEERVSLKVLAKNF----GNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGT-PSATGSASLVVTLEDINDNGPVL-TVSEGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDSGAPQ-MSSTGTVHITVLDQNDNPSQ 3615          

HSP 11 Score: 124.79 bits (312), Expect = 3.072e-27
Identity = 156/579 (26.94%), Postives = 255/579 (44.04%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDEELS--YSFGLITD----IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLID---IDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVD----ADGDNLRYILLPMTNY--FQINN-DGELHLIQKLDFEKHQSFSFTIQATD-----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSV-SINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKN-ALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKD 1788
            TI E+  I + V R   A+  D  ++   S+ +I+     IF+I+  +G +   K +D E       + K   TIS        +T      + + ++D++DN P F   EF   + E       VI+L  A D D S  N  IAY + S D   F ++      P + ++     +D+E ++ Y  T+ A+   DE   +   V +Q+   N+  P F   +Y   V E  S    + +V A D    ADG+ + Y++   +    FQIN   G++++   LD EK +  S  + A +     G  + E  + ITVLD ND PP + L+  ++ I E    G  V  ++ FD DS+ S +R      + +E  A  +             ++     LDRE++P  +     +  DSG       + S+ + + DINDN P+   S+ +V   EN   G  +   Q+TD D+  N     Y +  +  +  +   S  G L   + +DRE+   + L++V  D       S  T + ITVLD NDN  + R    F +   NL  G  +G++   D D
Sbjct: 3099 TIPESHSIGSVV-RTVSARDRDTAMNGLISYNIISGNEEGIFAINSSTGVVTLAKALDYEM------SSKHEMTISATDGGWVART--GYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHL-NATDAD-SGANAVIAYTVQSSDSDLFVID------PNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGE-VHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTG--------QITVTSGLDRESLP--VYNLTVLAVDSGTPSAT-GSASLVVTLEDINDNGPVLTVSEGEV--LENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTGT-VHITVLDQNDNPSQSRTVEIFVNYYGNLFPGGTLGSVKPQDPD 3644          

HSP 12 Score: 123.25 bits (308), Expect = 8.993e-27
Identity = 166/715 (23.22%), Postives = 306/715 (42.80%), Query Frame = 1
Query:  340 NVNVNRQK-----------TLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMS-GDH-SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMT--NYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAES---KLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQ--MSTDILLIYKLYTVHSLDRET--IPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPELREYTDF--SILENLPIGHYIGTLIAFDKDEGEN-ARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVN-NVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            NVN+NR             +L+S   + I  +D +DN P+F + ++   + + +     +I + A  DKD  + N E+ Y +S G+H   F L+  N  G  + +   +  +  + +   ++A  K +  +S+   V + V   N   PEFS+     ++ E  S+  ++  V+A D D      + Y ++       F IN+  G + L + LD+E       TI ATDG +VA +    L ++V+DVND  P ++ +     + E   SG  V  +   D DS   N  I  T  + ++    ++ +   ++T   L ++    + L  +   +PD                +  +  ++ + +   N+  P F S  Y   V E    G  + +  A+D D+G +  + Y I  +     F I+  TG + +   LDREK+ +  L ++A +   +         + ITVLD ND  P +   + +   I E +PIG ++  + AFD D   + +R  + +   +     ++N +TG +      DRE        +   DS   +  T   S+ V + D NDN P + + E +       +  N                 ++ G ++  +++TD D+  N    +YYL ++       S+      +G ++  R + R+ I    + V+  DSG P + S  T+ + +LD
Sbjct: 2945 NVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGL-NSEVEYFVSDGNHLGKFKLD--NDTG-WISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADS-GANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPD---------------EEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND--PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSA-TGSASLVVTLEDINDNGPVLTVSEGE-------VLEN-----------------KRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSL----STAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTGTVHITVLD 3608          

HSP 13 Score: 111.309 bits (277), Expect = 3.803e-23
Identity = 175/737 (23.74%), Postives = 286/737 (38.81%), Query Frame = 1
Query:  250 SGDIHTLKVIDLEA----LCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQ-VVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPM-TNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEP-PSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDI---LLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKR-QLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPL-HRDLIGLQKVK-------VMVEDSGHPSLKSAKTIMVEILD 2388
            SG++   + +D EA    +   + AD  S  ++    +N            II+ DI+DN P F    +   I E       V+ +        +  N  I+Y + G +S F +     +     LL   D E +  Y   + A         ++    L  + ++ND  P F    Y   +         +  V   DAD G N  L Y L    +  F I+   G +     L      +FS  ++   G F       +TV   N    P      +  +  E    G LV  IT       S  RG        ET +  +    +        L  ++     LD E I   +++      D G      Y  + I   V DINDNAP F    +   + EN     ++    ATD+D G N  + Y I        F I+  TG ++ ++PLDREK + Y LT+ + D+     +S S ++ I++LD+NDNAP   +     + EN P+G+ +  +   D+D G NA  + + S+     P T+N  TG +  ++  +RE   +   ++   DS      T    V + + D NDN P+                       S   Y +      ++G  +  V ATD D  +  Q+ Y++++      Q   F I+  +G+I   + L ++++ G   V        V   D G+PSL S  T+ +  +D
Sbjct: 2313 SGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTIN------------IIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLV--NASDADAAANAVISYSIIGGNSQFTINPSTGQIITSALL---DRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHVK-DGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQPVGTLVTTITG------SSLRG--------ETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYVVWIE--ARDGGFPPFSSYEKLDI--TVLDINDNAPTFEEDPFVSEILENLSP-RKILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKG-SPSQSTSVKVIISILDENDNAPRFSQIFSAYVSENSPLGYTVTRVTTSDEDIGINA--ISRYSIVDTSLPFTINPNTGDIVISRPLNREDTDRYRIRVSAHDSG----WTVSTDVTIFVTDINDNTPRF----------------------SRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKS------QSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVD 2977          

HSP 14 Score: 105.531 bits (262), Expect = 2.706e-21
Identity = 141/537 (26.26%), Postives = 223/537 (41.53%), Query Frame = 1
Query:  880 FQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSG--ILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSG-IKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGL-FVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTD----FSILENLPIGHYIGTLIAFDKDE------------GENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHV-------SVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRP--LHRDLIGLQKVKVMVEDSG-HPSLKSAKTIMVEILDI 2391
            F IN+  G L+    +D E   S    +          +++++ V D+ND  P +      +   E + SG  +++   T  D  S  ++       + +E    RL+     +       L +   LDRE  P   +       D G  KR+ Y  +++   V DINDN P+F SS YQ GV E+  +G  + Q  A D D G NA I Y +Q   D G  F +D  TG + + +PLD E + QY LT+ A D+ V    +G  +  I +LD NDN P  + R +       S+ EN  +G  +  L   D D             G N +  F++    +   L++ K  S       DRE+       + +SD++ G   T+ V       S+ + + D ND +P +F  +                      Y V +S     G  ++ V ATD D    S L+  L  S         F I + SG +T +    L R+L     + +   D G HP +  A+ ++V +LD+
Sbjct:   81 FAINSSTGALYTTATIDRESLPSDVVNLVVLSSSPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHHSYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEV--EDKGEPKRRGYLQVNV--TVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQ---DEGTPFQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSL-TGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPN-LSLIKVAS-----ALDRERIPSYNLTVSVSDNS-GAPPTAEVQARSSVASLVIFVNDIND-HPPVFEQQV---------------------YRVNLSEEVPPGSYVSGVSATDGD----SGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQ-LVVTVLDV 575          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|O35161|CELR1_MOUSE (Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3)

HSP 1 Score: 206.838 bits (525), Expect = 1.745e-52
Identity = 204/755 (27.02%), Postives = 346/755 (45.83%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQK----TLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESM-SANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNY-------------------FQI-NNDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIM--FKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL-ENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +F ID +SG + T  V+D E          E+A   L V  N Q      L +   + I++ D +DN P+F +  + +++ E +     V+ +  A D+D   +N  I Y +   +       H+  G  L ++  +D+E  ++Y   + A       + +++  V++QV+++ND AP F  + ++ +V E++ L   ++ + AVDAD G+N  L+Y L+   +                    FQI N+ G + +  +LD E+ + +SF ++A D       + + + ITVLDVND  P +     +L ++E    G  V  +   DRD+ S+   I    T   T+  R      S   L+   L   +  +R+       Y   +    G +        + +NV D N + P+F SS Y V V E+  +G  +    ATDED G+NA ITY ++  V    F ID  TG +  M  LD E +  Y L I A D  +  +KS +T L I +LD NDNAP  LR++   S+ E+ P    +  + A D+D G N R++  F+   D          +G + + +  DRE  +         D    N L++ V + V++LD NDN P   ++EKDE  L        + E ++            VG V+A ++A D D    +Q+ Y + E +  E  Q  +   D ++  + ++  + RD +      ++V+ +  P L S  T+ + +LD
Sbjct:  414 VFEIDARSGVVRTRAVVDRE----------EAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRV-QATDRD-QGQNAAIHYSIVSGNLKGQFYLHSLSG-SLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDANSV---ITYQLTGGNTRN-RFALSSQSGGGLITLALPLDYKQERQ-------YVLAVTASDGTRSH---TAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARITYVLEDPVPQ--FRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGI-PQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPP---VFEKDELEL--------FVEENS-----------PVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRA-LVELDFEVRRDYM------LVVQATSAP-LVSRATVHIRLLD 1108          

HSP 2 Score: 184.882 bits (468), Expect = 9.544e-46
Identity = 187/750 (24.93%), Postives = 338/750 (45.07%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVII-ILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA-----------------FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINND---GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGL-FVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPL--HRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEIL 2385
            F +   SG +  +  +D EA+           T+ +      +  LI+   +V + +LD++DN P F    F   + E +   + V+++  AVD D + +N  + YR+    S                  F  + HNS G  + +  ++D E+ + Y F + A      +MS++ +V++ V+++ND  P F++ +YE  + ED ++   ++ + A D D +++  I   +T     N F +++    G + L   LD+++ + +   + A+DG     +++ I V D N   P +  +   + + E    G  +  I+  D D+    R     E        R++ D  +        +YT+  LD E   D   YT  I   D+GI ++  T  S+ + + D NDNAP F    YQ  V E+      + Q  ATD D G N  + Y  Q   D    F I+  +G ++  + LDRE    Y L  +A+D+   +  S S  + ++VLD NDN P   ++  +  + EN P+G  +  + A D DEG NA+IM+++   ++ +   ++  +G L +    D E +      +Q + +     L S  +V + +LD+NDN P++  ++         LFNN  T  SN               VI  + A D D+++    ++   N      + S+  +D  +G++ ++R L  +R L  L +V V     G  S+ +  T+ V I+
Sbjct:  522 FYLHSLSGSLDVINPLDFEAI--------REYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHI-QAVDAD-AGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSG-WITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRDANSV--ITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDGTRSHTAQVFINVTDANTHRPVFQSSHYTVSVSEDRPVGTSIATISATDEDTGENARITYVLED--PVPQFRIDPDTGT--------IYTMTELDYE---DQAAYTLAITAQDNGIPQKSDTT-SLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYMLVVQATSAP----LVSRATVHIRLLDQNDNPPELPDFQ--------ILFNNYVTNKSN----------SFPSGVIGRIPAHDPDLSDSLNYTFLQGN------ELSLLLLDPATGELQLSRDLDNNRPLEALMEVSV---SDGIHSVTALCTLRVTII 1213          

HSP 3 Score: 181.8 bits (460), Expect = 9.061e-45
Identity = 209/813 (25.71%), Postives = 351/813 (43.17%), Query Frame = 1
Query:  121 KFTIEENQPIKTFV-------------GRIKFAKQ--IDEELSYSF------GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYR-MSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQ--KNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKL-KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSIN----RGIKCTETNHETQALRLEKDQMSTDI-LLIYK----LYTVHSLDRETIPDGIIYTNFICYDSGIKR------QLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRT--GWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR--EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIF--LYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKT-IMVEILDI 2391
            + ++ EN+P  T V             GR+ +  +   DE  +  F      G +T   S+D ++ D H LKV  ++       + + SA   L V V+                D +D+ P FE+ E+   I+E +     V+ +  A D D +  N  + YR + G    F   E ++R   +R    +D E+  +Y+  + A    +N   +SA+  V + V + ND  P+FS+  Y   V ED++++  +++V A D D G N  + Y ++   +   F +++  G L +I  LDFE  + ++  I+A DG     +  S L  + VLDVND  P ++ +P +  + E    G  V  I   D D+        R +    T     ++  E    + D    I+     +     LDRE +           Y  G++        + ++ S+ + V D+NDN P+F    Y++ + E+  +G  +   +A D D   N++ITY +        F + S++  G + L  PLD +++ QY+L + A D      +S + Q+ I V D N + P  +   YT  S+ E+ P+G  I T+ A D+D GENARI + L  D + Q      TG++++    D E ++     I   D+ I    +   S+ + ILD NDN P+     Y+        S+F +     S                 +  V ATD D     +L Y  +           F I+  SG I   R L R+ + +  +  +  D G P+  SA   I V +LDI
Sbjct:  266 QVSVPENEPAGTAVIELRAHDPDEGDAGRLSYQMEALFDERSNGYFLIDAATGAVTTARSLDRETKDTHVLKVSAVD-----HGSPRRSAATYLTVTVS----------------DTNDHSPVFEQSEYRERIRENLEVGYEVLTI-RATDGD-APSNANMRYRLLEGAGGVF---EIDARSGVVRTRAVVDREEAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYVVQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAPIFVSSPFQAAVLENVPLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEH---------YSFGVEAVDHGSPAMSSSASVSITVLDVNDNDPMFTQPVYELRLNEDAAVGSSVLTLRARDRD--ANSVITYQLTGGNTRNRFALSSQSGGGLITLALPLDYKQERQYVLAVTASDGT----RSHTAQVFINVTDANTHRPVFQSSHYT-VSVSEDRPVGTSIATISATDEDTGENARITYVLE-DPVPQFRIDPDTGTIYTMTELDYEDQAAYTLAITAQDNGIPQK-SDTTSLEILILDANDNAPRFLRDFYQ-------GSVFEDAPPSTS-----------------VLQVSATDRDSGPNGRLLYTFQGGDD---GDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDI 1007          

HSP 4 Score: 130.568 bits (327), Expect = 5.802e-29
Identity = 126/474 (26.58%), Postives = 218/474 (45.99%), Query Frame = 1
Query: 1033 PSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI----YKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRK-SGSTQLTITVLDDNDNAPELRE--YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSA----------SENLQQS---IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            P + L   ++ + E   +G  V ++   D D     R       +++ +AL    D+ S    LI      + T  SLDRET    ++  + + + S  +R   T +++   V D ND++P+F  S+Y+  ++EN ++GY++   +ATD D   NA + Y +      G+F ID+R+G ++    +DRE+  +Y L + A DQ  +    S S  + I V D+NDN P+  E  Y    + E++ +   +  + A D+D+G+NA I + +   +L     ++  +GSL      D E   +   +I+  D     ++ S   V V +LD NDN P IF         ++S F     E  NV           +G  +  ++A D D    ++L Y L ++A          SEN   +    F I   SG IT+   L R+ +      V   D G P++ S+ ++ + +LD+
Sbjct:  258 PQFPLPSYQVSVPENEPAGTAVIELRAHDPDEGDAGR------LSYQMEALF---DERSNGYFLIDAATGAVTTARSLDRETKDTHVLKVSAVDHGSP-RRSAATYLTV--TVSDTNDHSPVFEQSEYRERIRENLEVGYEVLTIRATDGDAPSNANMRYRL-LEGAGGVFEIDARSGVVRTRAVVDREEAAEYQLLVEANDQGRNPGPLSASATVHIVVEDENDNYPQFSEKRYV-VQVPEDVAVNTAVLRVQATDRDQGQNAAIHYSIVSGNLKGQFYLHSLSGSLDVINPLDFEAIREYTLRIKAQDGGRPPLINSSGLVSVQVLDVNDNAP-IF---------VSSPFQAAVLE--NV----------PLGHSVLHIQAVDADAGENARLQYRLVDTASTIVGGSSVDSENPASAPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSASVSITVLDV 695          

HSP 5 Score: 84.3445 bits (207), Expect = 6.054e-15
Identity = 88/354 (24.86%), Postives = 161/354 (45.48%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDEE---LSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYR-FTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPS---YILNPEKLVIDETNK--SGILVGQITVFDRD-SVSIN 1140
            ++ E++P+ T +  I    +   E   ++Y        F IDP +G I+T+  +D E        D+ + T+++    N          + I+ILD +DN P F +  +   + E       V+ + +A D+D S  N  + Y   G                +R    +D E    Y  + L+  + +   +SA++ + + V++IND  P F K   E  V E+  +  ++ ++ A D D G N  + Y ++   +   FQ++   G+L  + +LDFE  + +   +QAT    V+ + + I +LD ND PP    + +     V +++N   SG+ +G+I   D D S S+N
Sbjct:  812 SVSEDRPVGTSIATISATDEDTGENARITYVLEDPVPQFRIDPDTGTIYTMTELDYE--------DQAAYTLAITAQDNGIPQKSDTTSLEILILDANDNAPRFLRDFYQGSVFEDAPPSTSVLQV-SATDRD-SGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPNPLSASVGIQVSVLDINDNPPVFEKDELELFVEENSPVGSVVARIRANDPDEGPNAQIMYQIVEGNVPEVFQLDLLSGDLRALVELDFEVRRDYMLVVQATSAPLVSRATVHIRLLDQNDNPPELPDFQILFNNYVTNKSNSFPSGV-IGRIPAHDPDLSDSLN 1154          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|P58365|CAD23_RAT (Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 3.028e-52
Identity = 207/758 (27.31%), Postives = 352/758 (46.44%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATIS---------LNVNVNRQKTLISVMKIV-IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGP---RLRLLIDIDYEKQKQYRFTLSAYQK-NDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAES-KLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS----LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDED----IGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV-HDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREK----KSKVCTQIQLSDSAIGNV---LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            IF++D  SG           AL  N   D+E+   S           +N +R  +  +V     I+++DI+DN PEF   E+++ I E+      +      VDKD  + +    Y +  +   F +   + +G    R+R+ I +DYE   +Y F L A +   D    A + +TL  +N ND  P FS+ +Y  S+YE+I++   ++ V A D D      + Y      + F ++ D G + LI +LD+E  Q F+ T+ A DG     + +++I VLDVND  P++  +     + E   S   + ++   D DS   N  I  +  N        +        + +Y+ Y V S    LD E IP+G+IY   +  D+G    LY+ + + + V D NDN P F    Y V V EN   G  +    ATD D     G+ ++I Y+++    S  F I++R+G +     LDRE K +Y+L + A+D  V H++K+G   + +T+LD NDN P  ++   + +++E  P    + T++A D D G+N  +++ +   + +  L  + TG + +  V  DRE     ++++  +I +S +  G      TS  +V VN+LD NDN P                         N+ +V ++      G  +  V A D D      +SY ++      + +  F I+  SG +T    L R+ I   +++V+  D+G P+  S  T+ + +LD+
Sbjct:  283 IFALDYISG-----------ALTLNGLLDRENPLYSHGFILTVKGTELNDDRSPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITL--INENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPP-NNLITYSIVNASAFGSYFD--------ISVYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAG-NPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESII-YSLE---GSSQFRINARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGKNGTLVYSIQPPNKFYSLN-STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTF----------------------QNLPFVAEVLEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ----VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTIRVLDV 986          

HSP 2 Score: 166.007 bits (419), Expect = 7.652e-40
Identity = 180/703 (25.60%), Postives = 307/703 (43.67%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINR-GIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQY-QVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIA------------FDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE--KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS--IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S   + + +LD++DN P F+   F  E+ E      + +Y   A+D D  + N  ++YRM       +   +++ G  +    ++D E+  +Y+  + A      + S+   +T++V+++ND  P F   +Y  SV ED+  +  ++ +N  D D G N  L Y +    +   F +   D  +  +  LD E   +++  ++A D   V + +     + +TVLDVND  P ++ +  +  + E    G  + Q+   D D     R   +    NH     RL    +S+ +L+         LDRE     ++      +D G  R   +++ + + V D+ND AP+F   QY ++G++E   IG  +   +ATD D G   L+ Y I  S   G F ID  TG +  +  LD E K  Y++ + A D A      G   + +T+L++ D A +    + +  I+ENL +G  I  + A            FD      A+ +FK+             TG +    + DREK       +   D   G  + S V V V +LDENDN P+ F +  D                        +S+ E   VG  +A VKA D D  +  Q+ + L   AS N+  +  I   +   G++ + +PL R+ +    +K++  D G P  K    + V ILD+
Sbjct:  870 SSATVFVNLLDLNDNDPTFQNLPFVAEVLEGTP-AGVSVYQVVAIDLDEGL-NGLVSYRMQVGMPRMDFVINSTSG-VVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTIRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNVPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNN-FRL---HVSSGLLV----RGPRPLDRERNSSHVLMAEAYNHDLGPMR---SSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDRDTGDGGLVNYRI-LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATDGA-PPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDA----------ITGVITVKGLVDREKGDFYTLTVVADDG--GPKVDSTVKVYVTVLDENDNSPR-FDFTSDS----------------------AISVPEDCPVGQRVATVKARDPDAGSNGQVVFSL---ASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKIVASDRGTPPRKKDHILQVTILDV 1518          

HSP 3 Score: 161.77 bits (408), Expect = 1.359e-38
Identity = 189/705 (26.81%), Postives = 325/705 (46.10%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPR---LRLLIDIDYEKQKQYRFTLSAYQ--KNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQI-----NNDGELHL--------IQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNP-EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAV--VKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            S   + I +LD++D  P F    + + + E + R+  V++L    D D+ + N E++Y ++    A N++   S G R   +R ++ +D E    Y   L A       +  +    V + V+++ND  P F ++ YE SV EDI     I+++ A DAD      +      +++I      N+  LH+         + LD E++ S     +A +   G   +  ++ + V DVNDE P +      +L + ET   G  V  +   DRD+   + G+         +  + E D+ ST +++     TV  LD ET    ++  N    D      Q + ++ + L ++++ D A  F ++ Y+  + EN  +G ++ + QA   D        ++   S  +  LF ID+ TG + +   +DREK + Y LT+VA D     +   + ++ +TVLD+NDN+P     +D   S+ E+ P+G  + T+ A D D G N +++F L+  ++   ++ +T N + G +F  +  DRE+      +I  SD         H+ + V ILD NDN P           +I S F               +S+ E VG   +V  V+ATD D+   S LSYY+    +E  +   F +D+ SG+I T   P  R+      + V VED G P+L +   + V I+D
Sbjct:  975 STSTLTIRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWL-NCTDNDVGL-NAELSYFIT----AGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNVPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRV------WYRILHGNHGNNFRLHVSSGLLVRGPRPLDRERNSSHVLMAEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDRDTG--DGGLVNYRILSGAEG-KFEIDE-STGLIV-----TVDYLDYETKTSYLM--NVSATDGAPPFNQGFCSVYVTL-LNEL-DEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGG--PKVDSTVKVYVTVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKIVASDRGTPPRKKDHI-LQVTILDVNDNPP-----------VIESPFG------------YNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYI----TEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVD 1624          

HSP 4 Score: 154.836 bits (390), Expect = 1.933e-36
Identity = 178/697 (25.54%), Postives = 307/697 (44.05%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDI-SLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQINN-DGELHLIQKLDFE-KHQSFSFTIQATD------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL----IYKLYTVHSLDRETIPDGIIYTNFICY-DSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDR--KSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYI----GTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTG--SLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITI-NRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + ILD++DN P  E P  + + + E +     V+ +  A D+DI + N  ++Y ++  +           G         D E+Q  Y   ++   +   ++SA  +V + +V+ ND AP F +  YE  + E   +++  +I V A+D D G N  + Y ++   + N F+IN   G +   ++LD+E  H  ++  + ATD          + + + + V D+ND  P++  + E        + G  V      DRDS            N + +   ++ D +   ++     + ++     LDRETI     Y   IC  D G+   L + + + + V DINDN P+  +    + + EN+ +   +    A+D D G NAL+T+NI        F I++ TG + + +PLDRE+  +Y LT+   D   + R  +     L +++ D+NDN P   E T    ++EN P G  +    G ++A D DE   A + ++L   H    +  N TG  ++ S  + DRE  S    ++ L    +G  L     + + ILD+NDN+P                   T++  +   Y V +      GF +  + ATD D     +L Y +E  A     Q  F I   +G I + N  + R+     ++ V+  D G   L    T+ + I DI
Sbjct: 1513 VTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQV-RATDRDIGI-NSVLSYYITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTVNTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINRRTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFLAHDRDS----------GPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETI---AFYNLTICARDRGVP-PLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGVIIDREAFSPPFLELLLLAEDVGQ-LNGTAYLFITILDDNDNWP-------------------TFSPPA---YTVHLLENCPPGFSVLQITATDEDSGLNGELVYRIEAGA-----QDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTATVTILIDDI 2165          

HSP 5 Score: 154.066 bits (388), Expect = 3.274e-36
Identity = 211/812 (25.99%), Postives = 344/812 (42.36%), Query Frame = 1
Query:  109 DGVQKFTIEENQPIKTFVGRIK---FAKQIDEEL----SYSF-GLITDIFSIDPKSG--DIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMT-------------NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGE--------FVAESKLKITVLDVNDEPPSYILNPEKLV-----IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI--CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQ---AVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDND--VNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            +G  +  + EN P  T +  +     A   DE++    +Y   G  +D+F ID  +G   + +  +ID EA             + L +       L     + I ILD +DN P F  P +T+ + E       V+ +  A D+D  + N E+ YR+ +G    F +  H   G        ID E+Q+ YR T+ A  +    +S    VT+ + +IND  PEF   I   SV E      +I  V A+D D    L Y +L +              + F +N N G + +   L+ E   ++  T+   D           V  +KL + +LDVND  P +   P  +      + E    G  +  +   D D   +N  I  T  +      ++LE            K+    ++D E +     + NF     D+G   +    I + L + DINDN P+F    YQ  V E+  +G  + +  ATD D G  ALI Y++   VD  G F I+  TG + ++  LDREKK+ Y+LT +A D       +R+  S Q+ I VLD ND  P+  +     S+ EN P G  + T++A D+DEG N ++ + L    + +  +V+    L + Q   R  +S     + +  +  G   L     + V ++D NDN P +F+   + T L           H   +  ++ ++ E        V ATD D  +N   + S+     ++ N     F ID  SG I   + L R+   +  + ++  D G P   ++ + + V + DI
Sbjct: 1959 EGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGVIIDREAFS--------PPFLELLLLAEDVGQLNGTAYLFITILDDNDNWPTFSPPAYTVHLLENCPPGFSVLQI-TATDEDSGL-NGELVYRIEAGAQDRFLI--HPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTATVTILIDDINDSRPEFLNPIQTVSVLESTEPGTVIANVTAIDLDLNPKLEYHILSIVAKDDTDRLVPDQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNILDVNDNTPQF--KPFGITYYTERVLEGATPGTTLIAVAAVDPDK-GLNGLITYTLLDLIPPGYVQLEDSSAG-------KVIANRTVDYEEVH----WLNFTVRASDNGSPPRA-AEIPVYLEIVDINDNNPIFDQLSYQEAVFEDVAVGTVILRVTATDADSGNFALIEYSL---VDGEGKFAINPNTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNGQLTYSLEGPGM-EAFSVDMDSGLVTTQ---RPLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRP-VFVRPPNGTIL-----------HIKEEIPLRSNVYE--------VYATDKDEGLNGAVRYSFL---KSTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDI 2713          

HSP 6 Score: 142.51 bits (358), Expect = 1.266e-32
Identity = 168/645 (26.05%), Postives = 281/645 (43.57%), Query Frame = 1
Query:  196 ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEK--QKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-----GDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDG--------IIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSA-IGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTL 2049
            E++Y F    D FS+D  +G I  +  +D E +             +L V         +  ++ I +LD++DN P F+K  +   ++E       ++ L  A D+D S  N  I Y +   S   S F++  +   G  + +   +DYE+        T+ A    +  + + + VT++V + ND  P FSK  Y  SV E+I     ++ +NA D D     G       L  ++ F+IN   GE+     LD E    +   ++A DG      K     + +T+LD+ND  P++   P  + + E       V  +   D D       +   +  ++  +L     ++ T  ++         LDRE  PD         II +   C    +K    ++ ++ +N+ D+NDN P F +  +   V E    G  ++Q  A D D G N L++Y +Q  +    FVI+S +G +     LDRE+  +Y L +VA D     + S ST LTI VLD ND  P       + S+ E++P    +  L   D D G NA + + ++  ++    +V    ++    V  DRE  +     ++  D+  +G   T   +V V +LD NDN P IFL    E ++
Sbjct:  492 EVNYFFSDDPDRFSLDKDTGLIMLIARLDYELI----------QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRL-RATDED-SPPNNLITYSIVNASAFGSYFDISVYEGYG-VISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGKNGTLVYSIQPPNKFYSLNSTTGKIRTTHVM---------LDREN-PDPVEAELMRKIIVSVTDCGRPPLKAT--SSATVFVNLLDLNDNDPTFQNLPFVAEVLEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTST-LTIRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNVPVGKRRTGTATVFVTVLDVNDNRP-IFLQSSYEASV 1109          

HSP 7 Score: 142.124 bits (357), Expect = 1.332e-32
Identity = 141/535 (26.36%), Postives = 244/535 (45.61%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIH--RKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD--GEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF--PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV---DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID--QAVHDRKSGSTQLTITVLDDND----NAPELR-EYTDFSILENLPIGHYIGTLI-AFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKS 1908
            K+ + ILD++DN P+F+    T   + V+        +   AAVD D  + N  I Y +        ++  +S   ++     +DYE+     FT+ A        +A + V L++V+IND  P F +  Y+E+V+ED+++  +I++V A DAD  N   + Y L+     F IN N G+++++  LD EK   +  T  A D  G+  +  +     + I VLDVND  P +        + E   +G  V  +   D+D  S        +  +  +   +E   +  D  L+     + S +R  +         +  D G +  L+    + + V D+NDN P+F  P +   + +KE   +   +++  ATD+D G N  + Y+   S    D   F ID  +G ++  Q LDREK+  Y L +VA D  Q V        Q+ +  +DDN+      P+   +Y   ++ E+ P G  +G +  A D DEG NA + + ++  +  +   +   G L   +  DRE ++
Sbjct: 2276 KLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGL-NGLITYTLLDLIPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQLSYQEAVFEDVAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGS------NGQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNL-------TVVATDGG-EPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDKDEGLNGAVRYSFLKSTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEDKNFHLQPDGRLLVLRDLDRETEA 2795          

HSP 8 Score: 137.117 bits (344), Expect = 5.649e-31
Identity = 175/650 (26.92%), Postives = 295/650 (45.38%), Query Frame = 1
Query:  523 MKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGE----FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGI-----KRQLYTNISIPLN--VHDINDNAPLFPSSQYQVGVKENNDIGYQL-FQAQATDEDIGKNA-----LITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDID--KKSGKITINRPLHRDLI--GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            M N  + + +SG+ ++ F   E ++    LR  +D + + +    F++S +Q           V +QV ++ND AP F    Y   + E+  +   I  VNA D D   G ++ Y   P + +F I++  G + +I++LD+E  Q++  T+ ATD +        + L I + DV D  P +I  P    I E +  G  V  IT  D+D     RGI  T  +  T ++    D +S  + L         LDRE   + +    FI    G      +      ++   N  V DINDNAP F SS+Y V + E   +G+ L    Q  D+D G N+     L+  N    + S   V       +++  PLD E  ++Y   + A +++V D   G  ++ IT++++NDN P   +   + S+ EN+ +G  + T++A D D G    + +  S D      +++K TG +      D E   +    +   D   G   T  V   +N+LD NDN P    ++KD    + +L  N      +V  +V++             +ATD D    + ++Y + N+++     S FDI   +  G I+++RPL  + I  GL  + VM +D+G+P L S   + +E+ D
Sbjct:   60 MDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQG-----VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAIDSARGIVTVIRELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDK-GRPRGIGYTIVSGNTNSI-FALDYISGALTL------NGLLDRE---NPLYSHGFILTVKGTELNDDRSPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFA-NESVPDH-VGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDP--DRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGG-GEETTGRVR--INVLDVNDNVPT---FQKD--AYVGALREN----EPSVTQLVRL-------------RATDEDSPPNNLITYSIVNASAFG---SYFDISVYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFD 661          

HSP 9 Score: 127.487 bits (319), Expect = 4.914e-28
Identity = 182/800 (22.75%), Postives = 328/800 (41.00%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQIDE------ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIIL-DIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAV-----DKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-------------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVL--DVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRD-SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP-----LNVHDINDNAPLFPS---SQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVI-DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSH----VSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
             TI EN P+ +FV  +  A   D         + + G     F I+  +G +   + +D E +       +   T+S+  N    +       ++++ L D +DN P F +  +  E+ E       +  L   +     D+D+      + Y++ G HS   + ++++    +R  + ID E        L    ++   ++    + + +++ ND  P FS   Y   + E+      ++++ A D D             G   R+++ P+T   ++ N         +D E+ +S+  T+ ATD G         +T+L  D+ND  P + LNP + V + E+ + G ++  +T  D D +  +   I       +T  L  +++      +    +     L+RE +    +  + I   S +  +   ++S+P     +N+ D+NDN P F     + Y   V E    G  L    A D D G N LITY +   +  G   + DS  G +   + +D E+ +    T+ A D     R +    + + ++D NDN P   + +   ++ E++ +G  I  + A D D G  A I + L +D   +      TG ++     DREKK          D+  G+V ++     V V + +LD ND  PQ   + K + +   S++ N                 E  G  +  + ATD D  +  QL+Y LE    E      F +D  SG +T  RPL         + V+  D G P L     ++VE++D+
Sbjct: 1856 ITISENSPVSSFVAHV-LASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP------EYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLGTHSDLFVIDNSTGVVTVRSGVIIDREAFSPPFLELLLLAEDVGQLNGTAYLFITILDDNDNWPTFSPPAYTVHLLENCPPGFSVLQITATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGN-------ATIDREEQESYRLTVVATDRGTVPLSGTATVTILIDDINDSRPEF-LNPIQTVSVLESTEPGTVIANVTAIDLDLNPKLEYHILSIVAKDDTDRLVPDQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASDLPER---SVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLIPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPR-AAEIPVYLEIVDINDNNPIFDQLSYQEAVFEDVAVGTVILRVTATDADSGNFALIEYSL-VDGEGKFAINPNTGDIYVLSSLDREKKDHYILTALAKDNP-GDVASNRRENSVQVVIRVLDVNDCRPQ---FSKPQFS--TSVYEN-----------------EPAGTSVITMLATDQDEGSNGQLTYSLEGPGME-----AFSVDMDSGLVTTQRPLQS--YERFNLTVVATDGGEPPLWGTTMLLVEVIDV 2602          

HSP 10 Score: 125.561 bits (314), Expect = 1.920e-27
Identity = 172/748 (22.99%), Postives = 318/748 (42.51%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNR-QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLID------IDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRY---ILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIK--CTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITY---------NIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            F I+ +SG+I T  ++D E     + A+      +++  V   QKT I+ + + +  LDI+DN P ++   + + + E+    + V  +  AVD D+  KN  + Y +   +  ++L     +     +++D      ++ E  ++   +++   +     +++  V + ++++ND  P F    +   V E       + +V A+D D G N  + Y   + +P  ++   +  G +    +LD E+   +   + A+D     +S    L I VLDVNDE P++      + + E       V  +   D D V +N  +    T  N + +     +D +         + TV  LDRET     +    I      KR+  T  ++ + V D+NDN P+F  S Y+  V E+   G+ + Q +ATD D G+   + Y         N +  V SGL V   R        PLDRE+ + ++L   A +  +   +S S ++ + V D ND AP    ++Y    + E   IG  +  + A D+D G+   + +++      +      TG + +    D E K+     +  +D A         SV V +L+E D   Q                       SN  Y  +  I E +     +V+     ++N++Q++Y  +   S    +++F ID  +G IT+   + R+      + V+ +D G P + S   + V +LD
Sbjct:  717 FRINARSGEITTTSLLDRE-----TKAEYILIVRAVDGGVGHNQKTGIATVNVTL--LDINDNHPTWKDAPYYINLVEMTPPDSDVTTV-VAVDPDLG-KNGTLVYSIQPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTIRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDND-VGLNAELSYFITAGNVDGKFSVGYRDAV---------VRTVVGLDRETTAAYTLVLEAIDNVPVGKRRTGT-ATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRLHVSSGLLVRGPR--------PLDRERNSSHVLMAEAYNHDLGPMRS-SVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDRDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATDGA-PPFNQGFCSVYVTLLNELDEAVQF----------------------SNASY--EAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQ-AKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGG-PKVDSTVKVYVTVLD 1408          

HSP 11 Score: 115.931 bits (289), Expect = 1.729e-24
Identity = 191/766 (24.93%), Postives = 309/766 (40.34%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGE---FVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSG----ILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI---YKLYTVHS---LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKD-----EGENARIMFKLSMDHLYQ----PLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIG----NVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            G I + F I+ ++G I   K +D E +         +AT    +  +R   L S   +++ + DI+DN P F +  E   ++ E      +  +L  A D+D S  N ++ Y +  GD     +        R+R  +++D E    Y  T+ A  +    +S+ M V ++V++IND  P         ++ E+  +   +  V A DAD      +   +T       F IN   G + + + LD E+   +  T+   D      +A      L +++ D ND  P +     +  + E + +G    +L G I   D D           E  +     +L      +D+ +I     + TV S   +DRE      +    +  D G   QL     + + + D NDN P F    Y V + EN   G+ + Q  ATDED G N  + Y I+       F+I   TG +++    +DRE++  Y LT+VA D+      SG+  +TI + D ND+ PE L      S+LE+   G  I  + A D D     E     I+ K   D L         VN  TGS+      +RE  +     + + D+A      +V   +  + VNILD NDN PQ               F  TY       Y  ++      G  +  V A D D      ++Y L +       Q     D  +GK+  NR +  + +      V   D+G P   +   + +EI+DI
Sbjct: 1675 GNIINTFRINRRTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHR---LTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL--AHDRD-SGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDAD-----------EDVYAVVTYQLLGTH--SDLFVIDNSTGVVTVRSGVIIDREAFSPPFLELLLLAEDVG---QLNGTAYLFITILDDNDNWPTFSPPAYTVHLLENCPPGFSVLQITATDEDSGLNGELVYRIEAGAQD-RFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVP-LSGTATVTILIDDINDSRPEFLNPIQTVSVLESTEPGTVIANVTAIDLDLNPKLEYHILSIVAKDDTDRLVPDQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNILDVNDNTPQF------------KPFGITY-------YTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLIPPGYVQLE---DSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDI 2393          

HSP 12 Score: 108.997 bits (271), Expect = 1.886e-22
Identity = 190/810 (23.46%), Postives = 329/810 (40.62%), Query Frame = 1
Query:   94 FFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGL----ITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY-QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINN-DGELHLIQKLDFEK---HQSFSFTIQATD-------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQ-ITVFDRDSVSINRGIKCTETNHETQALRLEKD--QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP---------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL-ENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVN---NVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS--GHPSLKSAKTIMVEILDI 2391
            FF+ +       I E+ P+ + V ++  A+ +D +    FG+     +  F+++P +G +   + +D E         K   T+  +V+ ++    +   K+ I + D++DN P F    +++ I E        I++  A D D+      + Y        F ++  ++RG  + ++ ++DYE  + Y+ T++A  Q     +S   N+ + + ++ D  P F    Y  ++YE       +  + AVD D    R I   +      + F ++   G L L   LD E       F  T++ T+        +    +   I V+D+ND  P +  +   + I E  + G  +   I V D+D   +N   +     + +    +     Q   DI    ++     LD ET+           YD      L+ N S+P         + + + NDN P+F    Y V + EN  +G  +    ATD D+G    + Y   FS D   F +D  TG + L+  LD E   ++ LT++A D    +    + ++ I VLD NDN P  ++      L EN P    +  L A D+D   N  I + +   S    Y  ++V +  G +  ++  D E+       + +     GN  L S V V + + DENDN P                   T+++ +   Y V +      G  +  + ATD D +       + Y LE S       S F I+ +SG+IT    L R+      + V   D   GH       T+ V +LDI
Sbjct:   35 FFDTY-----LLISEDTPVGSSVTQL-LARDMDND-PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRET--------KSEFTVEFSVSDHQG---VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTP-VGTPIFIVNATDPDLG-AGGSVLYSFQPPSQFFAID--SARG-IVTVIRELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRSPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDE-GLNSMFEVYLVGNNSHHFIISPTSVQGKADI----RIRVAIPLDYETVDR---------YDF----DLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNY--FFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEET---TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISVYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPP-------------------TFSKPA---YFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGS-------SQFRINARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQKTGIATVNVTLLDI 769          

HSP 13 Score: 108.997 bits (271), Expect = 1.886e-22
Identity = 136/532 (25.56%), Postives = 228/532 (42.86%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVID--------LEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSK----TIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN-----YFQINN-DGELHLIQKLDFEKHQSFSFTIQATD-GEFV---AESKLKITVLDVNDEPPSYILNPEK------LVIDETNKSGILVGQITVFDRDSVSINRGIKCT-----ETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP--------------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF----------SVDSG-LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD 1641
            F+I+P +GDI+ L  +D        L AL  ++  D  S         NR++  +   ++VI +LD++D +P+F KP+F+  + E       VI +  A D+D    N ++ Y + G    AF+++  +      R L     +  +++  T+ A    +  +     + ++V+++ND  P F +    TI    + E+I L   + +V A D D G N  +RY  L  T      YF I+   G +   Q+LD EK   +S  + A+D G+ V       L++ + D++D  P ++  P+       L + E +  G LVG +T     +V  + G            +E +   L+ D          +L  +  LDRET  + I   +FI   S  +         P              + + DIND  P F  ++Y  GV  +  +G +L Q  A D DIG N+L+ Y I            S D G +F + S  G L+            +++ IVA D A H+
Sbjct: 2446 FAINPNTGDIYVLSSLDREKKDHYILTALAKDNPGDVAS---------NRRENSV---QVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITM-LATDQD-EGSNGQLTYSLEGPGMEAFSVDMDSGLVTTQRPL-----QSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILH--IKEEIPLRSNVYEVYATDKDEGLNGAVRYSFLKSTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVT----GAVDADEGPNAIVYYFIAAGNEDKNFHLQPDG---------RLLVLRDLDRET--EAIF--SFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARDLAGHN 2939          
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Match: sp|Q99PF4|CAD23_MOUSE (Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 3.490e-52
Identity = 210/760 (27.63%), Postives = 353/760 (46.45%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATIS---------LNVNVNRQKTLISVMKIV-IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDK--DISMKNKEIAYRMSGDHSAFNLEEHNSRGP---RLRLLIDIDYEKQKQYRFTLSAYQK-NDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEF-VAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHS----LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDED----IGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV-HDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREK----KSKVCTQIQLSDSAIGNV---LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            IF++D  SG           AL  N   D+E+   S           +N +R  +  +V     I+++DI+DN PEF   E+++ I E+      +      VDK  D+ + +    Y +  +   F +   + +G    R+R+ I +DYE   +Y F L A +   D    A + +TL  +N ND  P FS+ +Y  S+YE+I++   ++ V A D D      + Y      + F ++ D G + LI +LD+E  Q F+ T+ A DG       +++I VLDVND  P++  +     + E   S   + ++   D DS   N  I  +  N        +        + IY+ Y V S    LD E IP+G+IY   +  D+G    LY+ + + + V D NDN P F    Y V V EN   G  +    ATD D     G+ ++I Y+++    S  F I++R+G +     LDRE K++Y+L + A+D  V H++K+G   + +T+LD NDN P  ++   + +++E  P    + T++A D D GEN  +++ +   + +  L  + TG + +  V  DRE     ++++  +I +S +  G      TS  +V VN+LD NDN P                         N+ +V ++      G  +  V A D D      +SY ++      + +  F I+  SG +T    L R+ I   +++V+  D+G P+  S  T+ V +LD+
Sbjct:  283 IFALDYISG-----------ALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITL--INENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPP-NNLITYSIVNASAFGSYFD--------ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAG-NPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESII-YSLE---GSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLN-STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTF----------------------RNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ----VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDV 988          

HSP 2 Score: 163.696 bits (413), Expect = 3.554e-39
Identity = 179/703 (25.46%), Postives = 306/703 (43.53%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINR-GIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQY-QVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIA------------FDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE--KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQS--IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            S   + + +LD++DN P F    F  EI E      + +Y   A+D D  + N  ++YRM       +   +++ G  +    ++D E+  +Y+  + A      + S+   +T++V+++ND  P F   +Y  SV ED+  +  ++ +N  D D G N  L Y +    +   F +   D  +  +  LD E   +++  ++A D   V + +     + +TVLDVND  P ++ +  +  + E    G  + Q+   D D     R   +    NH     R+    + + +L+         LDRE     ++      +D G  R   +++ + + V D+ND AP+F   QY ++G++E   IG  +   +ATD+D G   L+ Y I  S   G F ID  TG +  +  LD E K  Y++ + A D A      G   + +T+L++ D A +    + +  I+ENL +G  I  + A            FD      A+ +FK+             TG +    + DREK       +   D   G  + S V V + +LDENDN P+ F +  D                        +S+ E   VG  +A VKA D D  +  Q+ + L   AS N+  +  I   +   G++ + +PL R+ +    +KV+  D G P  K    + V ILD+
Sbjct:  872 SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTP-AGVSVYQVVAIDLDEGL-NGLVSYRMQVGMPRMDFVINSTSG-VVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNN-FRI---HVGSGLLM----RGPRPLDRERNSSHVLMVEAYNHDLGPMR---SSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIGTSVIVVRATDKDTGDGGLVNYRI-LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATDGA-PPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDA----------ITGVITVKGLVDREKGDFYTLTVVADDG--GPKVDSTVKVYITVLDENDNSPR-FDFTSDS----------------------AISVPEDCPVGQRVATVKARDPDAGSNGQVVFSL---ASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV 1520          

HSP 3 Score: 163.31 bits (412), Expect = 5.392e-39
Identity = 188/699 (26.90%), Postives = 325/699 (46.49%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPR---LRLLIDIDYEKQKQYRFTLSAYQKN--DESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPM-----TNYFQINNDGELHL--IQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNP-EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAV--VKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKI-TINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            S   + + +LD++D  P F    + + + E + R+  V++L    D D+ + N E++Y ++    A N++   S G R   +R ++ +D E    Y   L A       +  +    V + V+++ND  P F ++ YE SV EDI     I+++ A DAD      +   +      N F+I+    L +   + LD E++ S    ++A +   G   +  ++ + V DVNDE P +      +L + ET  +GI    I V   D  + + G+         +  + E D+ ST +++     TV  LD ET    ++  N    D      Q + ++ + L ++++ D A  F ++ Y+  + EN  +G ++ + QA   D        ++   S  +  LF ID+ TG + +   +DREK + Y LT+VA D     +   + ++ ITVLD+NDN+P     +D   S+ E+ P+G  + T+ A D D G N +++F L+  ++   ++ +T N + G +F  +  DRE+      ++  SD         H+ + V ILD NDN P           +I S F               +S+ E VG   +V  V+ATD D+   S LSYY+    +E  +   F +D+ SG+I T   P  R+      + V VED G P+L +   + V I+D
Sbjct:  977 STSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWL-NCTDNDVGL-NAELSYFIT----AGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRET--AGIGTSVIVVRATDKDTGDGGLVNYRILSGAEG-KFEIDE-STGLIV-----TVDYLDYETKTSYLM--NVSATDGAPPFNQGFCSVYVTL-LNEL-DEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGG--PKVDSTVKVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHI-LQVTILDVNDNPP-----------VIESPFG------------YNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYI----TEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVD 1626          

HSP 4 Score: 156.377 bits (394), Expect = 6.261e-37
Identity = 212/812 (26.11%), Postives = 345/812 (42.49%), Query Frame = 1
Query:  109 DGVQKFTIEENQPIKTFVGRIK---FAKQIDEEL----SYSF-GLITDIFSIDPKSG--DIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMT-------------NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGE--------FVAESKLKITVLDVNDEPPSYILNPEKLV-----IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI--CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQ---AVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDND--VNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            +G  +  + EN P  T +  +     A   DE++    +Y   G  +D+F ID  +G   + +  +ID EA             + L +       L     + I ILD +DN P F  P +T+ + E       V+ +  A D+D  + N E+ YR+ +G    F +  H   G        ID E+Q+ YR T+ A  +    +S    VT+ + +IND  PEF   I   SV E      II  V A+D D    L Y ++ +              + F +N N G + +   L+ E   ++  T+   D           V  +KL + +LDVND  P +   P  +      + E    G  +  +   D D   +N  I  T  +      ++LE            K+    ++D E +     + NF     D+G   +    I + L + DINDN P+F    YQ  V E+  +G  + +  ATD D G  ALI Y++   VD  G F I+  TG + ++  LDREKK+ Y+LT +A D       +R+  S Q+ I VLD ND  P+  +     S+ EN P G  + T++A D+DEG N+++ + L    + +  +V+    L + Q   R  +S     + +  +  G   L     + V ++D NDN P +F+   + T L           H   +  ++ ++ E        V ATDND  +N   + S+      + N     F ID  SG I   + L R+   +  + ++  D G P   ++ + + V + DI
Sbjct: 1961 EGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFS--------PPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQV-TATDEDSGL-NGELVYRIEAGAQDRFLI--HPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF--KPFGITYYTERVLEGATPGTTLIAVAAVDPDK-GLNGLITYTLLDLTPPGYVQLEDSSAG-------KVIANRTVDYEEVH----WLNFTVRASDNGSPPRA-AEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSL---VDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGM-EAFSVDMDSGLVTTQ---RPLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRP-VFVRPPNGTIL-----------HIKEEIPLRSNVYE--------VYATDNDEGLNGAVRYSFL---KTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDI 2715          

HSP 5 Score: 154.836 bits (390), Expect = 2.006e-36
Identity = 180/697 (25.82%), Postives = 304/697 (43.62%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDI-SLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQIN-NDGELHLIQKLDFE-KHQSFSFTIQATD------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL----IYKLYTVHSLDRETIPDGIIYTNFICY-DSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDR--KSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYI----GTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTG--SLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITI-NRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + ILD++DN P  E P  + + + E +     V+ +  A D+DI + N  ++Y ++  +           G         D E+Q  Y   ++   +   ++SA  +V + +V+ ND AP F +  YE  + E   +++  +I V A+D D G N  + Y ++   + N F+IN + G +   ++LD+E  H  ++  + ATD          + + + + V D+ND  P++  + E        + G  V      DRDS            N + +   ++ D +   ++     + ++     LDRETI     Y   IC  D G+   L + + + + V DINDN P+  +    V + EN+ +   +    A+D D G NAL+T+NI        F I++ TG + + +PLDRE+  +Y LT+   D   + R  +     L +++ D+NDN P   E T    ++EN P G  +    G ++A D DE   A + ++L   H    +  N TG  ++ S  + DRE  S    ++ L    IG  L     + + ILD+NDN+P                        S   Y V +      GF +  V ATD D     +L Y +E  A     Q  F I   +G I + N  + R+     ++ V+  D G   L     + + I DI
Sbjct: 1515 VTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQV-RATDRDIGI-NSVLSYYITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFLAHDRDS----------GPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETI---AFYNLTICARDRGVP-PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQ-LNGTAHLFITILDDNDNWPTF----------------------SPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGA-----QDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDI 2167          

HSP 6 Score: 140.969 bits (354), Expect = 3.091e-32
Identity = 142/544 (26.10%), Postives = 245/544 (45.04%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIH--RKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD--GEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF--PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV---DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID--QAVHDRKSGSTQLTITVLDDND----NAPELR-EYTDFSILENLPIGHYIGTLI-AFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLS 1935
            K+ + ILD++DN P+F+    T   + V+        +   AAVD D  + N  I Y +        ++  +S   ++     +DYE+     FT+ A        +A + V L++V+IND  P F +  Y+E+V+EDI++  +I++V A DAD  N   + Y L+     F IN N G++ ++  LD EK   +  T  A D  G+  +  +     + I VLDVND  P +        + E   +G  V  +   D+D  S       ++  +  +   +E   +  D  L+     + S +R  +         +  D G +  L+    + + V D+NDN P+F  P +   + +KE   +   +++  ATD D G N  + Y+   +    D   F ID  +G ++  Q LDREK+  Y L +VA D  Q V        Q+ +  +DDN+      P+   +Y   ++ E+ P G  +G +  A D DEG NA + + ++     +   +   G L   +  DRE ++     ++ S
Sbjct: 2278 KLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGL-NGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGS------NSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNL-------TVVATDGG-EPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKAS 2806          

HSP 7 Score: 140.969 bits (354), Expect = 3.253e-32
Identity = 171/652 (26.23%), Postives = 282/652 (43.25%), Query Frame = 1
Query:  196 ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEK--QKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-----GDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK-----LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD-------SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDG--------IIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSA-IGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTL 2049
            E++Y F    D FS+D  +G I  +  +D E +             +L V         +  ++ I +LD++DN P F+K  +   ++E       ++ L  A D+D S  N  I Y +   S   S F++  +   G  + +   +DYE+        T+ A    +  + + + VT++V + ND  P FSK  Y  SV E+I     ++ +NA D D     G       L  ++ F+IN   GE+     LD E    +   ++A DG      K     + +T+LD+ND  P++   P  + + E       V  +   D D         SI+   K    N  T  +R      +T ++L          DRE  PD         II +   C    +K    ++ ++ +N+ D+NDN P F +  +   + E    G  ++Q  A D D G N L++Y +Q  +    FVI+S +G +     LDRE+  +Y L +VA D     + S ST LT+ VLD ND  P       + S+ E++P    +  L   D D G NA + + ++  ++    +V    ++    V  DRE  +     ++  D+  +G   T   +V V +LD NDN P IFL    E ++
Sbjct:  494 EVNYFFSDDPDRFSLDKDTGLIMLIARLDYELI----------QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRL-RATDED-SPPNNLITYSIVNASAFGSYFDISIYEGYG-VISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIR------TTHVML----------DREN-PDPVEAELMRKIIVSVTDCGRPPLKAT--SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTST-LTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRP-IFLQSSYEASV 1111          

HSP 8 Score: 139.043 bits (349), Expect = 1.434e-31
Identity = 175/652 (26.84%), Postives = 295/652 (45.25%), Query Frame = 1
Query:  523 MKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD---GDNLRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGE----FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-------RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQL---FQAQATDEDIGKNA-----LITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDID--KKSGKITINRPLHRDLI--GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            M N  + + +SG+ ++ F   E ++    LR  +D + + +    F++S +Q           V +QV ++ND AP F    Y   + E+  +   I  VNA D D   G ++ Y   P + +F I++  G + +IQ+LD+E  Q++  T+ ATD +        + L I + D+ D  P +I  P    I E +  G  V  IT  D+D     RGI  T  +  T ++    D +S  + L         LDRE   + +    FI    G +              +  + V DINDNAP F SS+Y V + E   +G+ L    Q    DED+G N+     L+  N    + S   V       +++  PLD E  ++Y   + A +++V D   G  ++ IT++++NDN P   +   + S+ EN+ +G  + T++A D D G    + +  S D      +++K TG +      D E   +    +   D   G   T  V   +N+LD NDN P    ++KD    + +L  N      +V  +V++             +ATD D    + ++Y + N+++     S FDI   +  G I+++RPL  + I  GL  + VM +D+G+P L S   + +E+ D
Sbjct:   60 MDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQG-----VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDK-GRPRGIGYTIVSGNTNSI-FALDYISGALTL------NGLLDRE---NPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFA-NESVPDH-VGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDP--DRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGG-GEETTGRVR--INVLDVNDNVPT---FQKD--AYVGALREN----EPSVTQLVRL-------------RATDEDSPPNNLITYSIVNASAFG---SYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFD 663          

HSP 9 Score: 126.716 bits (317), Expect = 8.833e-28
Identity = 185/799 (23.15%), Postives = 326/799 (40.80%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDE------ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIIL-DIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAV-----DKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-------------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVL---DVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRD-SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP-----LNVHDINDNAPLFPS---SQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVI-DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSH----VSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            TI EN P+ +FV  +  A   D         + + G     F I+  +G +   + +D E +       +   T+S+  N    +       ++++ L D +DN P F +  +  E+ E       +  L   +     D+D+      + Y++ G HS   + ++++    +R  I ID E        L    ++   ++   ++ + +++ ND  P FS   Y   + E+      +++V A D D             G   R+++ P+T   ++ N         +D E+ +S+  T+ ATD   V  S   I  +   D+ND  P + LNP + V + E+ + G ++  +T  D D +  +   I       +T  L  +++      +    +     L+RE +    +  + I   S +      ++S+P     +N+ D+NDN P F     + Y   V E    G  L    A D D G N LITY +      G   + DS  G +   + +D E+ +    T+ A D     R +    + + ++D NDN P   + +   ++ E++ +G  I  + A D D G  A I + L +D   +      TG +      DREKK          D+  G+V ++     V V + +LD ND  PQ   + K + +   S++ N                 E  G  +  + ATD D  + SQL+Y LE    E      F +D  SG +T  RPL         + V+  D G P L     ++VE++D+
Sbjct: 1859 TISENSPVSSFVAHV-LASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP------EYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGN-------ATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEF-LNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEH---SVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPR-AAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSL-VDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNP-GDVASNRRENSVQVVIRVLDVNDCRPQ---FSKPQFS--TSVYEN-----------------EPAGTSVITMLATDQDEGSNSQLTYSLEGPGME-----AFSVDMDSGLVTTQRPLQS--YERFNLTVVATDGGEPPLWGTTMLLVEVIDV 2604          

HSP 10 Score: 115.161 bits (287), Expect = 2.735e-24
Identity = 189/766 (24.67%), Postives = 307/766 (40.08%), Query Frame = 1
Query:  214 GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN------YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGE---FVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSG----ILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI---YKLYTVHS---LDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP-LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKD-----EGENARIMFKLSMDHLYQ----PLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIG----NVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            G I + F I+  +G I   K +D E +         +AT    +  +R   L S   +++ + DI+DN P F +  E   ++ E      +  +L  A D+D S  N ++ Y +  GD     +        R+R  +++D E    Y  T+ A  +    +S+ M V ++V++IND  P         ++ E+  +   +  V A DAD      +   +T       +F     G + + + LD E+   +  T+   D      +A      L +++ D ND  P +     +  + E + +G    +L G I   D D           E  +     +L      +D+ +I     + TV S   +DRE      +    +  D G   QL     + + + D NDN P F    Y V + EN   G+ + Q  ATDED G N  + Y I+       F+I   TG +++    +DRE++  Y LT+VA D+      SG+  +TI + D ND+ PE L      S+LE+   G  I  + A D D     E     I+ K   D L         VN  TGS+      +RE  +     + + D+A      +V   +  + VNILD NDN PQ               F  TY       Y  ++      G  +  V A D D      ++Y L +       Q     D  +GK+  NR +  + +      V   D+G P   +   + +EI+DI
Sbjct: 1677 GNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHR---LTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL--AHDRD-SGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDAD-----------EDVYAVVTYQLLGTH--SDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIG---QLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQD-RFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPL-SGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF------------KPFGITY-------YTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLE---DSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDI 2395          

HSP 11 Score: 107.071 bits (266), Expect = 7.558e-22
Identity = 187/811 (23.06%), Postives = 326/811 (40.20%), Query Frame = 1
Query:   94 FFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGL----ITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAY-QKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINN-DGELHLIQKLDFEK---HQSFSFTIQATD-------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQ-ITVFDRDS-VSINRGIKCTETNHETQALRLEKD--QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP---------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL-ENLPIGHYIGTLIAFDKDEGENARIMFKL----SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVN---NVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS--GHPSLKSAKTIMVEILDI 2391
            FF+ +       I E+ P+ + V ++  A+ +D +    FG+     +  F+++P +G +   + +D E         K   T+  +V+ ++    +   K+ I + D++DN P F    +++ I E        I++  A D D+      + Y        F ++  ++RG  + ++ ++DYE  + Y+ T++A  Q     +S   N+ + + ++ D  P F    Y  ++YE       +  + AVD D    R I   +      + F ++   G L L   LD E       F  T++ T+        +    +   I V+D+ND  P +  +   + I E  + G  +   I V D+D  + +N   +     + +    +     Q   DI    ++     LD ET+           YD      L+ N S+P         + + + NDN P+F    Y V + EN  +G  +    ATD D+G    + Y   FS D   F +D  TG + L+  LD E   ++ LT++A D    +    + ++ I VLD NDN P  ++      L EN P    +  L A D+D   N  I + +    +    +        G +  ++  D E+       + +     GN  L S V V + + DENDN P                   T+++ +   Y V +      G  +  + ATD D +       + Y LE S       S F I+ +SG+IT    L R+      + V   D   GH       T+ V +LDI
Sbjct:   35 FFDTY-----LLISEDTPVGSSVTQL-LARDMDND-PLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRET--------KSEFTVEFSVSDHQG---VITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTP-VGTPIFIVNATDPDLG-AGGSVLYSFQPPSPFFAID--SARG-IVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHHFIISPTSVQGKADI----RIRVAIPLDYETVDR---------YDF----DLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNY--FFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTVIARDGGGEET---TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPP-------------------TFSKPA---YFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEGS-------SQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDI 771          

HSP 12 Score: 105.916 bits (263), Expect = 1.883e-21
Identity = 135/532 (25.38%), Postives = 224/532 (42.11%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVID--------LEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSK----TIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN-----YFQINN-DGELHLIQKLDFEKHQSFSFTIQATD-GEFV---AESKLKITVLDVNDEPPSYILNPEK------LVIDETNKSGILVGQITVFDRDSVSINRGIKC-----TETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP--------------LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF----------SVDSG-LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD 1641
            F+I+P +GDI  L  +D        L AL  ++  D  S         NR++  +   ++VI +LD++D +P+F KP+F+  + E       VI +  A D+D    N ++ Y + G    AF+++  +      R L     +  +++  T+ A    +  +     + ++V+++ND  P F +    TI    + E+I L   + +V A D D G N  +RY  L  T      YF I+   G +   Q+LD EK   +S  + A+D G+ V       L++ + D++D  P ++  P+       L + E +  G LVG +T     +V  + G             E +   L+ D          +L  +  LDRET        +FI   S  +         P              + + DIND  P F  ++Y  GV  +  +G +L Q  A D DIG N+L+ Y I            S D G +F + S  G L+            +++ IVA D A H+
Sbjct: 2448 FAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVAS---------NRRENSV---QVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITM-LATDQD-EGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPL-----QSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILH--IKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVT----GAVDADEGPNAIVYYFIAAGDEDKNFHLQPDG---------RLLVLRDLDRET----EATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARDLAGHN 2941          

HSP 13 Score: 98.9821 bits (245), Expect = 2.423e-19
Identity = 180/750 (24.00%), Postives = 298/750 (39.73%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDL--EALCFNS---CADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKD----------ISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNI---NDCAPEFSKTIYEESVYEDISLDEIIIKVN----AVDADGDN---LRYILLPM-TNYFQINNDGELHLIQKLDFEKHQSFS-----FTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-------VSINRGIKCTETNHE-TQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSV-----------DSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAV----HDRKSGSTQLTITVLDDNDNAPELRE----YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL---YQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            F I P  G +   K ++L  E + F +   CA                  L S M + I +LDI+DN P        + I E     + V ++ A+ D D          I+  N+E A+ ++       +               +D E+  +YR T+S     +    A  +  L +V++   ND  P F++  Y+  V E+      +  +N    A+DAD D    + Y LL   ++ F I+N   +  ++       ++FS       + A D G+    + L IT+LD ND  P++      + + E    G  V Q+T  D DS         I  G +     H  T  +R+    +  +    Y+L TV + DR T+P                  L     + + + DIND+ P F +    V V E+ + G  +    A D D+  N  + Y+I   V               F ++  TG + +  PL+RE    Y +T+  ID A     H     + +LT+ +LD NDN P+ +     Y    +LE    G  +  + A D D+G N  I + L +D     Y  L  +  G + +N+  D E+   +   ++ SD+       + + V + I+D NDN P IF    D+ +   ++F +                   VG VI  V ATD D  N + + Y L +   +      F I+  +G I++   L R+
Sbjct: 1792 FVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGV-----------PPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLAS-DADSGCNALLTFNITAGNRERAFFINATTGIVTVNRP------------LDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHPVTGVIRVGNATIDREEQESYRL-TVVATDRGTVP------------------LSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTL-LDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNG-SPPRAAEIPVYLEIVDINDNNP-IF----DQPSYQEAVFEDI-----------------AVGTVILRVTATDADSGNFALIEYSLVDGEGK------FAINPNTGDISVLSSLDRE 2466          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A5K3EUK1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 5.451e-110
Identity = 274/890 (30.79%), Postives = 447/890 (50.22%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVG---------------RIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEF----EKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEE---HNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMS---------ANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYIL-----LPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHE--TQALRLEKDQMSTDIL-------LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKR-------------------QLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ-FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRK-SGSTQ-------LTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---------SMDHLYQPLTVNKT--GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIF-------LYEKDETTLINSLF---NNTYTEHSNVDY---VVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-------------------------YLENSASENLQQS------IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIP 2394
            ++T+ EN+PI   +G               R+       ++L +     +  F +D  +  + T  +ID E  C   C     A +++ VNV ++K LI+ + + I ++D+DDN  EF     +P F + +KEVI+RK   + LP AVDKD++ K   I+YR+   SG   +  + E    N   P L L  D+DYE+ K+Y FTL A+  N ES S         A + V + V+NIND  P F +++Y   V ED+ L  +I+++ A+D D D  L Y +     + ++  F++  DG++ L +  DFEK   ++  I+A+DGEF A ++L I +LDVNDE P +I+NP  + ++E     ILVGQ+ V D D+ ++N  ++CTE + E   Q LR  +   ST +        L + LYT H+LDRE  P  +  +  +C+D  +                     +L + +++ ++V D NDNAP+F    +   ++EN+DI  ++ Q  + D D  +NA+  Y +   + D+ LF ++  TG L  M   DRE ++ Y L +VA D +    +  G+ Q       +T+ ++D ND+AP ++E  +  + EN   G  +G + A D D G N  ++F+L         S   L Q +    T  GS+FS + FDRE +S+ C Q++  D +    L+S   VCVN+LD NDN P I         YE+D + + N  F   ++  T +S   Y    +++S+ E  G+   +++ATD D    ++L Y                         Y E + SE L+Q        F +D+++GK+ + R L    +G   ++++VED GHP LKS + I + + D P
Sbjct:   47 QYTMRENEPIGHRLGYLDDDLRRQQAMNFSRLCGGGAGCKDLRFRLREPSSRFGLDEATAMLTTKSIIDFEEQCIGQCRSTLDAFLTVTVNVWQEKKLIAFIHVRIQVVDVDDNNVEFPADISRP-FVLRLKEVIYRKGKAVELPRAVDKDVTPKYSAISYRLEFSSGQWESMKMVELSVTNDSRPLLVLKEDLDYEEVKEYGFTLVAW--NPESQSDGPKAMAREAQLPVVIHVLNINDMEPVFLQSLYTVEVPEDMELGTVIMELKAIDRDADAVLTYSINSAPGVNLSTPFEVEPDGKVRLRKACDFEKTTDYNLPIRASDGEFTASTRLHIRILDVNDEAPIFIVNPTHIAVEENQLPNILVGQVVVRDADTFAVNGNLECTEPSEEQDQQPLRFVRRSTSTGVSDSAVVPELHFDLYTKHTLDREDGPP-VRLSRLVCWDRVVGSSDLIYAGEVGHGAVSSKVTRLTSTLTVSVHVLDRNDNAPIFTQPTFTAELEENSDIRKEILQLTSKDYDTDENAVTRYRLTDENEDASLFYLNEETGRLYAMARFDRETRDVYHLQVVAFDSSSSPLEIPGAGQGAVSTALVTVRIVDVNDHAPIIQETGELILPENKEAGFLVGHVTATDLDAGANGEVVFELVPEDPRVVFSSPQLTQVMGFRMTSNGSIFSTKEFDREAQSRYCFQVRAKDKSPDASLSSTARVCVNVLDVNDNPPVIHSIEGPNARYERD-SPVPNPSFPGPDSFETLYSLAIYDLPSIRISLNEAPGYCALLIQATDLDEGENAELRYSINLAANCTPPNPPAPGYGQNADGNYQEKAESEWLEQPRQFRQHTFRMDERTGKLLLVRRLSHKELGAYCLELVVEDQGHPRLKSTQLIELTVEDTP 931          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A0R3UI68 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7092 PE=4 SV=2)

HSP 1 Score: 384.03 bits (985), Expect = 9.124e-110
Identity = 272/888 (30.63%), Postives = 445/888 (50.11%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVG---------------RIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEF----EKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEE---HNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDES-------MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYIL-----LPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHE--TQALRLEKDQMSTDIL-------LIYKLYTVHSLDRETIPDGIIYTNFICYD-------------------SGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ-FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRK-SGSTQ-------LTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---------SMDHLYQPLTVNKT--GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIF-------LYEKDETTLINSLF---NNTYTEHSNVDY---VVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-------------------------YLENSASENLQQS------IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIP 2394
            ++T+ EN+PI   +G               R+       ++L +     +  F +D  +  + T  +ID E  C   C     A +++ VNV ++K LI+ + + I ++D+DDN  EF     +P F + +KEVI+RK   + LP AVDKD++ K   I+YR+   SG   +  + E    N   P L L  D+DYE+ K+Y FTL A+    +S         A + V + V+NIND  P F +++Y   V ED+ L  +I+++ A+D D D  L Y +     + ++  F++  DG++ L +  DFEK   ++  I+A+DGEF A ++L I +LDVNDE P +I+NP  + ++E     ILVGQ+ V D D+ ++N  ++CTE + E   Q LR  +   ST +        L + LYT H+LDRE  P  +  +  +C+D                   S    +L + +++ ++V D NDNAP+F    +   ++EN+DI  ++ Q  + D D  +NA+  Y +   + D+ LF ++  TG L  M   DRE ++ Y L +VA D +    +  G+ Q       +T+ ++D ND+AP ++E  +  + EN   G  +G + A D D G N  ++F+L         S   L Q +    T  GS+FS + FDRE +S+ C Q++  D +    L+S   VCVN+LD NDN P I         YE+D + + N  F   ++  T +S   Y    +++S+ E  G+   +++ATD D    ++L Y                         Y E + SE L+Q        F +D+++GK+ + R L    +G   ++++VED GHP LKS + I + + D P
Sbjct:   31 QYTMRENEPIGHRLGYLDDDLRRQQAMNFSRLCGGGAGCKDLRFRLREPSSRFGLDEATAMLTTKSIIDFEEQCIGQCRSTLDAFLTVTVNVWQEKKLIAFIHVRIQVVDVDDNNVEFPADISRP-FVLRLKEVIYRKGKAVELPRAVDKDVTPKYSAISYRLEFSSGQWESMKMVELSVTNDSRPLLVLKEDLDYEEVKEYGFTLVAWNPESQSDGPKAMAREAQLPVVIHVLNINDMEPVFLQSLYTVEVPEDMELGTVIMELKAIDRDADAVLTYSINSAPGVNLSTPFEVEPDGKVRLRKACDFEKTTDYNLPIRASDGEFTASTRLHIRILDVNDEAPIFIVNPTHIAVEENQLPNILVGQVVVRDADTFAVNGNLECTEPSEEQDQQPLRFVRRSTSTGVSDSAVVPELHFDLYTKHTLDREDGPP-VRLSRLVCWDRVVGSSDLIYAGEVGHGAVSSKVTRLTSTLTVSVHVLDRNDNAPIFTQPTFTAELEENSDIRKEILQLTSKDYDTDENAVTRYRLTDENEDASLFYLNEETGRLYAMARFDRETRDVYHLQVVAFDSSSSPLEIPGAGQGAVSTALVTVRIVDVNDHAPIIQETGELILPENKEAGFLVGHVTATDLDAGANGEVVFELVPEDPRVVFSSPQLTQVMGFRMTSNGSIFSTKEFDREAQSRYCFQVRAKDKSPDASLSSTARVCVNVLDVNDNPPVIHSIEGPNARYERD-SPVPNPSFPGPDSFETLYSLAIYDLPSIRISLNEAPGYCALLIQATDLDEGENAELRYSINLAANCTPPNPPAPGYGQNADGNYQEKAESEWLEQPRQFRQHTFRMDERTGKLLLVRRLSHKELGAYCLELVVEDQGHPRLKSTQLIELTVEDTP 915          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A0R3TLN6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8168 PE=4 SV=2)

HSP 1 Score: 374.015 bits (959), Expect = 3.938e-106
Identity = 272/856 (31.78%), Postives = 430/856 (50.23%), Query Frame = 1
Query:  193 EELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPE-----FTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAF------NLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDES-------MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYIL--LPMTNY---FQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTET--NHETQALRLEK---------DQMSTDIL--LIYKLYTVHSLDRETIPDGIIYTNFICYD-------------------------SG-IKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ-FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVH-------DRKSGSTQLT-ITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMD---------HLYQPLTVNKT--GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIF-------LYEKDETTLINSL--FNNTYTEHSNVDY---VVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSAS--------------------ENLQQSI-------FDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIP 2394
            ++L Y     +    +D  +  + T  ++D E LC   C     A +S+ VNV + K +I+V+ + I ++DIDDN  EF  PE     F + +KEVI+RK   I LP A DKDI+ K   I+YR+    S +       L   N   P L L  D+DYE+ K+Y F+L A   +  S         A + + +QV+NIND  P FS+++Y   + ED+    +I ++ A+D D D  L Y +  +P  N    F +  DG++ L +  DFEK   ++  I+A+DGEF A ++L I +LDVNDE P++I+NP  L ++E     +LVGQ+ V D D+ ++N  ++C+E   + E Q LR E+          Q ST  +  L + LYT  SLDRE   + +     +C+D                         SG +  +L + +++ +++ D NDNAP+F  S +   + EN+DI  ++ Q  + D D  +NA+  Y++   S D+ LF ++  TG L  M   DRE ++ Y L +VA D + +       D ++ ST +  I ++D ND+ P ++E  + ++LEN   G  +G L A D D+G N  + F++  +          L Q +    T  GS+FS + FDRE +S+ C Q+Q +D +  N L+S   +CVNILD NDN P I         YE+D      +        T++S   Y    +++S  E  G+ +  ++ATD D    ++L Y L N A+                    EN +          F ID+++GK+ + R L    IG   + ++VED GHPSLKS + I + + D+P
Sbjct:   66 KDLRYRLREPSTYLELDETTSMLTTKSIMDFEQLCTAQCRSTLDAFLSVTVNVWQDKKIIAVLHVRIQVIDIDDNNVEF--PEDISRPFVLRLKEVIYRKGKTIELPKAEDKDITPKYSTISYRLEFSSSQWASMKMVELTVTNDSRPLLVLKEDLDYEEAKEYAFSLVASNPDIHSGVPKSISQEAKIPILVQVLNINDMEPVFSQSVYTVELPEDVQPGTVIFELKAIDRDADAVLTYSINAVPGMNQSTPFDVEPDGKVRLQEAFDFEKRADYNLPIKASDGEFTASTRLHIRLLDVNDEAPTFIVNPTHLTVEENQPPNVLVGQVVVRDADTFAVNGYLECSEPTEDSERQPLRFERRVVPIQPQLQQESTTAVPELQFDLYTRQSLDREE-GEPVRLARLVCWDGVGGGVGLGGASDYIYGGGSLTSSNSGRVSVRLTSTLTLSIHIQDRNDNAPIFTQSTFTAELLENSDIRKEIIQLTSKDYDTEENAVTRYSLTDDSEDASLFYLNEETGRLYAMTRFDRETRDNYQLQVVAYDVSQNPLENPGGDHQTVSTAVVNIKIIDINDHTPLIQEAGELALLENKDPGFLVGHLTATDLDDGPNGEVTFEIVPEDPRAVFNGPQLTQAIGFRMTPNGSIFSTRQFDREVQSRYCFQVQANDKSPDNALSSTARICVNILDVNDNAPIIHSIEGPDARYERDSLAQKPTFPGMEPYDTQNSLAAYDLPSLRISQNEAPGYCVLSMQATDLDEGENAELRYALNNGANCTPPNSSPSRFGHGIDEEKQENKEPEFRQFPLNTFRIDERTGKLLLVRRLSHKEIGTYCLGLVVEDQGHPSLKSTQMIELVVEDVP 918          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A0R3WM04 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1779 PE=4 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 3.971e-106
Identity = 278/910 (30.55%), Postives = 450/910 (49.45%), Query Frame = 1
Query:   52 AIVLLFQILYVYSIFFNAFDGVQ---KFTIEENQPIKTFVGRIKFAKQIDEELSYSF-----GLITDI----------FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPE-----FTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAF------NLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMS-------ANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYIL-----LPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHET--QALRLEK--DQMSTDI------LLIYKLYTVHSLDRETIPDG--IIYTNFICYD---------------------SGIK-RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ-FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVH-------DRKSGSTQ-LTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMD---------HLYQPLTVNKT--GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIF-------LYEKDETTLIN----SLFNNTYTEHSNVDY---VVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL---ENSASENLQQSIFD------------------------IDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTI 2370
             I+ LF  +++ S+  +  + +Q    +TI EN+P    VG +    +  + L++S      G   D+            +D  +  + T   +D E LC   C     A +S+ VNV +++ L + + + I ++D+DDN  EF  PE     F + +KEVI+RK   I LP AVDKD++ K   I YR+    S +       +   N   P L L  D+DYE  K+Y F+L A   + +S S       A + + +QV+NIND  P F ++IY   V EDI    +II++ A+D D D  L Y +     +  T  F +  DG++ L +  DFE+   ++  I+A+DG+F A ++L I +LD+NDE P++I+NP  L ++E     +L+GQ+ V D D+ ++N  ++C E   +   Q LR E+  + M + +       L + LYT HSLDRE   DG  +     IC+D                     SG +  +L + +++ ++V D NDNAP+F  S +   +KEN+DI  ++ Q  + D D  +NA+  Y +   + D+ LF ++  TG L  M   DRE ++ Y L +V  D + +       D +S ST  +T+ ++D ND+AP ++E  +  + EN   G  +G ++A D D G N  + F ++ D          L Q +    T  GS+FS + FDRE +S+ C Q+Q  D++    L+S   VCVNILD NDN P I         YE+D  +L+     S   +  T+ S   Y    +++S+ E  G+   +++A D D    ++L Y L    N    ++ +S FD                        ID+++GK+ + R L    +G   + ++VED GHP LKS + +
Sbjct:    3 GILFLFSAIFLLSL--SKCEQLQFHLHYTIRENEPSGYRVGYLDDDLRRQQVLNFSRLCGGGGACKDLRFRLREPSFHLELDETTAMLTTKSTVDFEQLCIGQCRSTLDAYLSVTVNVWQERKLTAFIHVRIQVIDVDDNSVEF--PEDIPRPFVLCLKEVIYRKGKTIELPRAVDKDVTPKYSSITYRLEFATSQWASMKMVEMSVTNDSRPLLVLKEDLDYEDAKEYAFSLVACNSDLQSDSSKTVIQEAQLPIVIQVLNINDMEPVFPQSIYSVEVPEDIQPGMVIIELKAIDRDADAVLTYSINSAPGMNATAPFDVEPDGKVRLRESFDFEQRTDYNLPIRASDGDFTASTRLHIRLLDINDEAPTFIVNPTHLAVEENQPPNVLIGQVVVRDADTFAVNGYLECAEPAEDAGQQPLRFERRAEPMRSPLESTAVPELHFDLYTRHSLDRE---DGAPVRLARLICWDGGGGGSGAEMTETTYGDSSTASGNQMARLTSTLTMSIHVQDRNDNAPIFTQSAFSAELKENSDIRKEILQLTSKDYDTEENAITRYRLTDENEDASLFYLNEETGRLYAMTRFDRETRDIYHLQVVVYDASQNPLEILGVDHQSVSTAVVTVRIIDVNDHAPLIQETGELILPENKEPGFMVGQVMATDLDAGVNGEVTFDIAPDDPRVVFNGPQLKQVMGFRMTPNGSIFSTRQFDRETQSRYCFQVQAKDNSPDASLSSTARVCVNILDVNDNSPIIHSIEGPDARYERD--SLLQKPPFSAVESFETQFSLASYELPSLRISVNEAPGYCALLIQAADLDEGENAELRYSLNLAANCTPPSVPRSRFDHNLDDEGEETDETEFRRFPLHTFRIDERTGKLLLVRRLSSKELGSYCLGLVVEDQGHPPLKSTQKV 903          
BLAST of Protocadherin gamma vs. TrEMBL
Match: A0A158R8H8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5493 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 8.108e-106
Identity = 279/915 (30.49%), Postives = 455/915 (49.73%), Query Frame = 1
Query:   61 LLFQILYVYSIFFNAFDGVQ---KFTIEENQPIKTFVGRIKFAKQIDEELSYS-----FGLITDI----------FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPE-----FTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAF------NLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMS-------ANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYIL-----LPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHET--QALRLEKD----QMSTDILLI----YKLYTVHSLDRETIPDG--IIYTNFICYD----------------------SGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ-FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVH-------DRKSGSTQ-LTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMD---------HLYQPLTVNKT--GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIF-------LYEKDETTLIN----SLFNNTYTEHSNVDY---VVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSA------------SENLQQS---------------IFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIP 2394
            LLF    V+ +  +  + +Q    +T+ EN+P    VG +    +  + L++S      G   D+            +D  +  + T   ID E LC   C     A +S+ VNV +++ L + + + + ++D+DDN  EF  PE     F + +KEVI+RK   I LP AVDKD++ K   I YR+    S +       L   N   P L L  D+DYE  K+Y F+L A   + +S S       A + + +QV+NIND  P F +++Y   V ED+    +II++ A+D D D  L Y +     + ++  F++  DG++ L +  DFE+   ++  I+A+DG+F A ++L I +LD+NDE P++I+NP  L ++E     +LVGQ+ V D D+ ++N  ++C E   +   Q LR E+     Q S +   +    + LYT +SLDRE   DG  +     +C+D                      +G   +L + +++ + V D NDNAP+F  S +   +KEN+DI  ++ Q  + D D  +NA+  Y +   + D+ LF ++  TG L  M   DRE ++ Y L +VA D + +       D +S ST  +T+ ++D ND+AP ++E  +  + EN   G  +G ++A D D G N  + F ++ D          L Q +    T  GS+FS + FDRE +S+ C Q+Q  D +  + L+S   VCVNILD NDN P I         YE+D  +L+     S   +  T++S   Y    +++S+ E  G+   +++ATD D    ++L Y L  +A            + NL+                  F ID+++GK+ + R L  + +G   + ++VED GHP LKS + I + I D+P
Sbjct:    4 LLFLFPTVFLLPLSKCEQLQFQLHYTVRENEPSGHRVGYLDDDLRRQQALNFSRLCGGGGGCKDLRFRLREPSFHLELDETTAMLTTKSTIDFEQLCIGQCRSTLDAYLSVTVNVWQERKLTAFIHVRVQVIDVDDNSVEF--PEDIPRPFVLCLKEVIYRKGKTIELPRAVDKDVTPKYSSITYRLEFATSQWVSMKMVELSVTNDSRPLLVLKEDLDYEDVKEYGFSLVACNPDLQSDSSKTVAQEAQLPIVIQVLNINDMEPVFPQSVYSVEVPEDVQPGMVIIELKAIDRDADAVLTYSINSAPGMNLSTPFEVEPDGKVRLRESFDFEQRTDYNLPIRASDGDFAASTRLHIRLLDINDEAPTFIVNPTSLTVEENQPPNVLVGQVVVRDADTFAVNGYLECAEPPEDAGRQPLRFEQRTESLQSSLESTAVPELHFDLYTRYSLDRE---DGAPVRLARLVCWDGGGGGSGAEGEEVPYSDVSTATAGRSVRLTSTLTMSVYVQDRNDNAPVFTQSTFSAELKENSDIRKEILQLTSKDYDTEENAITRYRLTDENEDASLFYLNEETGRLYAMTRFDRETRDIYHLQVVAYDASQNPLEIPGADHQSVSTAVVTVRIIDVNDHAPIIQETGELILPENKESGFLVGQVVATDLDAGVNGEVTFDIAPDDPRAVFNGPQLKQVMGFRMTPNGSIFSTRQFDREAQSRYCFQVQAKDKSPESSLSSTARVCVNILDVNDNSPIIHSIEGPDARYERD--SLVQKPPFSSMESFETQYSLASYELPSLRISMNEAPGYCALLIQATDLDEGENAELRYSLNLAANCTPPSMPTSRFAHNLEDEREENGETEFRRFPLHTFRIDERTGKLLLVRRLSNNELGSYCLGLVVEDQGHPPLKSTQLIELVIEDVP 911          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 238.81 bits (608), Expect = 1.330e-64
Identity = 239/796 (30.03%), Postives = 366/796 (45.98%), Query Frame = 1
Query:   61 LLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADK-ESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA---FNLEEHNSRG---PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILL----PMTNYFQI-NNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI-QFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            LLF +L V SI  N+  G   + + E QP  T +G +   + + D    Y   +      +D K+G+I T ++ ID E L    C  K +   +   V+V    Q     +++  I + DI+DN P+F  P  T+ ++E  H       +P A D+D + +N  + Y +S    A   F+L+  N RG   P+L +L ++D E +  Y  T++A      S  ++  + + + + ND AP+F K+ YE  V E+  +   +++V A D+D G N  + Y +     P+    QI  + G + +   LD E+  SF F + A D     +S    + I V D ND  P+  +    L         I E    G  V  + V D+D    N  + C         LR   D  S D    Y L T   LD E I D       +  DSG      TN S+ + V D NDN+P+F    ++V   E N  G ++    A D D G NA + Y+I   S   GLF ID  +G ++   PLDRE K +Y   + A D+ V   + G+  + I VLD NDN P+  L  Y+ FS+LEN+P    +G +   D D+GENA++   +  D +   +  N TG++ S+  FDREK+S    +++  D       +S+V V +N+LDENDN P +       T   NS F              ++S       V+ VV+A D D  + ++L Y +       L    F I    G+I + + L R   GL ++ V V D G PS
Sbjct:    9 LLFALL-VDSI--NSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETL--KDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAH-MGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGE-NAVVTCVVAGDVPFQLRPAGDS-SVDNKKKYFLQTTTPLDYERIRD--YRVEIVAVDSGNPALSSTN-SLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHR-GTATVVIKVLDRNDNDPKFMLSSYS-FSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPD-VGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNAPVV-------TKPSNSSFR-------------RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHEL----FYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 764          

HSP 2 Score: 137.887 bits (346), Expect = 1.519e-32
Identity = 137/483 (28.36%), Postives = 225/483 (46.58%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-------LREYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQ--PL---TVNKTGSLF--SNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P +      L + E    G         DRD+     G+   + +   +A  L   QM+ D    + +L  + +LDRE      +  N +  D G   + Y++  + + + D NDNAP F  S Y+  V EN+ +GY + Q +A D D+G N  I Y I  + D    +  I+  TG + +  PLDRE+ + +   ++A D+     KS +T ++I V D NDNAP        LR ++D   +I E++P+G  +  +   DKDEGENA +   ++ D  +Q  P    +V+     F  +    D E+      +I   DS  GN  L+S  S+ V + D NDN P               +F+    E   V++  +    EKV  VIA+    D D    ++L Y +    +++  + +F+ID  SG++    PL R+     + +V   D G PS +   T+++++LD
Sbjct:  118 RIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTE--RNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAV--DGGTPSR-YSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKG-PSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDS--GNPALSSTNSLRVQVTDTNDNSP---------------IFSPPLFE---VEFAEENQPGEKVLDVIAL----DADSGTNAELVYSI---IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLD 567          

HSP 3 Score: 110.153 bits (274), Expect = 6.180e-24
Identity = 110/399 (27.57%), Postives = 185/399 (46.37%), Query Frame = 1
Query: 1252 LDRETIPDGIIYTN--FICYDSG----IKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD-SGLFVID------SRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQ---SIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +DRET+ D  I     F+ ++      I+ Q    I   + V DINDN P FPS    + V+EN  +G      QATD D  +N ++ Y++    + S LF +        +   L ++  LDRE K+ Y LTI A+D     R S S  L + + D NDNAP+  + + +  + EN P+G+ +  + A D D G N  I + +  + D + + L + + TG +      DRE+ S     +   D    +  +S   V + + D+NDN P +          I  +   T++     D V  +S    VG  +A+V+ +D D    + ++  +       L+    S  D +KK   +    PL  + I   +V+++  DSG+P+L S  ++ V++ D
Sbjct:   80 IDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYS-SALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAV---------EIRGIGLRTHS-----DGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVD-NKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTD 461          

HSP 4 Score: 83.5741 bits (205), Expect = 9.328e-16
Identity = 107/390 (27.44%), Postives = 171/390 (43.85%), Query Frame = 1
Query:  547 RMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP---MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAE---SKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD------QMSTDILLIYKLYTVHSLDRETIPDGIIYT-NFICYDSG-IKRQLYTNISIPLNVHDINDNAPLFP----SSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKS 1650
            R +GD S  N +++      L+    +DYE+ + YR  + A    + ++S+  ++ +QV + ND +P FS  ++E    E+    E ++ V A+DAD G N  L Y ++        F+I+ + GE+     LD E  + + F + A D    +    + + I VLD ND  P ++L+     + E       VG +TV D D     +G      N + Q L +E D      Q  T  +L     +  S DRE       YT      D G   R  Y  ++I  NV D NDNAP+      SS  ++      D   ++ +A+  D D G NA + Y+I       LF I    G +KL + L R+    + L +   D+    R +
Sbjct:  406 RPAGDSSVDNKKKY-----FLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMD-----KG-----ENAQVQ-LSVEPDVGNFVVQNGTGTIL-----SSISFDREKESS---YTFRLKAVDGGEPPRSSYVGVTI--NVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAE--DIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHA 767          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 239.965 bits (611), Expect = 2.223e-64
Identity = 239/796 (30.03%), Postives = 366/796 (45.98%), Query Frame = 1
Query:   61 LLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEALCFNSCADK-ESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA---FNLEEHNSRG---PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILL----PMTNYFQI-NNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI-QFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            LLF +L V SI  N+  G   + + E QP  T +G +   + + D    Y   +      +D K+G+I T ++ ID E L    C  K +   +   V+V    Q     +++  I + DI+DN P+F  P  T+ ++E  H       +P A D+D + +N  + Y +S    A   F+L+  N RG   P+L +L ++D E +  Y  T++A      S  ++  + + + + ND AP+F K+ YE  V E+  +   +++V A D+D G N  + Y +     P+    QI  + G + +   LD E+  SF F + A D     +S    + I V D ND  P+  +    L         I E    G  V  + V D+D    N  + C         LR   D  S D    Y L T   LD E I D       +  DSG      TN S+ + V D NDN+P+F    ++V   E N  G ++    A D D G NA + Y+I   S   GLF ID  +G ++   PLDRE K +Y   + A D+ V   + G+  + I VLD NDN P+  L  Y+ FS+LEN+P    +G +   D D+GENA++   +  D +   +  N TG++ S+  FDREK+S    +++  D       +S+V V +N+LDENDN P +       T   NS F              ++S       V+ VV+A D D  + ++L Y +       L    F I    G+I + + L R   GL ++ V V D G PS
Sbjct:   45 LLFALL-VDSI--NSALGGILYHVREEQPPNTLIGSLAADQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETL--KDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAH-MGATFAIPQATDRD-TERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDE-GENAVVTCVVAGDVPFQLRPAGDS-SVDNKKKYFLQTTTPLDYERIRD--YRVEIVAVDSGNPALSSTN-SLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHR-GTATVVIKVLDRNDNDPKFMLSSYS-FSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPD-VGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNAPVV-------TKPSNSSFR-------------RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHEL----FYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPS 800          

HSP 2 Score: 138.272 bits (347), Expect = 1.743e-32
Identity = 137/483 (28.36%), Postives = 225/483 (46.58%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-------LREYTD--FSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQ--PL---TVNKTGSLF--SNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P +      L + E    G         DRD+     G+   + +   +A  L   QM+ D    + +L  + +LDRE      +  N +  D G   + Y++  + + + D NDNAP F  S Y+  V EN+ +GY + Q +A D D+G N  I Y I  + D    +  I+  TG + +  PLDRE+ + +   ++A D+     KS +T ++I V D NDNAP        LR ++D   +I E++P+G  +  +   DKDEGENA +   ++ D  +Q  P    +V+     F  +    D E+      +I   DS  GN  L+S  S+ V + D NDN P               +F+    E   V++  +    EKV  VIA+    D D    ++L Y +    +++  + +F+ID  SG++    PL R+     + +V   D G PS +   T+++++LD
Sbjct:  154 RIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTE--RNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAV--DGGTPSR-YSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSP-KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDS--GNPALSSTNSLRVQVTDTNDNSP---------------IFSPPLFE---VEFAEENQPGEKVLDVIAL----DADSGTNAELVYSI---IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLD 603          

HSP 3 Score: 110.153 bits (274), Expect = 6.827e-24
Identity = 110/399 (27.57%), Postives = 185/399 (46.37%), Query Frame = 1
Query: 1252 LDRETIPDGIIYTN--FICYDSG----IKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD-SGLFVI------DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQ---SIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +DRET+ D  I     F+ ++      I+ Q    I   + V DINDN P FPS    + V+EN  +G      QATD D  +N ++ Y++    + S LF +        +   L ++  LDRE K+ Y LTI A+D     R S S  L + + D NDNAP+  + + +  + EN P+G+ +  + A D D G N  I + +  + D + + L + + TG +      DRE+ S     +   D    +  +S   V + + D+NDN P +          I  +   T++     D V  +S    VG  +A+V+ +D D    + ++  +       L+    S  D +KK   +    PL  + I   +V+++  DSG+P+L S  ++ V++ D
Sbjct:  116 IDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYS-SALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGP-SPKSSTTYVSIEVTDQNDNAPAVE---------IRGIGLRTHS-----DGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVD-NKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTD 497          

HSP 4 Score: 83.9593 bits (206), Expect = 6.811e-16
Identity = 107/390 (27.44%), Postives = 171/390 (43.85%), Query Frame = 1
Query:  547 RMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP---MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAE---SKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD------QMSTDILLIYKLYTVHSLDRETIPDGIIYT-NFICYDSG-IKRQLYTNISIPLNVHDINDNAPLFP----SSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKS 1650
            R +GD S  N +++      L+    +DYE+ + YR  + A    + ++S+  ++ +QV + ND +P FS  ++E    E+    E ++ V A+DAD G N  L Y ++        F+I+ + GE+     LD E  + + F + A D    +    + + I VLD ND  P ++L+     + E       VG +TV D D     +G      N + Q L +E D      Q  T  +L     +  S DRE       YT      D G   R  Y  ++I  NV D NDNAP+      SS  ++      D   ++ +A+  D D G NA + Y+I       LF I    G +KL + L R+    + L +   D+    R +
Sbjct:  442 RPAGDSSVDNKKKY-----FLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMD-----KG-----ENAQVQ-LSVEPDVGNFVVQNGTGTIL-----SSISFDREKESS---YTFRLKAVDGGEPPRSSYVGVTI--NVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAE--DIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHA 803          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 214.927 bits (546), Expect = 1.480e-56
Identity = 221/782 (28.26%), Postives = 362/782 (46.29%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGR------------IKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLK-VIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLE----EHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRY------ILLPMTN-YFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFV-AESKLKITVLDVNDEPPS----YILNP--EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEK---DQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            +T++E QP    +G             IK +  +  +  Y  G +  +  ++  +G+I T    ID E LC +   +++     + V V   + +  ++KI  +I DI+DN P F+     + I E     N    +P+A D D+ +   +  Y +    S F L+        + P+L +  ++D E +  +   +      +   S+   + + V ++ND  P F  +  E +V E+  +   + +++A DAD G N +        + P T  +F I++  G + + Q LD E +      + A+DG    + + + + V DVND  PS    YI+NP    +++ E       +  ITV DRD+  +N  + C  T+H+    RL+    DQ        + L T   LD ET  +  I    +  DSG K  L T+  + + + D NDNAP+FP  + Q+ + ENND G QL +  ATD D G NALI Y++      G F ID R+G L + + LDREK+ +Y  T++A D   +  +S  T + + V D NDN+P     EY +F + ENLP+   +G +   D D G+NA +   +     + +  P    KTG +  N  FDRE++S     ++  DS +    TS+  V +N++D NDN P +F+                    SN  Y + +      G V+  V A DND    ++L Y +   +   L    F IDK +G IT+   +     GL ++ V V+D G P
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVP-LVRVEASTGEIFTTANRIDRERLC-SGVFNEKRCFYEIEVAVLPDE-IFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRY-PVPSAFDPDVGINGIQ-HYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA-DLNGKVTCY-TDHDV-PFRLKPVFNDQ--------FLLETAAPLDYETTREYAI--KIVASDSG-KPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDG-FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVT-VKLIVQDQNDNSPAFTHAEY-NFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDP----KTGVIKPNITFDREQQSSYTFVVKAVDSGLIQT-TSYAKVTINVVDVNDNRP-VFVIPS-----------------SNYSYDL-VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGL----FAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          

HSP 2 Score: 91.6633 bits (226), Expect = 3.244e-18
Identity = 147/580 (25.34%), Postives = 239/580 (41.21%), Query Frame = 1
Query:  727 NINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQIN------NDGELHLI--QKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQY-------QVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN---KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +IND AP F  T+   S+ E+ +++      +A D D G N    Y L+   + F ++       D    LI  Q LD E   +F   I+  DG    +S    L++TV DVND  P +  +  ++ + E    G  V Q+   D D  S N  I  + +N  + A +      S+  L+  K      LDRE+ P   ++   +    G      +  ++ +NV D+NDN P    ++Y        V + EN  +  ++     TD D   N  +T      V   L  + +    L+   PLD E   +Y + IVA D       + S  + I + D+NDNAP   +     SI EN   G  +  + A D D G NA I++ L  D    P   N   ++G L  ++  DREK+ K    +   D+   N L S+V+V + + D+NDN P                       H+  ++ V  ++   +   + ++  TD D  + + ++  + N          F ID K+G I  N    R+        V   DSG     S   + + ++D+
Sbjct:  171 DINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGS-NAQIHFSFSNQISPATKRHFAIDSSTGLITVK----QPLDRESNP---VHKLIVLASDG--SATPSRATVIVNVTDVNDNVPSI-DTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNT-SAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD---APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNG-SNPLQSNVTVKLIVQDQNDNSPAF--------------------THAEYNFYVPENL--PLYGTVGLITVTDADAGDNAIVTLSIINGKDN------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDV 706          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 215.312 bits (547), Expect = 1.566e-56
Identity = 221/781 (28.30%), Postives = 362/781 (46.35%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGR------------IKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLK-VIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLE----EHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRY------ILLPMTN-YFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFV-AESKLKITVLDVNDEPPS----YILNP--EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEK---DQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP 2346
            +T++E QP    +G             IK +  +  +  Y  G +  +  ++  +G+I T    ID E LC +   +++     + V V   + +  ++KI  +I DI+DN P F+     + I E     N    +P+A D D+ +   +  Y +    S F L+        + P+L +  ++D E +  +   +      +   S+   + + V ++ND  P F  +  E +V E+  +   + +++A DAD G N +        + P T  +F I++  G + + Q LD E +      + A+DG    + + + + V DVND  PS    YI+NP    +++ E       +  ITV DRD+  +N  + C  T+H+    RL+    DQ        + L T   LD ET  +  I    +  DSG K  L T+  + + + D NDNAP+FP  + Q+ + ENND G QL +  ATD D G NALI Y++      G F ID R+G L + + LDREK+ +Y  T++A D   +  +S  T + + V D NDN+P     EY +F + ENLP+   +G +   D D G+NA +   +    D+    +   KTG +  N  FDRE++S     ++  DS +    TS+  V +N++D NDN P +F+                    SN  Y + +      G V+  V A DND    ++L Y +   +   L    F IDK +G IT+   +     GL ++ V V+D G P
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVP-LVRVEASTGEIFTTANRIDRERLC-SGVFNEKRCFYEIEVAVLPDE-IFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRY-PVPSAFDPDVGINGIQ-HYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDA-DLNGKVTCY-TDHDV-PFRLKPVFNDQ--------FLLETAAPLDYETTREYAI--KIVASDSG-KPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDG-FNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVT-VKLIVQDQNDNSPAFTHAEY-NFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNF---IIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQT-TSYAKVTINVVDVNDNRP-VFVIPS-----------------SNYSYDL-VPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGL----FAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQP 799          

HSP 2 Score: 92.0485 bits (227), Expect = 2.469e-18
Identity = 146/580 (25.17%), Postives = 239/580 (41.21%), Query Frame = 1
Query:  727 NINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQIN------NDGELHLI--QKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQY-------QVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN---KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +IND AP F  T+   S+ E+ +++      +A D D G N    Y L+   + F ++       D    LI  Q LD E   +F   I+  DG    +S    L++TV DVND  P +  +  ++ + E    G  V Q+   D D +  N  I  + +N  + A +      S+  L+  K      LDRE+ P   ++   +    G      +  ++ +NV D+NDN P    ++Y        V + EN  +  ++     TD D   N  +T      V   L  + +    L+   PLD E   +Y + IVA D       + S  + I + D+NDNAP   +     SI EN   G  +  + A D D G NA I++ L  D    P   N   ++G L  ++  DREK+ K    +   D+   N L S+V+V + + D+NDN P                       H+  ++ V  ++   +   + ++  TD D  + + ++  + N          F ID K+G I  N    R+        V   DSG     S   + + ++D+
Sbjct:  171 DINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDAD-LGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVK----QPLDRESNP---VHKLIVLASDG--SATPSRATVIVNVTDVNDNVPSI-DTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNT-SAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD---APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNG-SNPLQSNVTVKLIVQDQNDNSPAF--------------------THAEYNFYVPENL--PLYGTVGLITVTDADAGDNAIVTLSIINGKDN------FIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDV 706          
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 211.846 bits (538), Expect = 1.027e-55
Identity = 221/788 (28.05%), Postives = 354/788 (44.92%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVN--RQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVD----ADGDNLRYILLPMTNYFQI----NNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI-QFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEIL 2385
            + + E QP  T VG +   + + D    Y   +      +D K+GDI+T  V ID E L  C N   + +   +   V++    + +   +++  I I D +DN P+F  P   + I E  +       +P A+DKD +  N    Y+++    A NL      +  + + P+L +L ++D E++  Y  ++           ++  + + + + ND  P+F ++ YE  + E+  + + +++V A D    A+G        P  N  ++    +N G + +   +D E+     F++QA D    A+S    + ITV D ND  PS  +    LV        + E    G  V  + V D+D    N  + C         LR      ST     Y L T   LD E I +  I    +  DSG      TN S+ + V D+NDNAP+F  S Y+V   E N  G ++    ATD D G NA + Y+I   S   GLF I+  TG +++M  LDRE K +Y   + A D+ V   K G+  + + VLD NDN P+  L  Y+ FS+LEN+P    +G +   D D+GENA +   +  ++  + +  N TG++ S+  FDREK+S    +++  D       +S+V + +N+LDENDN P +                   T+ SN  Y     +       +  V A D D    ++L Y +       L    F I    G+IT+ +   R   GL ++ V V D G PS  +  T +V I 
Sbjct:   37 YQLREEQPPNTLVGSLAADQGLPDTGHLYKLEVGGPYLRVDGKTGDIYTTDVPIDRETLKDCRN-LFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTY-VGAHYSIPVAMDKD-AGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGE-NAVVTCVVAGDVPFQLRSASASDSTSKRK-YFLQTTTPLDYERIKEYRI--EIVAVDSGNPALSSTN-SLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLK-GTATVVVRVLDRNDNDPKFMLNGYS-FSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPEN-GKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGG-DPPRSSYVGITINVLDENDNAPYV-------------------TKPSNSSYKFLQPLTSP-DTRVEKVDAEDIDTGLNAELVYSITGGNPHGL----FRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHT--TALVHIF 786          

HSP 2 Score: 123.635 bits (309), Expect = 4.204e-28
Identity = 143/516 (27.71%), Postives = 230/516 (44.57%), Query Frame = 1
Query:  928 FEKHQSF-SFTIQATD-----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDI-LLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI-QFSVD-SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---------EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVF-------DREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIF---LYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            FE    F  F +  TD     G  + E +++I   D ND  P +     +L I E    G         D+D+ S   GI   + N  + A+ L   Q++ +    + +L  + +LDRE       Y   I    G     Y++  + + + D NDN P F  S Y+  + EN  +G  + Q +A D+D+G N  +TY+  Q S +   L  ID  TG +++   +DRE+      ++ A D      KS    +TITV D NDNAP +R         E    ++ E++P+G  +  +   DKDEGENA +   ++ D  +Q  + + + S    + F       D E+  +   +I   DS  GN  L+S  S+ V + D NDN P +F   LYE                    VD+  +    +KV  V+A    TD D    ++L Y +    +++  + +FDI+  +G++ +   L R+     +  V   D G PSLK   T++V +LD
Sbjct:  102 FEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQ--DENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGS--NGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRD---TYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQ-AKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDS--GNPALSSTNSLKVQVTDMNDNAP-VFSPSLYE--------------------VDFAEENQPGDKVLDVVA----TDADSGTNAELLYSI---ITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLD 579          

HSP 3 Score: 101.293 bits (251), Expect = 3.360e-21
Identity = 91/368 (24.73%), Postives = 160/368 (43.48%), Query Frame = 1
Query: 1351 LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVI------DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFK-----------LSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFD--IDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + + D NDN P FPS   ++ + EN  +G       A D+D G N +  Y +    D+  LF +      D +   L ++  LDRE+++ Y L+I  ID     R S S  L IT+ D NDN P+  R + +  + EN P+G  +  + A D D G N ++ +            L +DH         TG +      DRE+   +   +Q  D+      +S   V + + D NDN P I +                +   ++ D +  +S    VG  +A+V+ +D D    + ++  +       L+ +       K+   +    PL  + I   +++++  DSG+P+L S  ++ V++ D+
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYS-SALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDH--------NTGIIQVKGSVDREEVPLLKFSVQARDNGP-QAKSSKAMVTITVKDRNDNAPSIRI--------------RGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDM 474          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 183.726 bits (465), Expect = 1.279e-47
Identity = 199/744 (26.75%), Postives = 323/744 (43.41%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTL-KVIDLEALCFNS-CADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDI---SMKNKEIAYRMSGDHSAFNLE----EHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYI------------LLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD------------GEFVAESKLKITVLDVNDEPPSYILNPEKLVI--DETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSG 2340
            +  ++P++G++    + +D EALC      D+    + + V   +      ++++ I + DI+DN P F  P  T+ + E           PA  D D     ++  E+        SAF L      +  + P L +   +D E+++ Y   L A        S +  + + V + ND +P F +      + E+  +   +++++A D D G N   +                   F+++ N G + +   L+ E+   +   I ATD               V +       +++ D     I+ P   VI   E +   + V  ITV D D +  N  + C   N E    +L+K          Y L T  +LD ET  + ++       D+G    L   +S+ + + D NDNAP+F    Y+V V ENN IG  L    ATD D+ KNA + Y +     + +F +D  TG + L + LDREKK  Y  TI+A DQ +     G+  + + VLD NDN P   L E+ DF + EN+P    +G +   D DEGEN R+   +      Q  +++ ++G + SN  FDRE++     ++Q +D     V +S V V ++++D NDN P + +             N TY       +VV    R   G ++  V A DND    ++L Y++      NL    F ID   G IT+  PL     GL ++ V V D G
Sbjct:   85 LVRVNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPAN-DPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD-----IVAPVNGVIYISEASHVNLPVALITVSDPD-IGANGAVTCYIYNPEV-PFQLKKLTYPNQ----YLLETRETLDYETKNEYVVQIK--AADAG-ATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPT-MFHMDPETGIISLTEQLDREKKANYSFTILAKDQGI-PVLEGNATVIVNVLDVNDNRPRFSLAEF-DFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGG-EPVRSSTVKVVIHVMDINDNSPIVLMPPS----------NTTY------KFVVP---RTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNL----FHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 94.3597 bits (233), Expect = 7.870e-20
Identity = 121/497 (24.35%), Postives = 213/497 (42.86%), Query Frame = 1
Query:  973 GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVS--INRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG--------LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELRE---------YTDFSILENLPIGHYIGTLIAFDKDEGENARI---MFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            G F    +++I V D+ND  P++      + + E   +G         D DS +  + R            A  L   + +    + Y L    SLDRE     +   N    D G      + + + +NV D NDN+P+F  ++  V + EN+ +G  + Q  A+D D G NA + Y +  S            LF +D  +G + +   L+RE+   Y + I+A D+   +    +  +T+TV D NDN+P  E+R+         Y   +   NLP+      +   D D G N  +   ++   +    + LT      L + +  D E K++   QI+ +D+     L+  +SV + +LD NDN P                    +TE +   Y V +     +G  +  V ATD D++  +++ Y+L   A      ++F +D ++G I++   L R+        ++ +D G P L+   T++V +LD+
Sbjct:  131 GPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPY-LVVRKSLDREE--RQLYEMNLRAVDGGSPPHSGSAV-LRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKG-PEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVA----LITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAG-ATSLSRTMSVTIKLLDSNDNAP-------------------VFTEPT---YKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAP-----TMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDV 590          

HSP 3 Score: 92.8189 bits (229), Expect = 2.685e-19
Identity = 94/314 (29.94%), Postives = 139/314 (44.27%), Query Frame = 1
Query: 1462 TDEDIGKNALIT---YNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +D DIG N  +T   YN +           ++   L+  + LD E KN+Y++ I A D       S +  +TI +LD NDNAP   E T   S+ EN  IG ++ T+ A D+D  +NA +++ L  D         +TG +   +  DREKK+     I   D  I  VL  + +V VN+LD NDN P+  L E D         N    +HS V  V               V  +D   N   +LS       ++N Q  +F ID +SG I  N    R+      ++V   D G P   S   +++ ++DI
Sbjct:  411 SDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQY-LLETRETLDYETKNEYVVQIKAADAGA-TSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGI-PVLEGNATVIVNVLDVNDNRPRFSLAEFD------FYVNENVPKHSTVGMVT--------------VADSDEGENGRVRLSIL----GTDNRQ--LFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDI 695          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009557.1 (pep scaffold:Pmarinus_7.0:GL476748:59426:101420:1 gene:ENSPMAG00000008644.1 transcript:ENSPMAT00000009557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.785 bits (434), Expect = 2.437e-43
Identity = 155/591 (26.23%), Postives = 260/591 (43.99%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-----------DHSAFNLEEHNSRGPRLRLLIDI-----DYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEF-SKTIYEESVYEDISLD-EIIIKVNAVDAD-GDNLR-----------------------------------YILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKL---VIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL 1821
            D+FS+D +SG + TL+ +D EA      A  E A ++   ++     L +   + + + D +D  P F +  +  ++ E       V+ +  A D D +  N ++ Y ++G            H    L E  +    + LL  +     + E   Q+   +S     +  +     V ++V + ND AP+F  K +  +++  + S+  E + +V A DAD G N                                     ++ +P   Y  +  + +LHL Q +D E+   +   + ATDG FV+++ + + VLD ND  P  + +   L    + E    GI +  ++  D D +  N  I+ T      +  R++            +L+T+  LDRE +P    Y   +    G  R     I + L   D+NDNAP FP+S Y V V E+  +   L + QATD D+G N  +TY+   S   G F ID R+G + L +PLDRE +  Y LT+ A D  V    + +  +++ VLD NDN P  E REY   +  +  P G  + +++A  KD G NA + + +
Sbjct: 1324 DLFSVDAESGWVRTLRPLDREAR-----AGHELAVVA--TDLGDPARLSATASVRVAVADANDCPPRFLRGSYAGDVPE-DSAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVG-EWKLHLKQPVDREERDRYQIEVTATDGAFVSKAVVDVAVLDANDNSP--VCDKGLLYAVAVAEDVAPGIFLLLVSARDAD-IGANAAIQYTLHGPGAEHFRMDS--------ATGELFTLAPLDREAVP---AYALSVRATDGGGRSCQAEILVSL--EDVNDNAPQFPASHYAVSVYESTAVETLLTRVQATDSDLGLNRKVTYSFLDSA-GGHFAIDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRPLTSTVGVSVAVLDVNDNPPAFEQREYHAAAPEDAAP-GSAVLSVLAISKDAGANAEVTYSV 1887          

HSP 2 Score: 155.606 bits (392), Expect = 1.811e-38
Identity = 164/666 (24.62%), Postives = 284/666 (42.64%), Query Frame = 1
Query:  604 RLRLLIDIDYEKQKQYRFTLSAYQKNDE-SMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD---NLRYILLPMT--------NYFQINND-GELHLIQKLDFEKHQSFSFTIQATD----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD-----------QMSTDILLIYKLYTVHSLDRETIPDGIIYTNFIC-YDSGI------KRQLYTNISIPLNVHDINDNAPLFPSSQYQVGV--KENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTG----------------------------W-LKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL--ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSG--HPSLKSAKTIMVEILDI 2391
            RL++   +D+E  + YRF + A  + DE  + A + VT+ V ++ND  P F  ++YE  V E++     +++V A D DG     L Y L            + F ++ + G +  ++ LD E        + ATD        A + +++ V D ND PP ++       + E +  G +V  +   D D+   N  +    T + T A R+  +           + S  + +  +L T+       +P  +  T   C ++ G+      +  L T   + + V D NDNAP F   + QV    +E +     + +  A D D G NA ++Y+I    ++G F ID + G                            W L L QP+DRE++++Y + + A D A   +      + + VLD NDN+P   +   +++   E++  G ++  + A D D G NA I + L           + TG LF+    DRE        ++ +D   G   +    + V++ D NDN PQ               F  ++       Y V +     V  ++  V+ATD+D+    +++Y   +SA  +     F ID++SG I++ RPL R+   + ++ V  ED     P L S   + V +LD+
Sbjct: 1222 RLKVAKALDHETVRSYRFGVKATFRRDEVDVVAQVLVTVHVGDVNDNRPVFESSVYEGVVMENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDAESGWVRTLRPLDREARAGHELAVVATDLGDPARLSATASVRVAVADANDCPPRFLRGSYAGDVPEDSAPGQVVAVVGADDADATPDNGQL----TYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTI-------LPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGAFVSK----AVVDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLLVSARDADIGANAAIQYTLHGPGAEHFRMDSATGELFTLAPLDREAVPAYALSVRATD---GGGRSCQAEILVSLEDVNDNAPQ---------------FPASH-------YAVSVYESTAVETLLTRVQATDSDLGLNRKVTYSFLDSAGGH-----FAIDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRP-LTSTVGVSVAVLDV 1841          

HSP 3 Score: 143.665 bits (361), Expect = 1.043e-34
Identity = 188/738 (25.47%), Postives = 305/738 (41.33%), Query Frame = 1
Query:  199 LSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVII-ILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILL---PMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVS--------INRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI--CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVK----VMVEDSG 2340
             S S G + D F+I+ ++GDI       L +               L V V   K + +   +V + + D++DN P F    +   + EV      V+Y  AA D+D+  +N E++Y +  +H  F++E   S    LR     D   +    FT++    +      +  V+L +  IN   P F +  Y +SV E+I     I+ + A   +G  L + +    P  N F I+ N G +++I  LD E   +F  T++ATD   G   AE  L I V DVND PP +  +     + E    GI V Q++  D D  S        IN G   +E  +   +  L    + T   L Y+   VH              NF+    DSG+   L +++ + + V DINDN P+F    Y+  V E    G+ + + QA+D D      + Y+I    D   FV+D ++G + +     +    QY L I   D       + + Q+ + +   N ++P     EY    I EN  +G  +  + A DKD G    + + +         T+++ G +F+++  DRE   +    I +  +  G       +V V   DENDN P         T + N  F N                R + G  I  V ATD D  + + L Y L    S+ ++  + ++   +G +         L+GL+  +    V  ED G
Sbjct:  476 FSISTGNVGDKFAINARTGDISVQNATHLRS------------RYELAVKVFDGKFVSTAQAVVAVRVEDVNDNAPVFVNLPY-YAVVEVDAAPGSVVYTIAAFDRDVG-RNGEVSYSLKEEHEYFDVEAR-SGDVSLRRSFTADMSSKD---FTVNVVATDSGVPPLSSEVSLPITVINKAMPIFERPFYSKSVPENIKPHTPILNLQAKSPEGLPLIFSITDGDPF-NQFSIDFNTGVVNVIGSLDHETQTTFKLTVRATDSVTGSH-AEVNLDILVQDVNDNPPLFSQSAYATTLSEAALIGISVLQVSATDADIGSNKALYYQIINNGKNSSECFYIDSSSGL----ILTSRFLDYEQNQVH--------------NFLVRASDSGMPF-LTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVTRVQASDADASDTDKLEYSILSGNDHMNFVVDGKSGIISISNLRKQTLAPQYRLNISVSDGVF----TSTAQVHVNIQSANLHSPIFGQNEYVK-EIPENSEVGTLLTLVQATDKDWGPLGHVSYSIVNQFAGDRFTIDENGQIFTSEPLDREDPLERVFDINIM-AKDGGGRVGFTTVKVIATDENDNKP---------TFVTNEYFGNVLA-------------RAEKGTAILQVLATDPDEGSNADLVYTLYKGESDAVED-VLEVQPLTGHVVTK----ESLVGLEGSRMSFFVKAEDKG 1141          

HSP 4 Score: 112.079 bits (279), Expect = 4.151e-25
Identity = 157/690 (22.75%), Postives = 288/690 (41.74%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM--SGDHSAFNLEEHNSRGPRL--RLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADG---DNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQ---SFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI---YKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI---QFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIM----FKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQ--QSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS-LKSAKTIMVEILD 2388
            I++ D++DN P F +  +   + E       V+ + +A D DI   NK + Y++  +G +S+      +S G  L  R L   DYE+ + + F + A       +++++ VT+ V +IND  P F++ +YE  V E       + +V A DAD    D L Y +L   ++     DG+  +I   +  K      +   I  +DG F + +++ + +   N   P +  N     I E ++ G L+  +   D+D              H + ++    +Q + D   I    +++T   LDRE   + +   N +  D G  R  +T + +     D NDN P F +++Y   V    + G  + Q  ATD D G NA + Y +   +      +  +   TG +   + L   + ++    + A D+   +RK     ++++VL  +   P   E     ++ E+  +G  IG       D    A +      + + D  +  + +++TG L   +  D E        ++ +       + + V V V++ D NDN P +F     E  ++ +L                       G  +  V+ATD D     QL+Y L   A       + +F +D +SG +   RPL R+     ++ V+  D G P+ L +  ++ V + D
Sbjct:  732 ILVQDVNDNPPLFSQSAYATTLSEAALIGISVLQV-SATDADIG-SNKALYYQIINNGKNSSECFYIDSSSGLILTSRFL---DYEQNQVHNFLVRASDSGMPFLTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVTRVQASDADASDTDKLEYSILSGNDHMNFVVDGKSGIISISNLRKQTLAPQYRLNISVSDGVFTSTAQVHVNIQSANLHSPIFGQNEYVKEIPENSEVGTLLTLVQATDKD---------WGPLGHVSYSI---VNQFAGDRFTIDENGQIFTSEPLDREDPLERVFDINIMAKDGG-GRVGFTTVKVIAT--DENDNKPTFVTNEYFGNVLARAEKGTAILQVLATDPDEGSNADLVYTLYKGESDAVEDVLEVQPLTGHVVTKESLVGLEGSRMSFFVKAEDKG-PERKHSVVPVSVSVLPADAELPAFTEAAYALTVAEDAEVGSEIGVARLAGNDSATYAAVPGGGGAENNADDTF--VVLSQTGRLKVAKALDHETVRSYRFGVKATFRRDEVDVVAQVLVTVHVGDVNDNRP-VFESSVYEGVVMENL---------------------PAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDAESGWVRTLRPLDREARAGHELAVVATDLGDPARLSATASVRVAVAD 1376          

HSP 5 Score: 108.997 bits (271), Expect = 3.482e-24
Identity = 150/669 (22.42%), Postives = 266/669 (39.76%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKT-LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPA----AVDKDISMKNKEIAYRMSGDHSAF-----NLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDES-MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDA----DGDNLRYIL-----------LPMTNYFQINNDGELHLIQKL---------DFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD---------SVSINRGIKCTE-----------TNHETQALRLEKDQMSTDILLI---YKLYTVHSLDRE---------TIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQ-YQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFS-NQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYP 2013
            D F +  ++G +   K +D E +         S    +     R +  +++ + + + + D++DN+P FE       + E +  +N+   +P     A D+D    N ++AY ++ +         +L   ++    +R L  +D E +  +   + A    D + +SA  +V + V + NDC P F +  Y   V ED +  +++  V A DA    D   L Y L           LP      +     + +  +L         + E    F+  +   DG        +++ + V D ND  P ++    ++      +S        V+ RD         S SI+ G +  +           T +       +   +  DI ++   +KL+    +DRE         T  DG   +  +               + + V D NDN+P+      Y V V E+   G  L    A D DIG NA I Y +     +  F +DS TG L  + PLDRE    Y L++ A D      +S   ++ +++ D NDNAP+    +   S+ E+  +   +  + A D D G N ++ +   +D       +++   + S  +  DRE ++     ++  D  +   LTS V V V +LD NDN P
Sbjct: 1212 DTFVVLSQTGRLKVAKALDHETV--------RSYRFGVKATFRRDEVDVVAQVLVTVHVGDVNDNRPVFES-----SVYEGVVMENLPAGVPVVQVRATDRD-GGANGQLAYSLAEEAGGEGGAARDLFSVDAESGWVRTLRPLDREARAGHELAVVATDLGDPARLSATASVRVAVADANDCPPRFLRGSYAGDVPEDSAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGAFVSKAV---------------VDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLLVSARDADIGANAAIQYTLH-GPGAEHFRMDSATGELFTLAPLDREAVPAYALSVRATDGG---GRSCQAEILVSLEDVNDNAPQFPASHYAVSVYESTAVETLLTRVQATDSDLGLNRKVTYSF-LDSAGGHFAIDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRPLTSTVGVSVAVLDVNDNPP 1846          

HSP 6 Score: 98.2117 bits (243), Expect = 8.350e-21
Identity = 112/395 (28.35%), Postives = 185/395 (46.84%), Query Frame = 1
Query: 1234 LYTVHSLDRETIPDGIIYTNFICYDSGIKRQ-LYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGST-QLTITVLDDNDNAPELREYTDFS--ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKT---IMVEILD 2388
            L TV SLD ET    I+    +  DS I  Q  Y  + +  NV D ND+APLF S  Y+  V E+  +G  + +  A D D G NA + Y+I+         F I    G L + + LDR     Y L + A+D+    R + +  ++ +TV    DNAP      D+S  + E    G ++  + A  +     + + +++   +      VN T G + + ++ D E+K     +IQ ++  +G  L+++ SV +++ DENDN P   ++++       S +    +E +    VV   + +K   V  V++ATD D    S L Y +     E+  Q+ F ID  +G I + + L  +       +V V DSG P L SA+T   + + +LD
Sbjct:   74 LSTVESLDHETKQSHIL--TVMVRDSEIPVQKAYATVVV--NVRDSNDHAPLFTSRHYEGRVVESAALGSAVLEVVALDRDRGPNAEVAYSIEAGNRNVGNSFTIHPTMGILSVAKELDRAVVEAYELVVRAVDRGEPPRSATTAVRVLVTVA---DNAPPKFTSKDYSAEVSEGARPGSFVLMVTASSR-----STVNYEIRDGNFEDTFYVNPTSGVITTKELLDYERKPSYQLKIQATN-MVG--LSTNASVSIHLSDENDNAP---VFDR-------SQYRGVVSEEAQAQTVV---LNDK--NVPLVIRATDLDSEQNSLLVYQI----VEHEAQTYFSIDSSTGAIKMIKVLDYEKTPEFHFQVRVSDSGSPKL-SAETPANVTITVLD 433          

HSP 7 Score: 95.5153 bits (236), Expect = 5.196e-20
Identity = 149/654 (22.78%), Postives = 284/654 (43.43%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLI--TDI-----FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFN-LEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG-EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRL----EKDQM-------STDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSG-IKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQ---LTITVLDDNDNAPELREYTDFSILE-NLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCT-QIQLSDSAIGNVLTSHVSVCVNILDE 1998
            + ++ E  P  T + R+  A   D+  S +F ++  TD+     F +D  +G + T++ +D E         K+S  +++ V  +      +   +V+ + D +D+ P F    +   + E     + V+ +  A+D+D    N E+AY + +G+ +  N    H + G  L +  ++D    + Y   + A  + +   SA   V + V   ++  P+F+   Y   V E       ++ V A      N         + F +N   G +   + LD+E+  S+   IQAT+       + + I + D ND  P +  +  + V+ E  ++     Q  V +  +V +   I+ T+ + E  +L +    E +         ST  + + K+     LD E  P+   +      DSG  K    T  ++ + V D ND+ P+F  + Y+  +      G +L    ATD D   +A +T++I        F I++RTG + +        +++Y L +      V D K  ST    + + V D NDNAP       ++++E +   G  + T+ AFD+D G N  + + L  +H Y  +   ++G +   + F  +  SK  T  +  +DS +   L+S VS+ + ++++
Sbjct:   22 EVSVAEETPPNTEILRLN-ATDRDDTSSLTFSIVSSTDVASLRKFKLDYNTGALSTVESLDHET--------KQSHILTVMVRDSEIPVQKAYATVVVNVRDSNDHAPLFTSRHYEGRVVESAALGSAVLEV-VALDRD-RGPNAEVAYSIEAGNRNVGNSFTIHPTMG-ILSVAKELDRAVVEAYELVVRAVDRGEPPRSATTAVRVLVTVADNAPPKFTSKDYSAEVSEGARPGSFVLMVTASSRSTVNYEIRDGNFEDTFYVNPTSGVITTKELLDYERKPSYQLKIQATNMVGLSTNASVSIHLSDENDNAPVFDRSQYRGVVSEEAQA-----QTVVLNDKNVPLV--IRATDLDSEQNSLLVYQIVEHEAQTYFSIDSSTGAIKMIKV-----LDYEKTPE--FHFQVRVSDSGSPKLSAETPANVTITVLDANDSPPIFSRAVYETVLLTPTYSGVRLLSMSATDPD--TDASLTFSISTGNVGDKFAINARTGDISVQNAT--HLRSRYELAV-----KVFDGKFVSTAQAVVAVRVEDVNDNAPVFVNLPYYAVVEVDAAPGSVVYTIAAFDRDVGRNGEVSYSLKEEHEYFDVEA-RSGDVSLRRSFTADMSSKDFTVNVVATDSGVPP-LSSEVSLPITVINK 638          

HSP 8 Score: 92.0485 bits (227), Expect = 5.279e-19
Identity = 119/490 (24.29%), Postives = 212/490 (43.27%), Query Frame = 1
Query:  709 VTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDA-DGDNLRYILLPMTNY-----FQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFV---AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD-------SVSI---NRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP-------------ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTV--NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNV-LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNN 2070
            V + V+N N+  P+FS+  YE SV E+   +  I+++NA D  D  +L + ++  T+      F+++ N G L  ++ LD E  QS   T+   D E     A + + + V D ND  P +     +  + E+   G  V ++   DRD       + SI   NR +  + T H T  +     ++   ++  Y+L  V ++DR   P                R   T + + + V D  +  P F S  Y   V E    G  +    A+       + + Y I+       F ++  +G +   + LD E+K  Y L I A +       S +  ++I + D+NDNAP             E +  T     +N+P+      + A D D  +N+ +++++ ++H  Q      + TG++   +V D EK  +   Q+++SDS    +   +  +V + +LD ND+ P IF     ET L+   ++ 
Sbjct:    2 VEVSVINTNEHRPQFSRPRYEVSVAEETPPNTEILRLNATDRDDTSSLTFSIVSSTDVASLRKFKLDYNTGALSTVESLDHETKQSHILTVMVRDSEIPVQKAYATVVVNVRDSNDHAPLFTSRHYEGRVVESAALGSAVLEVVALDRDRGPNAEVAYSIEAGNRNVGNSFTIHPTMGILSVAKELDRAVVEAYEL-VVRAVDRGEPP----------------RSATTAVRVLVTVAD--NAPPKFTSKDYSAEVSEGARPGSFVLMVTAS-----SRSTVNYEIRDGNFEDTFYVNPTSGVITTKELLDYERKPSYQLKIQATNMV---GLSTNASVSIHLSDENDNAPVFDRSQYRGVVSEEAQAQTVVLNDKNVPL-----VIRATDLDSEQNSLLVYQI-VEHEAQTYFSIDSSTGAIKMIKVLDYEKTPEFHFQVRVSDSGSPKLSAETPANVTITVLDANDS-PPIFSRAVYETVLLTPTYSG 457          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.088 bits (427), Expect = 1.508e-42
Identity = 185/691 (26.77%), Postives = 305/691 (44.14%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDH-SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN--YFQINNDGELHLIQKLDFEKHQSFSFTIQATDG--EFVAES-KLKITVLDVNDEPPSYILNPEKLVID--ETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETI--PDGIIYTNF--ICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSV-CVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLI-GLQKVKVMVEDSGHP--SLKSA-KTIMVEILD 2388
            + I + D  D  P F + +++  + E +    +V     +V       N  + Y + SGD   +F++E     G R+     ID E+Q  Y+  + A   N   ++   +V++ V ++N+ AP F +  YE S+ ED  ++     V A D D G N  ++Y +        F I  DG+L++  +LD E  + +S T+ A D   E ++ S  + +TVLDVND  P  + N    V    E  + G LVG +   D D+ S N G+  +    E   +  E D  +       ++ ++   DRE +    G    +F  +  D G  + L    ++ + V D+NDN P F  S YQ  V E+     QL +  A+D D G N  + Y I    + G F +D+ TG + L+  LDRE+   Y L + A D       +  T + + VLD+NDN P   E       LE+  +G  + TL A D+D G +  + + +   + +    +++ TGS+F  +  D E +      +   D   G    S  ++  V++ D NDN P  FL       +  S+  N                   +G  +  V A D D +   +L Y +   A +    + F ID +SG+I     + R++  GL +V V   D   P  + +SA K + V + D
Sbjct:  644 VTITVADAQDTPPTFARDDYSFVVFENVAPGTLV----GSVSASTLDLNANVTYLIVSGDQRGSFSIEWS---GGRIFTANAIDREEQAFYQLRVVA---NSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP--LFNSSSYVFHFCEEQEVGSLVGAVQATDADAGS-NGGVTYS---FEKPQVNFELDSETG------RIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCT-VAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDG--GRPPRSSATILVVHVRDFNDN-PPAFL----PGDVFASIMENI-----------------PIGTRVITVTARDPDADVNGELHYSI---ARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTD 1284          

HSP 2 Score: 162.155 bits (409), Expect = 2.354e-40
Identity = 157/589 (26.66%), Postives = 271/589 (46.01%), Query Frame = 1
Query:  358 QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYR-MSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLD-----EIIIKVNAVDADG---DNLRYILLP------MTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKR----QLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQ---------FSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFL 2025
            +  + S  ++ I + D++DN P F  PE  +E++E    +  VI+  +A D D   +N  + Y  +SG   AF ++  +     LR    +D E++  Y  T+ A   +D + + +  +++ V + ND +P FS+  Y   V ED + D      +I  V A DAD      + Y L P          F ++   G L++ + LD E    +    +ATD G   A ++L + VLD ND  PS   +     + E    G  + +I+  D D   +N  ++ + ++ + +     +  +  D     +L    +LDRE       + N +   S   R    +L + + + L + D+NDNAP F S +  +   E++ +G  +   QA D D G+N+ + Y +               G F +++ TG ++L++ LDRE +  Y LT++A+D+      S +T L +TV D NDNAP    REY + +I E+ P G  +  L A+D DEG N  + + ++         ++   G+L   +  DRE+ +     ++  D   G   +   SV V + D ND  P   L
Sbjct: 1493 RPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTG-EGEVIFTLSATDAD-QGQNALVTYSVLSGSEGAFVVDAASG---VLRASRRLDREERASYLLTVRA---SDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDE-GVNAELEFSISSGDPEG----RFAVGND----GQLSVARALDRER----QSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL-APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTAT-LAVTVGDANDNAPRFPRREY-EAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGG-GPARSDTASVRVTLSDVNDCSPAFQL 2056          

HSP 3 Score: 151.754 bits (382), Expect = 3.224e-37
Identity = 175/739 (23.68%), Postives = 316/739 (42.76%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHE-TQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREK------KNQYMLTIVAID----QAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++F +D  +G + TLK +D E L        E   + +         L S  K+ +++ D++DN P F   ++   I E        +    A D D    N  + Y++ +GD + F +   N+    +   + +D E++  Y+  ++A         +   VT+ V +  D  P F++  Y   V+E+++   ++  V+A   D   N+ Y+++       F I  + G +     +D E+   +   + A  G    E+ + + V DVN+  P +     ++ I E          +   D+DS       K  E  +E  +    EK  +  D     +LY  + LDRET  +  +  +    D+G++  L +++++ + V D+NDN PLF SS Y     E  ++G  +   QATD D G N  +TY+  F      F +DS TG +  ++  DRE          +  ++VA D    + + DR +    + + V D NDN P+  +     S+ E+      +  + A D DEG N  + + ++  +     TV+  TG +      DRE+ +     +  +DS   + L +  +V V +LDENDN P+             SL +    E +            +VG ++  + A+D D      + Y +    +     + F ID+ +G + + R L  +   L ++ V  ED G P   SA  ++V + D
Sbjct:  495 EMFRLDSLTGKVTTLKSLDREEL--------EEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILE-NEPGGTAVTTVTATDPDRG-ANGTVRYQLTAGDAARFQV---NAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSG------KNGEVKYEIGEGNGGEKFGIFPD----GQLYVRYELDRETREEYSLTVS--AMDTGVE-PLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYS--FEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRAT----VQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGT-SPLAASCTVAVQVLDENDNPPR----------FTESLLSVDALEST------------RVGELLITLTASDEDTGPSGDVRYAIVAGNT----HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRD 1174          

HSP 4 Score: 147.902 bits (372), Expect = 4.505e-36
Identity = 170/703 (24.18%), Postives = 279/703 (39.69%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKP---EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRG----PR---------LRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLI---QKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPS--YILNP---EKLVIDETNKSGILVGQITVFDRDSVSINRGIKCT-ETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE--YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK----TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++ +++ D++DN P F +P   E   +    + R+   + L  AVD+D+             +H A+ +   N  G    PR         L     +D E    Y   + A           + V + V + ND  P F K  Y  SV ED  +             G  LR +L        +  D +  ++   Q LDFE  + ++ +++A DG        +   I +LDVND  P+  ++  P       +DE+   G +   +TV D DS + N  +  +    +E     L     +  +  +  L     LDRE IP  +     +  D+G         S+ + V+D+ND+AP F  S Y   + E    G  +    A D D G NA + Y+I    D G F +D  TG +     +DRE  +  +L I A DQ     K+  T LT+T+LD ND  P   +  Y   ++  +LP G ++ ++ A D D GEN  + +    D   Q   + +    TG + + +  DRE+  +    +Q  D      L S   V V + D NDN+P  +                       V Y   +   E  G  +  V ATD D      + Y L    +   Q     ++  +G ++    L R+   + +++V   D GH   +S   + + + D
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQ---VLLDTAVDRDVGPNGV--------NHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPV-------------GAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLH----APGVPGLRVLKVASQLDRERIP--MYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQP-KTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLP-GLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRG-SPPLGSTAKVTVVVGDLNDNHPVFY----------------------PVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQ-----VNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVAD 650          

HSP 5 Score: 141.354 bits (355), Expect = 5.260e-34
Identity = 183/740 (24.73%), Postives = 297/740 (40.14%), Query Frame = 1
Query:  241 DPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFE----KPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLL---IDIDYEKQKQYRFTLSAYQKNDE-SMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD---NLRYILLPMTNYFQINNDGELHLIQ---KLDFEKHQSFSFTIQATDGEF---VAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD---SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-LFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL-ENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            DPK+G + T + +D EA        +   T+SL         L      VI +LD++DN P        P       +       V  L    D D    N E++  + G +   +   H    P LR+L     +D E+   Y  T+ A       + SA  ++ + V ++ND AP F+ + Y  ++ E       +  V A+DAD      LRY ++   +    + D    L+    K+D E   S    I A D       A + L +T+LDVNDEPP +          E +  G+ V  ++  D D   + ++             +  RL+         L  K+ T+ SLDRE + +   Y   +         L +   + + V D+NDN P+F   QY   + EN   G  +    ATD D G N  + Y +    D+  F +++ TG +     LDRE++  Y L + A+D   H R      +TITV D  D  P   R+   F + EN+  G  +G++ A   D   NA + + +         ++  +G  +F+    DRE+++      QL   A    +    SV V + D N++ P               +F+          Y V ++  E V      V+ATD D     ++ Y + E +  E     IF      G++ +   L R+      + V   D+G   L S+ T+ V +LD+
Sbjct:  171 DPKTGMVSTRQPLDFEA--------RRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDS--------LTGKVTTLKSLDREELEE---YPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAG-DAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGG-HLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAF----YQLRVVANSGGVAGEASVSVLVHDVNNHAP---------------VFDR-------ASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKF--GIF----PDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDV 855          

HSP 6 Score: 140.969 bits (354), Expect = 6.235e-34
Identity = 146/594 (24.58%), Postives = 240/594 (40.40%), Query Frame = 1
Query:  691 MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMT-NYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPP-----SYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-----LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD--RKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFS-NQV---------FDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            MS+   V + V ++ND  P F+    E  V E+    E+I  ++A DAD G N  + Y +L  +   F ++   G L   ++LD E+  S+  T++A+DG    +++L + V D ND  P     +Y  +  +    +   +  ++G +   D DS               T AL   +D    D       +   L     LDRE+    ++       D G    L     + +NV D NDNAP   +      V E+   G  L +  ATD+D G NA + ++I      G F +    G L + + LDRE+++ Y L +   D+A H   R S + ++++ + D NDNAP           E+ P+G  + T+ A D D G N+ + + L+ D              F+ N V          DRE +      +   D      LTS  ++ V + D NDN P+    E                      Y   ++  E  G  +  + A D D     +L Y +    +       F +D   G + + RPL R+     ++ V   D G P+     ++ V + D+
Sbjct: 1496 MSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFG---------EVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRAR--ATDGG---GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV-GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGR-PPLTSTATLAVTVGDANDNAPRFPRRE----------------------YEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDI----ASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDV 2047          

HSP 7 Score: 134.806 bits (338), Expect = 4.660e-32
Identity = 147/544 (27.02%), Postives = 236/544 (43.38%), Query Frame = 1
Query:  361 KTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLL---IDIDYEKQKQYRFTLSAYQKN-DESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINND---GELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD---SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGL-FVIDSRTGWLKLMQPLDRE-KKNQYMLTIVAIDQA--VHDRKSGSTQLTITVLDDNDNAPELREYTDFSILEN---LPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCT 1920
            + L S + + + +LD++DNKP F    +     E     ++V  +  A D D +  N  + Y        F L+    R   LR+      I       + F++ A      + +     V + V ++ND  P+F+K++Y+ SV E  S    +++V A D D G N  LRY +       +   D   G++ L+  LD E+  S++  + ATD       A   + + VLD ND PP +  +   +   E+ + G L+  +T  D D   S  +   I    T H T A+    D+ +  + L  +L      D ET    +   N    D G   +    I + ++V D NDN P F        + EN  IG ++    A D D   N  + Y+I      G  F ID  +G +     +DRE     + +T+ A D+A  VH R+S    +T+ V D+NDNAP  R  T  +IL +      G  +GTL A D DE ENA + + ++         ++ +TG + ++   DRE      T
Sbjct:  840 EPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAV-QATDAD-AGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT-HATFAI----DRSTGSVFLARRL------DFET--QRLYRLNVSAEDGGRPPRSSATILV-VHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAP--RFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRESGHGAFT 1365          

HSP 8 Score: 130.954 bits (328), Expect = 8.710e-31
Identity = 155/621 (24.96%), Postives = 279/621 (44.93%), Query Frame = 1
Query:  379 MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHS-AFNLEEH--NSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDE------IIIKVNAVDAD-------------GDNLR--YIL-LPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAES---KLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCT-ETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIK-RQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG---LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLT-SHVSVCVNILDENDNYP-------QIFLYEK-DETTLINSLFNNTYTEHSNVDYVV 2106
            +++ + + D +DN P FEKP +   + E               D  +    +++ +R  G  +  F+ +    ++R P       +D+E ++QY  +L A    +  +S      +Q++++ND  P   + +Y        S+DE      +   V   DAD             G N R  ++L  P     ++     L +  +LD E+   ++ TI A+D G+ VA S    L + V DVND  P + L+     + E   +G  V  +T  D DS  +N  ++ +  + ++     +++   ST ++      T   +DRE     ++  N    D G + +  YT++++ L   D+ND  PLF  ++Y     EN+  G  +    A D D+G+N  + YN    + +    +F +DS TG +  ++ LDRE+  +Y L + A D+      S + ++T+ V D NDN P       F SILEN P G  + T+ A D D G N  + ++L+     +   VN  TG++ +    DRE+++    Q+Q++    G++   S   V + + D  D  P          ++E     TL+ S+  +T   ++NV Y++
Sbjct:  120 LQVNVTVQDANDNPPAFEKPAYRASVAE---------------DSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQP-------LDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAI-RFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRV-----LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADS-GLNAKLRYSIVSGNDLGWFSVDE---STGLVT-----TDGKVDREVASSVVL--NISAQDQGAQPKTAYTSLTVTL--LDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGS-TAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAAR-FQVNAVTGAVSTRVSLDREERA--VYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLI 695          

HSP 9 Score: 128.642 bits (322), Expect = 3.622e-30
Identity = 131/512 (25.59%), Postives = 225/512 (43.95%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQIDEE----LSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAA-VDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD----GDNLRYILLPMTNY--FQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVL---DVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGI----KRQLYTNISIPLNVHDINDNAPLF--PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKN 1596
            F   E Q + + VG ++ A   D      ++YSF      F +D ++G I +L+V D EAL     A   S ++ +  +  R K L     + + + D++DN P+F K  +   + E       ++ + A+ VD+ +   N  + Y ++  +         S G ++ LL  +D E+   Y   +SA       ++A+  V +QV++ ND  P F++++      E   + E++I + A D D    GD +RY ++    +  F I+   G + L ++LDFE  + +   + A DG     S   I V+   D ND PP+++       I E    G  V  +T  D D+  +N  +  +             D  S +I       T   +DRE +  G+        D  I    +R    N+++   V D NDNAP F  P++    G++     G  +   QA+D D  +NA + Y +     + LF +D RTG ++    LDRE  +
Sbjct:  869 FHFCEEQEVGSLVGAVQ-ATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSV-VATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGV---NGALRYAINEGNEGGKFTVDASTG-QITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGD-VRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDA-DVNGELHYSIARQFPPGAHFTIDPESGEIC------TAAEIDRE-VTGGLFEVTVRATDKAIPVHTRRSALKNVTV--LVTDENDNAPRFVTPTAILVDGLRAA--AGSVVGTLQASDPDEAENAAVRYAVTGGDAAILFRLDRRTGIIETSTELDRESGH 1361          

HSP 10 Score: 123.635 bits (309), Expect = 1.298e-28
Identity = 138/597 (23.12%), Postives = 251/597 (42.04%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVI----HRKNMVIYLPAAVDKDISMKNKEIAYRMSGDH------SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP--MTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATD------GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIK---CTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSI--LENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSD 1938
            F +D  SG +   + +D E          E A+  L V  +   T  +  ++ + + D +DN P F +  ++ ++ E           VI    A D D S    E+ Y ++          AF L  H   G  L +   +D E +  Y   L A   +   ++A   + + V++ ND AP          V ED      +++++A D D G N  L + +        F + NDG+L + + LD E+   ++  ++ +D          +  ++ + + DVND  P++  +P   +  E +  G +V  +   D DS   N  ++    T+               + + +   ++  V  LDRE      +    +  D G +  L +  ++ + V D NDNAP FP  +Y+  + E+   G ++ +  A D D G N  + Y+I     +G F +D   G L + +PLDRE+   Y L + A D     R S +  + +T+ D ND +P  +L  YT  +    +  P+   I  ++A D D G + ++ +  +  +     +V+  G +   +  DRE + +    I  +D
Sbjct: 1563 FVVDAASGVLRASRRLDRE----------ERASYLLTVRAS-DGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDAD-SGPFGEVTYALAPSEDSDWADGAFGL--HPVTG-ALNVTRPLDRESRACY--VLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-SPRSALAPEDSPVGAVVATVQAVDPDS-GRNSYVEYALATDGEEGGGGAGAGPGPFALNTV-TGEVRLVRELDREARQSYAL--TVLAVDKG-RPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPAR-SDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPV--LILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 11 Score: 109.383 bits (272), Expect = 3.103e-24
Identity = 117/511 (22.90%), Postives = 205/511 (40.12%), Query Frame = 1
Query:  163 GRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEA-LCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDES---MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTN--------------YFQINN-DGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQL-FQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAID 1626
            G + +A    E+  ++ G     F + P +G ++  + +D E+  C+            L         L +  ++ + +LD +DN P  +      E+ E       ++ + +A D D  + N E+ + +S           N    +L +   +D E+Q  Y   +    +       +S+ + V+L + ++ND AP F+         ED  +  ++  V AVD D     Y+   +                 F +N   GE+ L+++LD E  QS++ T+ A D       + + L +TV D ND  P +     +  I E    G  V +++ +D D  +         +   T   RL+         ++  L     LDRE       Y   +    G         S+ + + D+ND +P F  S Y V  +EN      L  Q  A D+D+G +  +TY      D G F + S  G + L++ LDRE + Q++L I A D
Sbjct: 1655 GEVTYALAPSEDSDWADG----AFGLHPVTGALNVTRPLDRESRACY-----------VLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRI-SATDDDEGV-NAELEFSISSGDPEGRFAVGNDG--QLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDP--------VLGTLAVARPLDRERTAS---YELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSV-SPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 12 Score: 81.6481 bits (200), Expect = 8.073e-16
Identity = 114/492 (23.17%), Postives = 183/492 (37.20%), Query Frame = 1
Query:  991 SKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQAL-------RLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR------EYTDFSILENLPIGHYIGTLIAFDKDE------------GENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +++++ V DVND  PS+   PE  V++   K    VG+  + D    +++R +     NH    +       RL   +  T    ++ L T   LDRE  P    Y   +  + G   + Y  + + + V D NDN P F    Y+  V E++ +G  L        D+         + F         D +TG +   QPLD E + QY L++ A D   +   SG     I +LD NDN P +R           S+ E+   G     +   D D             G N R  F L    +   L V K  S       DRE+       I  SD+      ++  S+ V + D ND+ P+ F        L       +Y +                      V A D D    S L+  L  S         F +D+ +G +T +  + R++     + +  +D G     +  ++ V +LD+
Sbjct:    7 TEVRVVVGDVNDNAPSF---PEPGVMEVAFKEDAAVGRQVLLD---TAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLH-LATTGPLDREANPS---YALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RDLLHRGRGPLAVPF---------DPKTGMVSTRQPLDFEARRQYTLSLRAADGG-NPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPG-LRVLKVASQ-----LDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPR-FALSAYAAALSEGAPAGSYVKD---------------------VTAMDAD----SGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDV 439          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 155.992 bits (393), Expect = 6.180e-39
Identity = 166/635 (26.14%), Postives = 271/635 (42.68%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRIK--FAKQIDEELSYSFGLIT-DIFS---IDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLID------------IDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYIL-------LPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILN------PEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFV-----IDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNA-----PELREYTDFSIL-ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-LFSN 1881
            K+ + E QP  T VGR+      ++ E  S  F L+  D FS   ++   G +   +VID E      C    S  I  +V     + L  ++   + +LDI+D+ P+F + E  +EI E +     V  L  A D D+       A R      A++L+E+   G  LR   D            +D E++ +Y   L+A+   D   S    V + V++ ND +P F++T    +V ED +   +++ +NA D D G N   +          +   FQ++   G+L L  +LD E +  +  +IQA D       A  K+ + V D+ND  P   L+       + + + E       VG +TV D DS   N  + C    H    L   +D         Y + T  SLDRE + D   +      D G   ++       + + D NDN P F  S Y+  + ENN  G  +    A D D   N +I YN+  S  +G  V     I+  +G +  ++PLD E        + A D  V    + +T +++ ++D+NDNA     P LR  T    L  +  +G+ +  + A D D   N  + +++   +      +N+ G  +F+N
Sbjct:   32 KYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDRE----QQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRV-PLEGARDLDVGGN----ALR------AYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAE-NGLVACHLRGHPHFKLLPYRDD--------YVVVTNSSLDREQMAD--YFLVLEASDGGTPPRVAAR-QFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNAT-VSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTN 638          

HSP 2 Score: 124.02 bits (310), Expect = 4.827e-29
Identity = 148/599 (24.71%), Postives = 260/599 (43.41%), Query Frame = 1
Query:  703 MNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD--GDNLRYILLPMTNYFQI----NNDG----ELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRL-EKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIP------LNVHDINDNAP------LFPSSQYQVGVKENNDIGYQLFQAQATDEDI--GKNALITYNIQFSVDSGLFVIDSRTGWLKLM-QPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMF-----KLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIG---LQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            ++  +++++IND AP+F+++     + E ++L   +    A D D  G+ LR   L     F +      DG    EL +  +LD E+   ++  + A DG     S    ++ITVLD ND  P +      + + E    G ++  +   D D       +    +  + +  RL + D  +  + L  +L   H L+ E             Y+  I+ +     SIP      ++V DINDNAP      +  S    V V E     Y+ F    T  DI   +N L+  +++      L  +  R  ++ +    LDRE+   Y L + A D     R + + Q T+ +LD+NDN P     T + S+LEN   G Y+ T+ A+D D   N  I +     +++   +   +++N  +G++++ +  D E  + +  Q+Q  D  +  ++T + +V V I+DENDN P +                 T+    N   VV++     +G+++ VV+A D+D     +LSY +      NL    F I++  G++  N     D         + VMV D G P+L +   I + +
Sbjct:  120 VHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLD--HELNSE-------------YEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEG--AAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKL--LPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVA-ARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVT-NATVSVRIVDENDNAPVV-----------------THPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNL----FRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 3 Score: 104.375 bits (259), Expect = 6.000e-23
Identity = 124/477 (26.00%), Postives = 190/477 (39.83%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSIN--RGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS---GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL--------REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIF-DIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++ +LD+ND  P +  +   + I E+   G  V      D D V  N  R     E      ALR   D      L++        LDRE   +G        +D G   +  T + + + V D NDN+P+F  +   V V+E+   G  L    ATD D G N  + Y+    VD+    LF +D +TG L L   LD E  ++Y ++I A D       +   ++ + V D NDNAPE+        R  T F + E      ++G +   D D  EN  +   L     ++ L       + +N   DRE+ +     ++ SD      + +     V +LDENDN P+        +T   SL  N                    G  +  V A D D  +   ++Y +  S       S +  I+  SG I   RPL  + +     +V   D G P L +  T+ V I+D
Sbjct:  123 EVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLD-VGGNALRAYHLDENERFGLALRARTDGAKYAELVVKS-----RLDREQ--EGEYTLQLTAWDGGDPPRSGTTL-VRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPA-HCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAAR-QFTVRLLDENDNEPRFH-----RSTYEASLLENN-----------------SPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVD 565          

HSP 4 Score: 101.679 bits (252), Expect = 4.012e-22
Identity = 87/276 (31.52%), Postives = 136/276 (49.28%), Query Frame = 1
Query: 1252 LDRET----IPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQ-----PLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLS------MDHLYQ--PLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFL 2025
            +DRE      P  +I  + +C    + R L+  +   + + DIND+AP F  S+  V + E+  +G ++    A D D+G NAL  Y++  +   GL  + +RT   K  +      LDRE++ +Y L + A D     R SG+T + ITVLD NDN+P   + + + ++ E+   G  + TL A D DEG N  +++  S      +  L+Q  P    KTG L      D E  S+    IQ  D    ++  +H  V V++ D NDN P+I L
Sbjct:   90 IDREQQCGQAPSCVIRFDVLCT---LPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGL-ALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPR-SGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDP----KTGKLSLKGQLDHELNSEYEISIQARDMGPSSI-PAHCKVLVHVEDINDNAPEIKL 355          
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.992 bits (393), Expect = 1.773e-38
Identity = 196/774 (25.32%), Postives = 327/774 (42.25%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDE----ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEK--QKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD------NLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG-----EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRG---------------IKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREY-TDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQV-FDREKKSKVCTQIQLSDSA-IGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKV--GFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINR-PLHRDLIGLQKVKV 2322
            ++ EN  + T V ++  A  +D     ++SY F   +D FS+DP SG I     +D EA          +   ++ V         +  ++ I +LD++DN P F++  +    +E  +    V+ +  A D+D S  N +I Y +   S   S F++      G  + L   +DYEK        T+ A       +++ +   ++V + ND +P F +  Y  ++ E+I     ++ VNA D D        +L Y L   T  F+IN   G++     LD E    +   ++A DG     +    + + IT+LDVND  P++   P  + I E    G  +  ++  D D   +N                 I        T  L+L+++ ++       +   V   DR + P                R+   + ++ + + D+NDN P F    Y + V E       LFQ  ATD D G N  +TY++  ++    F +D+ TG +  +  LDRE    Y L +VA D+      S +T L++ VLD NDNAP      +  S++E++     + +L   D D G NA + F ++  +     +V     L    V  DRE K+     I+  D+   G+  T   ++ V +LD NDN P +FL    E                       +S+ E V  G +I  V+ATD D     ++ Y +    S N Q   F ++  SG I+    PL R+ + L  ++V
Sbjct:   38 SVWENATLGTSVVQV-LATDLDAGVFGQVSYHFSDDSDKFSLDPASGLISVAAALDFEA----------TPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRV-RATDED-SPPNNQITYSILPTSAYSSYFSITVSGGYG-VVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ-FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPD---LNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPP----------------RRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGT-PALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRP-LFLEGSYE-----------------------VSVPENVTRGAIILQVQATDIDEGINGRVWYRI---ISGN-QDGNFLVNVSSGLISRGATPLDRETVALHALQV 748          

HSP 2 Score: 146.747 bits (369), Expect = 1.243e-35
Identity = 156/585 (26.67%), Postives = 263/585 (44.96%), Query Frame = 1
Query:  694 SANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD---NLRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFV-AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTV-HSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDED----IGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVC----TQIQLSDSAIGNV---LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            SA +++TL  +N ND  P FS  +Y  SV+E+ +L   +++V A D D      + Y     ++ F ++   G + +   LDFE    F+ T+ A DG       +++I +LDVND  P +  +       E + S   V ++   D DS   N   + T +   T A        S  +   Y + T+  +LD E IP G I    +  D G    L + ++  + V D NDN+P+F  + Y + + EN   G  +    ATD D     G+ +LI Y+++ S     F I++R+G +     LDRE  +QY+L + A+D    +D+K+G   + IT+LD NDN P  R+     +I+EN P G  I T+ A D D  EN  +++ +   + +  +         +    DRE  + +       I +S +  G+     T+  +V V + D NDN P                          + Y +++         +  V ATD D      ++Y    S +  L +  F +D  +G IT    L R+ +   +++++  D G P+L S  T+ + +LD+
Sbjct:   13 SARVHITL--INENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNN---QITYSILPTSAY---SSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGG-SPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLI-YSLEGSTQ---FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFV----------------------GLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTY----SMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDV 558          

HSP 3 Score: 118.242 bits (295), Expect = 6.939e-27
Identity = 176/784 (22.45%), Postives = 317/784 (40.43%), Query Frame = 1
Query:  187 IDEELSYSF-GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKES---ATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNK-EIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINND-------------------GELHLIQKLDFEKHQSFSFTIQATDG---EFVA------ESKLKITVLDVNDEPPSYILNPEKLV-IDETNKSGILVGQITVFDRDSVS----INRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPS-SQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQP--LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSN----QVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-YLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            ++  L+YS  G  +  F ID   G++         ++      D+E      + L + V       + +++ + +LD++DN P F     T  + E        + +  A+D+D+ + +   + Y + SG +  F ++E       +  +  IDYE + +Y   + A  +     +A+  + + + N  D    FS   Y+ ++ E      ++++V A          + LP+    Q  ++                   GE+     LD E   S+  T+ + DG   E +A       + + + V D ND  P +      LV + E+   G L+  +   DRD+ S      R    T T    Q + + +++    I+ + K   V    +       I    +  D G   +  T  ++ + V D+NDN P+F S   Y V V E    G  +    ATD D G N  +T+ I+ S       I    G +++     +DRE +  Y L +VA+D+  +   SGS  + + V D ND  P  L      S+LE+L +G ++ T+ A +  +G N +  +K++        TV+ T  L ++    + ++R   + V T            L     + V +LD ND+ P +F+   + T +             N+  V+ + IR      I  V A D D      + Y +L      +     F I+  SG I+  R L R+   +  + ++  D G P S +S + + V + DI
Sbjct: 1535 VNATLAYSLLGGSSAYFLIDRDRGNV---------SMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGL---IVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPP--KLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQ------FILFRIVALDGGSPPR-STTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIE-SGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRG-NPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIG-KNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPP------LWGQAGLYVEVLDVNDHRP-VFVLPPNGTVV-------------NITEVMPVVIR------IVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDI 2268          

HSP 4 Score: 109.383 bits (272), Expect = 3.255e-24
Identity = 176/782 (22.51%), Postives = 310/782 (39.64%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEA-----LCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKP-EFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDA-DGDNLRYILL--PMT------NYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLK------ITVLDVNDEPPSYILNPEKLVIDETNKSG----ILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENND-IGYQLFQAQATDEDIGKNALITYNIQFSVDSG---LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL---ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQP----------------LTVNKTGSLFSNQVFDREKKSKVCTQIQLSDS----AIGNVLTSHVS--VCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKV--GFVIAVVKATDNDVNNVSQLSYYLENSASENL-QQSIFDIDKKSGKITINRPLHRDLIGLQK----VKVMVEDSGHPSLKSAKTIMVEILDI 2391
            F ID  +G +  +K +D E      L   +  D+           +  + L S   + + + D++D  P F +  E  +++ E      +  ++  A D+D  + N E+ Y +  GD     +        R+R  +++D E Q  Y  T+ A       +++ + V ++V++++D  P F       S+ E  ++  I+ +V A DA +G N   +L   P +       ++  +  G +++ + LD E+   +  T+   D         K      +T+LD ND  P +     +  I E + +G    +L G I   D D   +N  +  +     +    +++D+ +  + L         LDRE IP G +    +  D G +      + + + V D+NDN P F  +     V EN+  +G  +   +A D D+G     T  +++S+ SG    F ID  TG +  + P+D E + +Y+L +VA DQA     + S +L +++ +      EL E   FS+      L      GT++         A     L +  L Q                 L     G + +    DRE        +   D     AI  VLT+     V VN+ DENDN P+   +E    TL+                     +RE    G ++ V+ ATD D  +   +S          +  Q I  I  +SG +TI      D +         +++  D G P   +   + V +LD+
Sbjct: 1221 FGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPR---------DPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFM--ASDQDSGL-NGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDAD-FGVNATLAYSLLGGSSAYFLIDRDRGNVSMAL------GQGLDREGIPGGRLELTILVQDGGRRN---ATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGT--VRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA-PPFHTASCELRVSLQN------ELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIA-VLTNKPGAYVYVNVTDENDNSPE---FEAGSATLVE--------------------VRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESG-VTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDV 1946          

HSP 5 Score: 104.76 bits (260), Expect = 8.023e-23
Identity = 145/561 (25.85%), Postives = 238/561 (42.42%), Query Frame = 1
Query:  697 ANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIK-VNAVDAD-GDNLRYILLPMTN----YFQINND-GELHLIQKLDFEKHQS-FSFTIQATDG------EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKN--ALITYN-IQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVA---IDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYI----GTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTG--SLFSNQVFDRE--KKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDND--VNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPL 2286
            A  +V +++ + ND AP F    YE  + E  S   + +  V A D D GDN R +   ++      F I+N  G L  ++ LDFE     +   + ATD          + + + + V DVND  P ++ + E  +     + G  +      D+DS  +N  ++ +  + +    R E      D  L  + Y    LDRET          +  D G    L + +++ + V D++DN P+F +      + E   +   + + +A+D + G+N  AL+ ++   F      F  DS+TG + + +PLDRE+  +Y LT+      D   + RK  S  + +T+LD+NDN+P   + T +  I EN P G  +    G + A D D G NA + + L        L     G  S+   Q  DRE     ++   I + D   G    + V + V +LD NDN P   +  +    L NS                       VG  + VVKA D D  V +   + Y + +  ++      F ID+ +G I    P+
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDS-GLNGELEYSIIDGDP---RNEFVISPADGDLRVRRYV--ELDRET--QAFYNLTIMAKDMGTP-PLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKD-SDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQD---GGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENS---------------------PAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDT-----FGIDESTGLIVTVAPI 1675          

HSP 6 Score: 93.9745 bits (232), Expect = 1.626e-19
Identity = 151/653 (23.12%), Postives = 265/653 (40.58%), Query Frame = 1
Query:  397 ILDIDDNKPEFEKPEFTM-EIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEH------NSRGPRLRLLIDIDY-EKQKQY-RFTLSAYQKNDESMSANMNVTLQVVNINDCAPEF-SKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMTNYFQINNDGELHLI-------------QKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFD-------RDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF--PSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGL-----FVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDD-NDNAPEL-------REYTDFSILENLPIGHYIGTLI-AFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDEND-NYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYL 2202
            + D +DN PEFE    T+ E++E      ++  L  A D+D +  N  ++ R +  H+   +         N  G  +  +   D+ EK  Q+  F + A        S   N+++ V+++ND  P F S   Y  SV E  +   ++  V A DAD G N +         F+I + G   L                +D E   +++  + A D         + +++ V DVNDE P+++   + + + E+   G  V  +   +       + +  I    K   T H T  L       ST +L  Y+ + + +               +  D G +  L+    + + V D+ND+ P+F  P +   V + E   +  ++ +  A D D G+N  + Y+   +   G      F I++ +G +   + LDRE +  Y L ++A DQ        STQ    VLDD +DN P           Y  FSI E+ P G  +G +  A D D G NA + + ++  +      +++ G L      DRE        ++ S +      T  V+         D    ++ +Y +D         N+ +   +N +Y   +++  KVG  +  ++A D DV N S + Y +
Sbjct: 1829 VTDENDNSPEFEAGSATLVEVRESAAPGTLLTVL-HATDRD-AGSNGTVSAR-AHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVT-------FRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGL-----VTSTRLLKSYERFNLTA---------------VATDHG-RPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQG-QPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNP---NWTPAVTTGPEFDPSKDRTLREVRVYLED--------INDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRI 2438          

HSP 7 Score: 85.8853 bits (211), Expect = 4.321e-17
Identity = 94/361 (26.04%), Postives = 164/361 (45.43%), Query Frame = 1
Query: 1342 SIPLNVHDINDNAPLFPSSQYQVGVKEN-NDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDRE-KKNQYMLTIVAIDQA--VHDRKSGSTQLTITVLDDNDNAPE-LREY-TDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATD-NDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSG-HPSL--KSAKTIMVEILD 2388
            S+ + + D NDNAP F ++ Y+V + E  +  G  +    A+D D G NA + Y I     +  F ID+ TG L  ++ LD E     Y+L + A DQ      R + +  +++ V D ND  P  LR Y     + E  P G  I T +A D+D G N  + + +          ++   G L   +  + +++++    + +    +G   L S ++V V +LD +DN P +FL                     N+     +S    V  +++ V+A+D N+  N + L  +   S      +  F  D ++G + +NRPL R+ +   ++ + V D+  +PS   K +  ++V ILD
Sbjct: 1157 SVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDP-VFL---------------------NLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNG--ERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILD 1492          

HSP 8 Score: 84.7297 bits (208), Expect = 1.049e-16
Identity = 127/503 (25.25%), Postives = 213/503 (42.35%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYE-KQKQYRFTLSAY-QKNDES--MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEI---IIKVNAVDADGD---NLRYILL---PMTNYFQINNDGELHLIQ--KLDFEKHQSFSFTIQATD-GEFVAESKLKITV--LDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPD-GIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLF----QAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTG--WLKLMQPLDRE--KKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFS-ILENLP-IGHYIGTLIAFDKDEG 1794
            +   ++I I D +DN P F    + + + E      + +    A D D    N  + Y +   ++A      N  G  L  +  +D+E     Y   ++A  Q  D +  +++   V++ V ++ND  P F ++ YE  +  D+S  +    I    A D D      L Y ++   P   +     DG+L + +  +LD E    ++ TI A D G     S L + V  LDV+D  P ++  P    + E      +V ++   D      N G  C      +       ++          +Y    LDRE + +  +  T     D+    +  ++I I + + D NDN+P+F    Y+  + EN+  G  L        A+D D G NA + Y++     S  F+ID   G   + L Q LDRE     +  LTI+  D     R++ + +L +TVLD NDN P     +  + +LEN P +G  +  + A D+D G
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPD-EGDNARVVYAIVSGNTAATFGIDNGTG-VLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRS-YEGPI--DVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASD-----ANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMI-VTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSL-LGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGG---RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLG 1641          

HSP 9 Score: 77.411 bits (189), Expect = 1.965e-14
Identity = 120/524 (22.90%), Postives = 216/524 (41.22%), Query Frame = 1
Query:  226 DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIV-IIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEF----SKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNY-------FQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVA---ESKLKITVLDVNDEPPSYILNP------EKLVIDETNKSGILVGQIT-VFDRDSVS-------INRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYN------IQFSVDSG-----LFVI------DSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD 1641
            D  SI P  G I         A   N   +  +A   + V V+R    +S   IV +++ D++D +P F  P  T+ + E +   + V  + A   ++    N +  Y+++G   +AF +   +      RLL     +  +++  T  A       +     + ++V+++ND  P F    + T+   ++ E + +   I++V AVD D G N  +RY  L            F+IN   G +   + LD E    +S  + A+D G+ V+      L++ + D++D  P +I+ P      +   I E +  G  VG ++   D D  +       I  G +  + N     L +    +  ++   Y +    S +    P     T    +D    R L     + + + DIND  P+F + +Y  GV  +  +G +L Q +A D D+G N+++ Y       I+ S +S      +F +        R G L+            +ML +VA D A H+
Sbjct: 1999 DKLSIGPSDGIIRV-------APGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKAT--ENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLL-----KSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVV--NITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTP---AVTTGPEFDPSKDRTLR---EVRVYLEDINDQWPVFTNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRILSILYIKHSSNSSTRMYNIFTLGRCARAGERDGILRTYDLFTAYGPGYFMLEVVAADLAGHN 2500          

HSP 10 Score: 70.0922 bits (170), Expect = 2.806e-12
Identity = 118/490 (24.08%), Postives = 206/490 (42.04%), Query Frame = 1
Query:  985 AESKLKITVLDVNDEPPSY-ILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSG--IKRQLYTNISIPLNVHDINDNAPLFPSS-QYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQ--PLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTV----NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVS--VCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAV----VKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKIT--INRPLHRDLI--GLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            A + + I + D ND  P++     E L+ +  + +G+ V  +T  D D     R +    + +      ++     T +L   K     +LD E +  G+        D      R+L +  ++ ++V D+ND  P F  S +  + V E    G ++    A+D+D G N  + Y+I        FVI    G L++ +   LDRE +  Y LTI+A D       S  T + + VLD +DN P  L    + S+ E   +   +  + A D +EG N   + + S              ++TG ++ N+  DRE+ ++    + + D+          S  + V ILDENDN P +F                     S V Y  ++      G V+ V    + A+D D    + L+Y L   +S     + F ID+  G ++  + + L R+ I  G  ++ ++V+D G     +   + V +LD+
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDN---GTGVLTAVK-----ALDFE-VSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLT-VGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSP-VF---------------------SQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSS-----AYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDV 1603          

HSP 11 Score: 55.4546 bits (132), Expect = 9.121e-8
Identity = 65/252 (25.79%), Postives = 113/252 (44.84%), Query Frame = 1
Query: 1651 GSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFS-NQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSN-VDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLI--GLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            GS ++ IT++++NDN P   L  Y + S+ EN  +G  +  ++A D D G   ++ +  S D      +++    L S     D E   +    +   D   G    +   V +N+LD NDN P   ++++D        +  T  E+ N +  VV+             V+ATD D    +Q++Y +  +++ +   SI  +    G +T+ R L  + I  G   + +M  D G P L S  T +VE+ D
Sbjct:   12 GSARVHITLINENDNRPIFSLPLY-NVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDS--DKFSLDPASGLISVAAALDFEATPRFTVTVMARD---GGGQETAGRVRINLLDVNDNTP---VFQRDS-------YVGTARENDNSLTPVVR-------------VRATDEDSPPNNQITYSILPTSAYSSYFSI-TVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFD 233          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 207.994 bits (528), Expect = 2.146e-54
Identity = 215/776 (27.71%), Postives = 347/776 (44.72%), Query Frame = 1
Query:  106 FDGVQKFTIEENQPIKTFVGRIKFA-KQIDEELSYSFGLIT----DIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHS-AFNLEEHN---SRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAES---KLKITVLDVNDEPPSYILNPEKLV--IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYT-NFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMV 2376
            F G  +F I E+ P  T VG++    + I    + ++ +I+    + F +DP+SG +     +D E +   +   K S   S       Q+++ +   I + +LD++DN P FEK  F+ EI+E     + V+ +    DKD    N  I   +SG+ S  F ++      S+ P       +DYE    Y+ T++A      S SA   V + ++N+ND  P F       S+ ED++++  ++K+NA D+DG  L + ++     + F+I+ + G + + ++LD E   +++  ++AT+     ES      I VLDVND  P  + NP      + E    G  V ++T  DRD        K T   +E       K +++    L+    T   LDRE   D   Y+      D G   Q     +I L ++D+NDN+P F  S+Y + V EN   G  + +  A+D D G N  +TY+I        F IDS TG + ++  +DRE    Y LTI A D  V    S +  + ITV D+NDN+P      T + I E + IG  +  + A D+DEG NA++ + +              G L   +  +RE        I+ SD     ++TS   + V + D NDN P +F    +  + I S+  N+    S                 +  V A D+DV   + L Y + +   E      F I+  SG I    PL  +      ++V   DS + + K+  TI V
Sbjct:  790 FTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGS------PQQSITA--SIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVE-DKD-EGSNGAITLSLSGEGSDNFTIDSTGFVLSKTP-------LDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP--VFNPGSYAKSLHENLPIGQTVAKVTATDRDE---GENAKVT---YELSVGDTSKFEVNPATGLVT---TKRPLDRE---DQASYSLRVTAMDHGKPSQSAV-AAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVS-TAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRG-SPMMTSDKELTVVVNDVNDN-PPVF----NSQSYIGSVRENSAQSTS-----------------VLTVAADDSDVGANAVLRYSIISGNDEKR----FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKY-TAKTNVTIRV 1504          

HSP 2 Score: 192.2 bits (487), Expect = 1.612e-49
Identity = 213/781 (27.27%), Postives = 343/781 (43.92%), Query Frame = 1
Query:  115 VQKFTIEENQPIKTFVGRIKFAKQIDEELSYSF--GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMS-GDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMT----NYFQINND-GELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE--YTDFSILENLPIGHYIGTLIAFDKDE-GE------NARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVS-VCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
             Q  +I E+  I T V ++         L++    G     F ID  SG I   K +D E     +   + + T S   +V    T        I +LD++DN P F    +   + E +     V  +  A D+D   +N ++ Y +S GD S F +          R L   D E Q  Y   ++A      S SA   +TL + ++ND +P+FS++ Y  +V E+ +    I++V A D D G N R     ++    N F+I++  G + ++  +D E   S++ TI A D     +V+ + + ITV D ND  P +  N     IDE    G  V  +T  DRD  S N  +  +    +T A  +        +L + K      ++RET+P    YT  I         + ++  + + V+D+NDN P+F S  Y   V+EN+     +    A D D+G NA++ Y+I    D   F I+S +G +    PLD E+K+QY L + A D     + +  T +TI V++ ND  P   +  YT  S+ EN P    +  + A D+D  G         +   K S+D         ++G + +  V DRE  S    Q++++D+  GN   S+++ V + ILDENDN P+                   +   S    +++ S      F +A   ATD D    ++++Y L        +   F I   SG IT+ +PL R+      + +   D G P   S+ TI V ++DI
Sbjct: 1001 AQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNAT--------IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKV-TATDRD-EGENAKVTYELSVGDTSKFEVNPATGLVTTKRPL---DREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGS-NAQVFYSIVRGDTSAFAI---NAMNGVLTVKK-----EINRETVP---TYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS----KYTAKTNVTIRVINLNDITPAFTQQNYT-ASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQ--------RSGIISTADVLDRELVSLYAIQVRVTDA--GNPPLSNLTWVTIKILDENDNSPK-------------------FDSSSYSSSILENSAPSSFSFKLA---ATDADEGTNARITYNLS-------RNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDI 1712          

HSP 3 Score: 184.882 bits (468), Expect = 3.436e-47
Identity = 189/686 (27.55%), Postives = 303/686 (44.17%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR--YILLPM-TNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD---SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTV-HSLD---RETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFS--ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +VI + D +DN PEF    +   I+E      + I    A D+D S  N  I Y +    + F +   NS+   +R +  +D+E +  Y   +SA+     +        + V ++ND AP F+ ++Y+  VYED+++  I+ ++ AVD D G N R  Y L+   T+YF +++ G +      D E   S+   ++A DG       ++ ++I +LDVND  P +        +DE    G  +  +T  D+D   +  +        TNH   A  L+          +  + TV  SLD   R +   G+  T     D G    L     + +NV+DINDN P+F  S YQ  VKEN   G Q+    ATD D   N  + + I    D G+F ID  TG + + +  D E K +Y LT+ A D+ V   K  + Q+TI + D ND++P     +++S  I E+  IG  + T+ A D D G   R+ ++L   ++     ++  +GS+  +   DRE       Q++  D       +S   V + + D NDN P               +F           YV ++S     G  I  V ATD D ++   + Y L +         +F I+  +G IT+   L  +      V V  +D G PS  S   + V + D+
Sbjct:   56 VVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIV--TATDRD-SGTNAAITYSLFSGENKFMM---NSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVP----LITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNH---AFTLDA---------VTGVVTVSRSLDFEQRSSYALGLSVT-----DRG-SPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVP-VKYDTAQVTIFIEDVNDHSPVFSP-SNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGS-TSRSSSTRVTIALQDINDNSP---------------IFQGP--------YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD------NTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDV 678          

HSP 4 Score: 180.259 bits (456), Expect = 1.017e-45
Identity = 173/683 (25.33%), Postives = 313/683 (45.83%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRY---ILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKT-GSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +  ++ I I++++DN P F  P     I E +     V+ L  A D D +    +I    +G  S+F +++ +     + +   +D E    Y   + A +   +  S   N T++V+++ND AP F+   Y +S++E++ + + + KV A D D G+N +    + +  T+ F++N   G +   + LD E   S+S  + A D    ++S    + +T+ D+ND  P +  +   L + E   +G  + ++   D D+ +  R      + +   A R++            ++  V  +DRE +     Y   I   DSG+   + T   + + V D NDN+P+F S++   G+ E   IG ++    ATD D G NA + Y+I    D+  F I++  G L + + ++RE    Y LTI A D+      +   +LT+ V D NDN P     +   S+ EN      + T+ A D D G NA + + +   +  +   +N T G + +    D E+KS+   ++  +DS      T+  +V + +++ ND  P              +     YT           S+RE      +VVK + +D ++   LSY +      +     F ID++SG I+    L R+L+ L  ++V V D+G+P L +   + ++ILD
Sbjct:  979 ATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKL-NATDSDGTPLTFDIVEGNAG--SSFKIDQSSGL---ISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDS--------TTGRITVVGVVDREALAS---YNLTISAKDSGVPPWVSTAF-VAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSI-VRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRG-SPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSK----YTAKTNVTIRVINLNDITP--------------AFTQQNYT----------ASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDK----FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILD 1609          

HSP 5 Score: 177.563 bits (449), Expect = 7.053e-45
Identity = 183/661 (27.69%), Postives = 313/661 (47.35%), Query Frame = 1
Query:   70 QILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN--YFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSV-SINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNIS-IPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTV-NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQ 2016
            Q  Y  ++  N  +G     +  + P     GR+ ++      +S + G   + F ID  +G I  + V+D EAL         S  ++++   +     +S   + I + D +DN P F   E +  I E +   + V  +  A D+D    N ++ Y +  GD SAF +   N     L +  +I+ E    Y  T+ A  +    M+++  +T+ V ++ND  P F+   Y  SV E+ +    ++ V A D+D G N  LRY ++   +   F+IN+  G +     LDFE+   +   + ATD ++ A++ + I V+++ND  P++        + E + +   V +++  DRDS  S++  I   + +      +   DQ S  I       T   LDRE +   +        D+G      +N++ + + + D NDN+P F SS Y   + EN+      F+  ATD D G NA ITYN+  +     F+I + +G + L QPLDRE K+ Y L I A D     + S S  + +TV+D ND+ P +   +   S+ EN P   ++  ++A D D G NA + F L  +      T+ N TG + +    DRE+++    +I ++D   GN  L+S   V ++++DE+DN P+
Sbjct: 1205 QSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI-----ISGNHG---NAFRIDSTTGRITVVGVVDREALA--------SYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVV-TATDRD-EGSNAQVFYSIVRGDTSAFAINAMNGV---LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSD-----KFSIDQRSGII------STADVLDRELV--SLYAIQVRVTDAG--NPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN---DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQAS-SITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADK--GNPSLSSVADVIIDVIDEDDNCPR 1823          

HSP 6 Score: 174.096 bits (440), Expect = 8.444e-44
Identity = 203/775 (26.19%), Postives = 353/775 (45.55%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDEE---LSYSFGLI-TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHS-AFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRY---ILLPMTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGE---FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDS-VSINRGIKCT--ETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPD-GIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE---KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            ++ EN PI   V ++    + + E   ++Y   +  T  F ++P +G + T + +D E        D+ S ++ +    + + +  +V  I + I D++DN P+F + ++T+ + E     + ++ + A+ D D     +     +SG+H  AF ++   S   R+ ++  +D E    Y  T+SA         +   V + V + ND +P F+       + E +S+   +  V A D D G N +    I+   T+ F IN  +G L + ++++ E   +++ TI+A+D       ++ +L + V DVND PP  + N +  +      S      +TV   DS V  N  ++ +    N E    R + +  S  I+      T   LD E     G+  T     DS  K    TN++I   V ++ND  P F    Y   V+EN+     + +  A+D D      ++Y+I    DS  F ID R+G +     LDRE  + Y + +   D A +   S  T +TI +LD+NDN+P+        SILEN     +   L A D DEG NARI + LS +  +  +    +G +   Q  DRE KS     IQ  D        S +++ V ++D ND+ P           LINS               ++ S+RE   K   V+ ++ A+D D    ++L++ L +    N  +S+F +D  +G I+   PL R+   +  +++ V D G+PSL S   ++++++D
Sbjct: 1107 SLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDRE--------DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLAS-DPDAGANGRVTYSIISGNHGNAFRID---STTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP--VFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK---RFKINSTSGVIM------TTTPLDFEEKSQYGLEVT---ATDS--KYTAKTNVTI--RVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTD-AGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAF--MIGASSGVITLAQPLDRENKSTYDLAIQARDHGT-PPQASSITIRVTVIDINDHRP-----------LINS-------------SSLRGSVRENQPKETHVMRIL-ASDADTGLNAELTFSLLS----NEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 7 Score: 171.785 bits (434), Expect = 4.289e-43
Identity = 188/746 (25.20%), Postives = 313/746 (41.96%), Query Frame = 1
Query:  196 ELSYSF--GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGD---NLRYILLP--MTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTS-HVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +L YSF  G     F++D  +G +   + +D E         + S  + L+V       L     ++I + DI+DN P F    +   +KE       V    +A D+D S     +   + G D   F ++   S G  + +    DYE + +Y  T+ A  +          VT+ + ++ND +P FS + Y + + E   +   ++ V A D D      L Y L+   +   F I+ N G + +  +LD E   S+S  ++A DG   + S    + I + D+ND  P +   P    + E++  G  +GQ+   D D  S          N +  ++      ++    L Y+  T + +                 D G   +    + + + V D+NDN P F  S Y   V EN   G  +    ATD D G N  I+Y+I    ++  F +D  TG +    PLDRE    Y LTI A D ++  R   +T + I++ D+NDN P     + F+I E+ P G  +G L A D+D G N  + + +   +      ++ ++G L      DRE        ++ SD+  G+   S   S+ V++LD NDN P+   +EK       SLF+    E ++V   V              VK  D D  +   ++  L    S+N     F ID  +G +    PL  +     ++ V   D G PS  +   + + I+++
Sbjct:  305 DLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFE--------QRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQV----SATDRDSSTNGALVFGIIKGNDDGVFTID--GSTG-IISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMV------------TVTAKDGGTPSRSSLTV-VKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLV-RFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDA--GSPQQSITASIHVSVLDVNDNAPR---FEK-------SLFSGEIREDASVHSTVLQ------------VKVEDKDEGSNGAITLSLSGEGSDN-----FTID-STGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINV 990          

HSP 8 Score: 169.088 bits (427), Expect = 2.742e-42
Identity = 195/757 (25.76%), Postives = 326/757 (43.06%), Query Frame = 1
Query:  187 IDEELSYSF-GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHS--AFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINND-GELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVL--DVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIY-------KLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE--YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            I+  LSYS     T  F++D + G I T    D E         K S  ++L        +      + I ILD++DN+P F   ++T  + E +     ++ + A+ DKD +  N ++ Y  +  ++  AF L+         R L   D+E++  Y   LS   +    ++   ++ + V +IND  P FS + Y+  V E+        +V+A D D      ++  +        F I+   G + + +  D+E    +  T+QA D G  V     ++T+   DVND  P +  +     I E+   G  V  +T  D DS    RG             RLE   +S ++   +        +     LDRET P    Y+  +    G      ++  + + + DINDN+P+F    Y   V E++  G+Q+ Q  ATD D   N  + Y +  + D  +F I++ TG + L   LD EKK QYM+T+ A D     R S  T + + V D NDN P+  +  YT  ++ ENL  G  +  + A D D G N +I + +   +      +++ TG + +    DRE  +     I   D ++   + +  +V ++I DENDN P                   T+T  S  +    +S     G  +  + ATD D+     ++Y +    S N Q + F +D +SG +++   L R+ I    + V   D+G P      +I V +LD+
Sbjct:  199 INARLSYSLVSGDTSYFTVDSQ-GVIRTKGAFDRET--------KASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTAS-DKD-NGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSL---DFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG---TQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGP--RG-------------RLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPS---YSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD--VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSS-LTVVKVMVDDVNDNPPQFAKSLYT-CTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAA-TTVNISIADENDNQP-------------------TFTGPSRFN----ISEDSPTGTRVGQLTATDRDIGPNGAVTYAI---ISGN-QGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDV 887          

HSP 9 Score: 140.198 bits (352), Expect = 2.132e-33
Identity = 162/598 (27.09%), Postives = 259/598 (43.31%), Query Frame = 1
Query:  628 DYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKS----GSTQLTITVLDDNDNAPELREYTDFS-ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            D E + +YR T+ A    +        V + V + ND APEF    Y  ++ E+    ++ I V A D D G N  + Y L    N F +N+  GE+  +  LD E   S++  I A DG+      L ITV DVND  P + L+  K  + E    G +V Q+T  D D V IN  +  +  + +T    ++   +         + T  + DRET      Y   +    G         ++ + + D+NDN P+F S+QY   V E+  IG  +    A+D+D G NA + Y+      +  F +D+ TG + + + LD E+++ Y L +     +V DR S     ++ L I V D NDN P        S + EN P G  +    A D+D   N  ++F +   +     T++  TG +   +  D E K++    +Q  D  +  V      V + I D ND+ P +F                     S  +Y  ++     +G  +  V ATD D     +L Y L    S N++ + F+ID  SG I ++  L R+      ++V   D G  S  S+  + + + DI
Sbjct:   29 DRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD-VGINARLSYSLVSGDTSYFTVDSQGV---------IRTKGAFDRETKAS---YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGL-----SVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGV-PVKYDTAQVTIFIEDVNDHSP-VF---------------------SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL---ISGNVKGA-FNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDI 576          

HSP 10 Score: 123.25 bits (308), Expect = 3.474e-28
Identity = 141/543 (25.97%), Postives = 245/543 (45.12%), Query Frame = 1
Query:  223 TDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SG-DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADG-DNLRYILLPM--TNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLK---ITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTV----HSLDRETIPDGIIYTNFICYDSGIKRQLY------TNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR--EYTDFSILENLPIGHYIGTLIAFDKD 1788
            T  F+I+  +G +   K I+ E +         + T+++  +      + S  ++ +++ D++DN P F    +   ++E   +   V+ + AA D D+   N  + Y + SG D   F +   NS    +     +D+E++ QY   ++A    D   +A  NVT++V+N+ND  P F++  Y  SV E+      ++KV+A D D   +L Y ++    ++ F I+   G +     LD E    ++  ++ TD      S L    I +LD ND  P +  +     I E +                 S +  +  T+ +  T A R+  +    D  +I     V      LDRE         N   YD  I+ + +      ++I+I + V DIND+ PL  SS  +  V+EN      + +  A+D D G NA +T+++  +    +F +D+ TG +    PLDRE++  Y L I   D+  +   S    + I V+D++DN P  +  EY + +I E+LP G  I  + A D D
Sbjct: 1352 TSAFAINAMNGVLTVKKEINRETV--------PTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTV-AADDSDVGA-NAVLRYSIISGNDEKRFKI---NSTSGVIMTTTPLDFEEKSQYGLEVTA---TDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPS--------------SFSFKLAATDADEGTNA-RITYNLSRNDAFMIGASSGVITLAQPLDRE---------NKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKG-NPSLSSVADVIIDVIDEDDNCPRFQPTEY-NVTISESLPRGASIVQVTARDID 1852          

HSP 11 Score: 92.0485 bits (227), Expect = 1.129e-18
Identity = 93/304 (30.59%), Postives = 137/304 (45.07%), Query Frame = 1
Query: 1498 YNIQFSVDSGLFVIDSRTGWLKLM-QPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL-SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIRE--KVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            Y+I    D G+F IDS TG +    +  DRE +++Y LT++A D A    K G T + I V D+NDNAPE  L  Y  F+I EN P    +  + A D+D G NA I + L S ++ +  +  +KTG + +    D E K     +I    SA     T+ V + + + D NDN P   L                         V K  + E   VG ++  + A D DV   ++LSY L +        S F +D + G I       R+     +V +  +D G PS     T+ +EILD+
Sbjct:    1 YSIMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHK-GRTVVVIDVKDENDNAPEFPLNSYV-FNIRENTPAAQ-VAIVTATDRDSGTNAAITYSLFSGENKF--MMNSKTGEIRTVTPLDHETKDSYTMRI----SAFDGKHTTFVPL-ITVDDVNDNAPFFAL------------------------SVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSG-----DTSYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDV 264          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 191.045 bits (484), Expect = 5.684e-49
Identity = 199/773 (25.74%), Postives = 348/773 (45.02%), Query Frame = 1
Query:  127 TIEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT-----NYFQINN-DGELHLIQKLDFEKHQSFSFTIQATD-GE--FVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQS 2400
            T+  + P     G I+++    + L     +    FSID  +G I T + +D E L        +     +      + +L   M + I +LD++DN P FE+  +  +I E     + V+ + A+ D D S  N E+ Y +    GD+SAF++ E +     + ++  +D EK   Y   + A  + +   SA + V + ++++NDC P+FSK +Y  ++ ED+ +++++  V A D D  +   +   +      N+F IN  +GE+ + QKLD+E    F+  + A D G+     ++ + I ++DVND  P ++ +  + +I E    G    ++  +D+D            TN E     ++ D   +       +     LDRE +P    +T  I   D G+  +  T   I + + DINDN P F   +Y   + EN+  G  + Q +A D D G   ++   +  S     F I+ + G + L   L+   K+ Y+ ++ A D  +    S +  + + V D N +APE  R      + E+  +G  + T++A D+D G NA+I +  S+  L    +V++ TG + +    DREK      ++  +D  I   L +   V ++I D NDN P +FL    E                     V+  IR   G  +  V A+D D+   +Q+ Y     AS    Q  F ID   G I   +PL R+ I   ++ V+  D G P  +++  + V + D+  S
Sbjct:   41 TVSASDPDSGSNGMIRYSMSPSQNL-----MSATYFSIDQITGVITTKRGLDREFL--------DRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRAS-DAD-SGSNGEVKYCILNSDGDNSAFSIGEVSGA---VTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDH----------GTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPK---FTFGIKARDKGVPFKEGT-AQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASDGML----SSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISY--SIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQ-LKAKSFVYIHIADVNDNDP-VFLKPSYEAK-------------------VREDIRP--GGRVIEVSASDADIGKNAQIIYSF---ASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDS 748          

HSP 2 Score: 115.931 bits (289), Expect = 5.823e-26
Identity = 140/560 (25.00%), Postives = 249/560 (44.46%), Query Frame = 1
Query:  382 KIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR--YILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRD---------SVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREY-TDFSILEN--LPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFS--NQVFDREKKSKVCTQIQLSD-----SAIGNVLTSHVS 1974
            +I I +LDI+DN P+F + E+   I E       V+ +  A+D D    N  + Y +   SG    F +   N +G  + L   ++Y  +  Y F++SA   +D  +S+   V + V + N  APEF +  Y   V ED SL   ++ V A D D G N +  Y +  +   F ++   G +     LD EK  ++ F + ATD    +  A+S + I + DVND  P ++    +  + E  + G  V +++  D D         S + N   + T T   TQ +                + T+  LDRETIP+  +    +  D G       ++ + + + D+ D+ PLF    Y+V V E+      +   +A  +D+     + Y+I       +F I+  TG ++ +  LD E +++Y LT+ A            T + + + D NDN P L  +  + ++ E    P   Y   + A+D D  +  ++ FK+   +  + +T+N T    S   ++    K + +  +I ++D     SA G+++ + V+
Sbjct:  427 QITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQV-KAIDPDSGPTN--VVYSIVSSSGHDRCFRI---NPQG-LITLSCTLNYNTKHVYVFSVSA---SDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGI----------------IRTLKPLDRETIPEYEL--TVVATDQGTPPG-QASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFFTE----TTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARY--KIPAYDPDVSD--KLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPANI--KIAVTDGLRTASATGSIMMTSVT 947          

HSP 3 Score: 105.531 bits (262), Expect = 8.788e-23
Identity = 114/460 (24.78%), Postives = 197/460 (42.83%), Query Frame = 1
Query: 1030 PPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIK--CTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS-VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-YLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            PP +    E   + E  + G +V  ++  D DS S N  I+   + + +   A     DQ++  I       T   LDRE +            + G +  L   + + +NV D+NDN P+F  + Y   + E+  IG  +   +A+D D G N  + Y I  S  D+  F I   +G + +M+ LDREK   Y L + A DQ  +  +S +  + IT+LD ND  P+  ++    +I E++P+   + T+ A D D+G N  + F++   +     ++N+  G +   Q  D E        +   D      L +  +V + ++D NDN PQ           ++S F     E    +Y V              V+A D D     ++++ +++N          F I++ +G I+I   L R+ +      +   D G P  +    I + +LDI
Sbjct:   17 PPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGS-NGMIRYSMSPSQNLMSATYFSIDQITGVIT------TKRGLDREFLDRHFFRVK---AEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQG-NPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKG-QPFLYNQTTVDIALIDVNDNAPQ----------FVSSHFQTMIPE----NYAVGQEFYR--------VQAYDKDHGTNGEITFSFMQNDLP-------FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDI 435          

HSP 4 Score: 94.3597 bits (233), Expect = 2.099e-19
Identity = 93/349 (26.65%), Postives = 157/349 (44.99%), Query Frame = 1
Query: 1372 DNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS---VDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFK-LSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSH-VSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGF--VIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +N P F   Q    V E+ ++G  +    A+D D G N +I Y++  S   + +  F ID  TG +   + LDRE  +++   + A D        G   LTI VLD NDN P   R      I E+  IG ++  + A D D G N  + +  L+ D      ++ + +G++   +  DREK      Q+Q  D   GN   S  V+V + +LD ND  PQ   + K                      V   +IRE V    ++  V+ATD D  +  ++ + + +    N     F I++ +G++ + + L  ++IG+  + V  +D G P L +  T+ + ++D+
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGG-EPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQ--GNPPRSATVTVKITLLDVNDCTPQ---FSKK---------------------VYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNF----FSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDV 332          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 189.119 bits (479), Expect = 1.584e-48
Identity = 217/780 (27.82%), Postives = 362/780 (46.41%), Query Frame = 1
Query:  130 IEENQPIKTFVGRI-KFAKQIDEELSYSF--GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLIS-VMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLP-MTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAE---SKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFI-CYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKD-EGENARIMFKL---SMDHLYQPLTVNKTGSLFSN----QVFDREKKSKVCTQIQLSDSAIGNV-LT---SHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + EN  I T V +I    K I + +SYS   G    +F+ID  +G+I T+  +D E +              L V       L+S ++K+V+ + D++DN P F  P +T+E  E       ++ +  A+D DI   N  + Y +  + + + +  +   G        +D E ++ + FT+ A      S S+  +V +++V+IND +P F+ T Y   V E+      ++ V A D D G N  L Y+L   +   F I+ D G +   + L+ E+  S++ T++A D    A    +++ ITV D ND  P +  +     + E  K G  VG++   D D ++ N  ++   ++  T +L    ++ +        + T  +LDRE       YT  I   D GI   L +N S+ + + D+NDN PLF  S Y V ++E+  +  Q+ Q  ATD D G N   TY I       +F ID+ TG + +   LD EK + Y LT+ A D       +G+  + I V D +DNAP   +      + EN+  GH++ T+ A D D E  + R+ +++   + D ++  L   ++G +  N       +RE  ++   Q+    +AI  V LT   S V   + +LD NDN P+      D  + + S+  +T                      I  VKA D D     ++ + +  S +EN    +F +D K+G +T  RPL R+      + VM ED G P+L S+ T+ + +LD+
Sbjct: 1201 LSENASIGTNVTKITALDKDIGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVT----------QYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQV-KAIDADIG-DNAAVLYSIVENVTDY-VTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDED-INDNARVRYYISSGNT-SLMFSVNETTG------IISTTSTLDRE---QNASYTLIITAKDHGIP-ALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPL-TGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMF--LIGEQSGVITLNCTPSGCLNRETHARYELQV----AAISRVNLTEQKSLVPAVITVLDVNDNAPRF-----DSESYVRSVLEDT---------------GPITDATILTVKAQDGDEGESGEIIFTIV-SGNEN---GVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDM 1924          

HSP 2 Score: 139.043 bits (349), Expect = 4.161e-33
Identity = 178/681 (26.14%), Postives = 293/681 (43.02%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANM-NVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TG--SLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD----IPQ 2397
            +VI + D++DN P F + ++  ++ E       V+ + A+ D+D    N +I Y+++  +       +N  G  + +   ID E    +  T+ A  + + S       V + V + ND  P+FS T YE  + E+  +   I  V         LR    P                               +A      A  K  IT+  +NDE P +  +   + + E+   GI++G++T  DRD   IN  I  +    E    +    + + DI++         LDRE      +Y   +   + +     T   + + V D+ D+ P F SS   V + EN  IG  + +  A D+DIG    I+Y+I      GLF ID+ TG ++ +  LDRE   QY L + A D    +  S   ++ + V D NDN P   +  YT     E  P G  I  + A D D G+NA +++ + ++++   +TVN  TG  SL S+Q  DRE +      I+ +DS + +  +S  SV + ++D NDN P               +FNNT       DY   +   +  G  + VV A+D DV   ++LSY L       +  + F ID  +G IT   PL+R+  G   + +   DS   + +    +++ + D    +PQ
Sbjct:  906 VVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHAS-DRD-QGANGKITYKLTNGNKDDAFSINNVTG-EITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSP-------------------------------RAPAALLTAREKRPITL--INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDE-GINAIIFYSSNGAEA---KFYVSRSTGDIIVD------SPLDREF---KNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSV--NLVSDLLKVVVQVEDVNDNPPVFSMPGYT-IEYWEESPEGTSILQVKAIDADIGDNAAVLYSI-VENVTDYVTVNAITGVISLGSSQ-LDREVEEYFNFTIRATDSGVPS-KSSTASVAIKLVDINDNSP---------------VFNNT-------DYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL-----SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQ 1502          

HSP 3 Score: 138.272 bits (347), Expect = 8.210e-33
Identity = 174/692 (25.14%), Postives = 295/692 (42.63%), Query Frame = 1
Query:  367 LISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDH-SAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN---LRYILLPM----TNYFQIN-NDGELHLIQKLDFEKHQSFSF---------------------------TIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA---LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLI-----AFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSL-FSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFV---IAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            L S   ++I + DI D  P F +  +  EI+E     + V+ + A  D D+ + N  +   +SG+    F ++ +      + +   ID EK   +R T+ A +  D + +  + V + VV++ND  P F +++Y   V ED++L   ++       DGD     R +L  +    ++ F I+   G L++ + LD+EK  +F+F                           T   T  +F A + + +T+++VND  P +  +     +DE    G  +  IT  D D  +   G    E      A   +  +   +S   +L Y     +              + +  D G   Q     ++ + + D+NDN P F    Y   + EN   G  +FQ  ATD+D G+N  +++NI    D G F I+  +G +   + LDRE    Y LT+ A D  V  R     QLT+ VLD+NDN P++ +    +I  N+  G   GT++     A D D G N ++ + +S        T+N  TG L  S    DRE K      I ++D+      T+  +V V ILD NDN P                  +     S   YV+  ++ E  G +   +  + ATD D +   +++Y L        +   F +D  +G++++ + L R+
Sbjct:  133 LESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEAR-DGDVGINNPILYEIISGNSDGVFTIDSNTGV---ITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTF--GALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQF------------SLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHK-HVQLTVNVLDENDNTPQITD--GLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD--SRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNG-SPPNTNSTTVHVTILDVNDNTPAF----------------DPNPAQSLATYVI--TVDEGPGTINKTLIDINATDPDADANGKVAYSLSGD-----EHGFFRLDPVTGELSVRKELDRE 776          

HSP 4 Score: 137.502 bits (345), Expect = 1.552e-32
Identity = 162/630 (25.71%), Postives = 283/630 (44.92%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQ---IDEELSYSF-GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA--FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMT----NYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD---GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGII----YTNFICYDSGIKRQLYTN----ISIPLNVHDINDNAPLFPSSQYQVGVKENNDIG----YQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR---------EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKT-GSLFSNQVFDREKKS 1908
            + ENQP  T V  +  + +    + +LSY   G++   F+IDP +G+I T + ++ E        +  S T++L    +  +      +++I + D +D+ P+F +  +   ++E +   + V  + A  D+DI+  N  + Y +S  +++  F++ E          L   D E+   Y   ++A      ++ +N +V + + ++ND  P FSK++Y  ++ E + L   +++V A D D G N ++          + F I+ N G + +  KLD+EK   ++ T+ A D           ++I V DV+D  P +        + E    G  V  +   D D+          E +H+    R+E     + + LI +   V +L+    P G +    +  +    + I R   T     +   + V D+NDNAP F S  Y   V E  D G      +   +A D D G++  I + I    ++G+F +D++TG L   +PLDRE  + Y L ++A D+      S S  + ITVLD NDN P L+           T FS+ ENL  G  +G + A D D      I + ++     +   +N+T G L +    DRE  S
Sbjct: 1408 VRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNRE--------ETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRV-ATTDEDIN-DNARVRYYISSGNTSLMFSVNETTGIISTTSTL---DREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDA----------EASHKRVYYRIESGNTDS-MFLIGEQSGVITLN--CTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLE--DTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKG-EPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKN--LIYYYITNTEEQKYFILNETSGELRTRITLDREDSS 2006          

HSP 5 Score: 131.339 bits (329), Expect = 9.948e-31
Identity = 177/674 (26.26%), Postives = 293/674 (43.47%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLEEHN----SRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR---YILLPMTN-YFQINNDGELHLIQK-LDFEKHQSFSFTIQATDGEFVA---ESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVS---INRGIKCTETNH-----ETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDI-GKNALITYNIQFSVDSGLFVIDSRTGWLKL-MQP---LDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENL-PIG-HYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRD 2295
            S   + I ++DI+DN P F   ++   ++E       V+ + A+ DKD+   N +++Y +SG  ++ F ++       +R P       ++ E+   Y  TL A      +      V + V + ND  P+F+++ Y  SV ED+ +   + +V   D D  DN R   YI    T+  F +N    +      LD E++ S++  I A D    A    + + IT+ DVND  P +  +   + + E+      V Q+   D D  +       I   +T+          L   K ++  +   +Y L TV + D  T P         C+             + ++V D++DNAP+F   +Y   + EN   G+ +    ATD D    +  + Y I+      +F+I  ++G + L   P   L+RE   +Y L + AI +     +       ITVLD NDNAP    E    S+LE+  PI    I T+ A D DEGE+  I+F +   + + ++Q    NKTG L   +  DRE  S     +   D      L+S V+V + +LD NDN P   + +     LI      T++   N+D           G  + VV A D D  N+  + YY+ N+     +Q  F +++ SG++     L R+
Sbjct: 1381 STASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTAS-DKDVGT-NAKLSYVLSGVLYTRFAIDPDTGNITTREP-------LNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNL-TVSAQDLGTPP-----LTGACF-------------VEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQ--MDNKTGVLTRTRPLDREDTSFYSLVVMAEDKG-EPALSSSVTVNITVLDMNDNLP---ILQTPMDVLIPER-RTTFSVKENLD----------AGVPVGVVAAQDLDTKNL--IYYYITNTE----EQKYFILNETSGELRTRITLDRE 2003          

HSP 6 Score: 130.954 bits (328), Expect = 1.534e-30
Identity = 186/798 (23.31%), Postives = 330/798 (41.35%), Query Frame = 1
Query:  199 LSYSFGLITDIFSIDPKSGDIHTLKVIDLEA---LCFN---------------SCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSA------YQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMTN----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSG---ILVGQITVFDRDS-------VSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF---PS---SQYQVGVKEN-NDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKK---------NQYMLTIVAIDQA--VHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSD 2406
            L +  G  +D F+IDP SG ++  K +D E      F+               +   +E   ++   + + +    +   + + +++++DNKP F K  +   + E I     +  +  A D D+      + Y + G  +A F++   N      ++L   DY+  +QY+F+L        YQ   E   A + VTLQ VN ND  PEF+   Y   + E++    I+ +V A D D G+N R            +F IN  G +   ++LD E   +++ T+ A D    +  K   L + VLD ND  P  I +   +  + +  +G   +L+  I   D D+        S++ G      N  T  L++    +  ++   Y L  ++  D  + P+    TN              + ++ + + D+NDN P F   P+   + Y + V E    I   L    ATD D   N  + Y++    + G F +D  TG L + + LDRE            +++L I A DQA  + DRKS + +++ITV D NDN+P+ +    +  + E    G  +  + A D+D     ++++ ++     +   V K    ++      +K   +C + + S             V + + D NDN P               +FN +        Y   +      G  +  V A+D D     +++Y L N   ++     F I+  +G+IT+   + R+ +    + V  ED G PS  S KT    ++ +   +D
Sbjct:  297 LYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEK--FSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADI-TATDADLGTFGA-LTYELRGGQAAYFSVNADNGTISAAQIL---DYDTLRQYQFSLVVKDGGGFYQ---EIAIATVTVTLQDVNDND--PEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQ-ITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLI-INVTDNGSPPN----TN--------------STTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGD-EHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWH----KKNCVLCKESKCS--------VERTYVVIYVDDVNDNDP---------------VFNQS-------KYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDA----FSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPS--SRKTFAEVVITVKDEND 1021          

HSP 7 Score: 127.487 bits (319), Expect = 1.664e-29
Identity = 174/731 (23.80%), Postives = 293/731 (40.08%), Query Frame = 1
Query:  370 ISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG--DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTI-YEESVYEDISLDEIIIK-VNAVDAD------------GDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEF---VAESKLKITVLDVNDEPPSYILNPEK------LVIDE----TNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETI-------PDGIIYTNFICYDSG--IKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFS-ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ---------------------------------------------IFLYEKDETTLIN---SLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDL 2298
            I++  + + + D++DN PEF    +T +I E +     +++   A DKD S +N  +++ +S   D   F++   N  G  +    ++D E    Y  T+SAY     S   ++ +T+ V++ ND  P+ +  +    ++ E      +++  + AVD D            G + R+ L   T   QI+  G       LD E   S+   I  TD         + + +T+LDVND  P++  NP +      + +DE     NK+ I    I   D D+   N  +  + +  E    RL+         +  +L     LDRE+         DG    +    D    I  +    + + + V D NDN+P F S  Y+  + E    G  + Q  ATD+D+     + YNI    ++    ++      KL++  +  KKN     +    +   +R    T + I V D NDN P   +    + +LEN P G  +  + A D+D+G N +I +KL+  +     ++N  TG +    V DRE        +Q  D    +   +   V + + DENDN+PQ                                             +   EK   TLIN    LF  +        Y V +S     G VI  V ATD D   ++ + +Y  N A     ++ F + + +G I ++ PL R+ 
Sbjct:  475 IAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLP-AGTIVFQVTATDKD-SGENGRLSFNISAGDDGGHFSI---NGSG-LVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTG-------LDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLI---DINATDPDA-DANGKVAYSLSGDEHGFFRLDP--------VTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVE------KLVRHYNWHKKN---CVLCKESKCSVER----TYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSM-------YYVNVSESASRGIVIGRVTATDRD-EGINAIIFYSSNGA-----EAKFYVSRSTGDIIVDSPLDREF 1154          

HSP 8 Score: 63.5438 bits (153), Expect = 6.063e-10
Identity = 154/694 (22.19%), Postives = 265/694 (38.18%), Query Frame = 1
Query:  316 KESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEK------PEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNLE----EHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDES-----MSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELH-LIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVID--ETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDF-SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDS 2337
            K+S  + +NV  N      +   + + ILD++DN P F+         + + + E     N  +    A D D    N ++AY +SGD H  F L+    E + R    R    +    Q   RF L     +  +      SA + V++ V + ND +P+F    YE  + E       +I+V+A D D +    ++  +T+  + N   E+  L++  ++ K       +       V  + + I V DVND  P  + N  K   D  E + +G  V ++   DRD    N  I    TN         KD   +   +  ++     +DRE +   ++       D G      T   + + V D NDN P F  + Y+  + EN+ +G  +      D+ I  + L                          +P    +    +LT                +  IT++  ND +P   +   + ++ E+   G  IG + A D+DEG NA I+F  S     +      TG +  +   DRE K+     +  ++   G   T+   V + + D  D+ P                FN++          VK+S    +G  +  + A D D+ +   +SY + N     L    F ID  +G+I     L R+ +   ++ V  +DS
Sbjct:  667 KDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDAD-ANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDE-NRKCEVEKLVRHYNWHKKNCV---LCKESKCSVERTYVVIYVDDVNDNDP--VFNQSKYAADVLENSPTGTPVLRVHASDRDQ-GANGKITYKLTNG-------NKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQ--AEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTI--TMVPDQKISSSTL--------------------------RPRSSPRAPAALLT-------------AREKRPITLI--NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINA-IIFYSSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTT-TQVHITVTDVIDDKP---------------YFNSS-------SLTVKLSENASIGTNVTKITALDKDIGDT--ISYSIANGDPYGL----FTIDNVTGEIRTVAELDRENVTQYELFVQAKDS 1270          

HSP 9 Score: 62.003 bits (149), Expect = 1.742e-9
Identity = 109/482 (22.61%), Postives = 195/482 (40.46%), Query Frame = 1
Query: 1003 ITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNH-ETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPI-GHYIG-TLIAFDKDEGENARIMFKLSMDHLYQP----LTVNKT-GSLFSNQVFDREK----------------------------KSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSG 2340
            + V D ND  P +   P    I E  + G  + +I+  D DS   N  ++   +N   TQ      + ++ ++ L         LD E     ++    I  D G+ + L +  ++ + V DI+D  P F  S Y   ++EN  IG  +   +A D D+G N  I Y I      G+F IDS TG + +   +D EK + + +T+ A +    +  +  T +   V  +++    L+    F + E++ + G  +   L   D D+      +F+  + HL         ++ T G+L+ N+  D EK                            K  V T+   S+       +++ SV + +++ NDN P   ++ K                 S+ +Y +   I    G  IA + ATD D+     L+Y L        Q + F ++  +G I+  + L  D +   +  ++V+D G
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADS-GTNSQVQYKFSNATATQTPFFSLNSVNGELTL------GGPLDFEVARSYMLV--VIAEDLGVPK-LESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNP----VFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEK-----FSANASVTLTLINVNDNKP---MFAK-----------------SSYNYTMDEEITP--GTHIADITATDADLGTFGALTYELRGG-----QAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGG 469          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO41005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5N5])

HSP 1 Score: 186.808 bits (473), Expect = 8.606e-48
Identity = 211/792 (26.64%), Postives = 360/792 (45.45%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFA-KQIDEELSYSFGLITDI------FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISV----MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEH---NSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDE------SMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINN-DGELHLIQKLDFE-KHQSFSFTIQATDGEFVAESKL---KITVLDVNDEPPSYILNPEKLVIDETNKS--GILVGQITVFDRDSVSINRGIKCTETNH----ETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYT-NFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHL-YQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            I EN+P  TFV ++      I      S+ +++D       F I+ K+G I T + +D E +           T  L V  +    L ++    + +V+ +LDI+DN PEF +P +   + E       ++ + +AVD+D  + N  I Y ++      N+E      +R   L+L   +D E   ++   ++A  +  E      S++  +NVT+ V++ ND  P   K  Y  S+ E+ S+ + +I +N  D D G+N  L Y ++   + F ++N  G + L + LDFE K   F+  I+  D      S +    +TV +VND  PS+  +     I E + +    +VG ++  D D+ S N  + C +  +     T    ++KD           L  V SLDRE I +   YT + I  DS   R L     + +N+ D+NDN P+F    Y   V E+   G  + + +A D D+  NA ++Y+I        F +D+ TG +KL+  L+REK   Y LT+ + D     R+S +  + I V+D NDN+P  L +     +LENLP GH++  ++  D DE  N R+ + L+ D     P     TG + + +  DRE        +   +S   + +  + SV V ++D ND+ P   +                        Y +       VG  +  V+A D D    +++ Y L        ++S+F I+  +G +T+   L R+     +++V   D G P S  ++ TI++ + D+
Sbjct:  438 IYENEPPGTFVIQVSANDSDIGSNAMVSYAVLSDAEGHYQYFKINAKNGTITTSRRLDRENI----------TTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYNFSVIET-ALPGAILGIISAVDRDKDL-NGNIVYIIT----EGNVEGSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGHSKFVVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPL-CGKLQYTLGNSTGPFAIDKDTG--------VLRAVGSLDREGIKN---YTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVLKIRAVDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKLVSKLEREKITSYTLTVGSADGGAVPRRS-TALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDEVHNGRVEYNLTSDAFRVDPF----TGIITTTRALDRESIPAYNLMVTARNSNSSD-MEVNCSVHVIVMDTNDHTPSFTMAR----------------------YYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMG------EESLFRINYTTGIVTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDV 1167          

HSP 2 Score: 169.474 bits (428), Expect = 1.610e-42
Identity = 185/728 (25.41%), Postives = 328/728 (45.05%), Query Frame = 1
Query:  232 FSIDPKSGDIHTLKVIDLEALCFNSCADKESA-TISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEV-IHRKNMVIYLPAAVDKDISMKN----KEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMN-VTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVD---ADGDNLRYILLPMTN--YFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFV---AESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTV-NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSA 2361
            F +D  +G +   K++D E        +K +  T+++ V  + +  L  V+ + + + +++DN P F +  +T  I E      + ++ + +A D D    N     ++ Y +      F +++       LR +  +D E  K Y F++ A          N+  VT+ ++++ND  P F + +Y  +V ED S    ++K+ AVD   A   N+ Y ++       F ++N  GE+ L+ KL+ EK  S++ T+ + DG  V   + + + I V+DVND  P  + + + + + E   +G  V ++   D D V   R     E N  + A R++             + T  +LDRE+IP    Y   +   +     +  N S+ + V D ND+ P F  ++Y +   E   +G  LF+ +A D D G NA + Y +    +  LF I+  TG + L+  LDRE K QY L + A D+ + +  + ST + I V D NDN P     + D ++LE   +G     ++A DKDE  NA I++ +   +      + NK+GS+++    DRE   +    +  SD      + S  +V +++ D NDN P I                      +N   VV        G ++ ++ A+D D  + +++++     +   +    F I K +G+I +   L R+         M  DSG P   S+
Sbjct:  695 FVVDNVTGIMSLNKLLDFE--------EKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTLGNSTGPFAIDKDTGV---LRAVGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVLKIRAVDNDLASNANVSYSIVSGNTGAAFHVDNVTGEIKLVSKLEREKITSYTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDEVHNGR----VEYNLTSDAFRVDP--------FTGIITTTRALDRESIP---AYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMG--EESLFRINYTTGIVTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEG-QVGAVAAIVVALDKDEEINADIVYSIIGGNTDNSFAINNKSGSIYTLLHLDRETTDRYILTVLASDRG-EPAMNSSTNVTIHVNDVNDNKPNI----------------------TNNPGVVVTRENTPPGSLVYILSASDLDEGSNARVAF-----SGYAVPDGKFSI-KPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSS 1364          

HSP 3 Score: 144.436 bits (363), Expect = 1.010e-34
Identity = 154/615 (25.04%), Postives = 274/615 (44.55%), Query Frame = 1
Query:  607 LRLLIDIDYEKQKQYRFTLSAYQ--KNDESMSAN-----MNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMT----------NYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCT---ETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG--LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDS-----AIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPL-HRDLIGLQKVKVMVEDSGHPSLK 2355
            +RL  ++D+E+  QY+  +SA     ND  +  N       VT+ V++ +D    F+   Y  S+ E+ ++  ++++V+A D D    + I  P+T            F I N  GE+ L   LD E    +   I A    +   +++ ITV DVND  P + L      ++E    G  V Q+   D     I++G+  +   E  +      + +    + I+++       +LDRE     +     I  ++      ++N++I + + D NDN+P+F  + Y   + EN   G  + Q  A D DIG NA+++Y +    +     F I+++ G +   + LDRE    + L + A D A +   +     + +TVLD NDN+PE +R   +FS++E    G  +G + A D+D+  N  I++ ++  ++     +  ++G L  N   DRE  SK   ++  SD      A G+ L + ++V +N+LD NDN P                          V Y + +     VG  +  +  TD D    + L Y++ +  S+      F +D  +G +++N+ L   +   +  V + V D G P L 
Sbjct:  167 IRLARELDFEQMTQYKLNISASNPLTNDTVIPKNGLSNWTMVTVNVLDADDLPVRFNNYSYSASIPENAAMGSVVMQVHAKDLD----KSINAPVTYAIDKETNPLRMFNIANITGEITLNGSLDRETIAEYRLRILAYCTIYQDHTEVLITVTDVNDNIPLFTLPSYNTTVNENAAIGTYVIQVQAED-----IDQGVNASFIYEIAYAGHEFVIGE---HSGIIIVNG-----TLDREK--KDLYSITVIARETETSAGFHSNVTITVMLRDENDNSPIFSRALYSSPIYENEPPGTFVIQVSANDSDIGSNAMVSYAVLSDAEGHYQYFKINAKNGTITTSRRLDRENITTFRLRVTASDGAPLSTIRVSVVDVVVTVLDINDNSPEFVRPSYNFSVIETALPGAILGIISAVDRDKDLNGNIVYIITEGNVEGSFIIGARSGLLQLNHTLDREVVSKHSLRVTASDRGGEFMADGSSLNTTINVTINVLDSNDNIPVC----------------------DKVYYTISIPENTSVGQSLIHLNCTDQDSGENAHLLYHMVSGHSK------FVVDNVTGIMSLNKLLDFEEKPTVFTVAIEVIDHGRPPLS 734          

HSP 4 Score: 144.05 bits (362), Expect = 1.272e-34
Identity = 178/727 (24.48%), Postives = 307/727 (42.23%), Query Frame = 1
Query:  196 ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADG-DNLRYILLPMTNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSIL-ENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQP---LTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPS 2349
            +L Y+ G  T  F+ID  +G +  +  +D E +      +   + I+ +   NR   L++V  + + +LD++DN P F++  +T  + E       V+ +  AVD D++  N  ++Y +   ++       N  G  ++L+  ++ EK   Y  T+ +         +   V + V+++ND +P          + E++     ++KV   D D   N R      ++ F+++   G +   + LD E   +++  + A +    +      + + V+D ND  PS+ +    +   ET   G  + ++   D D   IN  ++ T    E+    L +   +T I+ +     V SLDRE      +       D GI      + +I + V D+NDN P F  + Y   V E            A D+D   NA I Y+I        F I++++G +  +  LDRE  ++Y+LT++A D+      + ST +TI V D NDN P +       +  EN P G  +  L A D DEG NAR+ F         P    ++   G +      DRE +++       +DS      +S VS  + I DENDN P +F                       V Y V +S       VI  V A++ D     +L + +    S       F I   +G I+  +PL R+++    + +  ED G PS
Sbjct:  794 KLQYTLGNSTGPFAIDKDTGVLRAVGSLDREGI-----KNYTFSVIAQDSIPNRP--LVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVLKI-RAVDNDLA-SNANVSYSIVSGNTGAAFHVDNVTG-EIKLVSKLEREKITSYTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDEVHNGRVEYNLTSDAFRVDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDD-GINAEVRYTLMGEES----LFRINYTTGIVTL-----VSSLDRENKAQYQLEVE--ARDRGIPESNANSTTILIRVGDVNDNRPTFTHAHYDGNVLEGQVG-AVAAIVVALDKDEEINADIVYSIIGGNTDNSFAINNKSGSIYTLLHLDRETTDRYILTVLASDRG-EPAMNSSTNVTIHVNDVNDNKPNITNNPGVVVTRENTPPGSLVYILSASDLDEGSNARVAFS----GYAVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNP-VF---------------------DPVHYSVNISENGPSEEVIVQVNASERDE---GKLLFKI----SSGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPS 1463          

HSP 5 Score: 132.109 bits (331), Expect = 5.560e-31
Identity = 173/698 (24.79%), Postives = 299/698 (42.84%), Query Frame = 1
Query:  361 KTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRG-PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYE-DISLDEIIIKV---NAVDADGDN------LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDG----EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL---REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL-SMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
             +L + + + I +LD +DN P  +K  +T+ I E       +I+L    D+D S +N  + Y M   HS F ++  N  G   L  L+D + EK   +   +         +S  + V + V N+ND  P F +  Y   + E D ++D  I+ V   + +DAD  N      L+Y L   T  F I+ D G L  +  LD E  ++++F++ A D       V  + + + +LDVND  P +  +     + E    G+ V +I   D D  S N  +  +  +  T A     D ++ +I L+ KL      +RE I     YT  +    G      +   + + V D+NDN+P+       V + EN   G+ + +   TD D   N  + YN+     S  F +D  TG +   + LDRE    Y L + A +    D +   + + + V+D ND+ P     R Y   S  E  P+G  +  + A D D+G NA + + L   + L++   +N  TG +      DRE K++   +++  D  I     +  ++ + + D NDN P          T  ++ ++    E         +   +K           D ++N  + + Y +    ++N     F I+ KSG I     L R+      + V+  D G P++ S+  + + + D+
Sbjct:  627 SSLNTTINVTINVLDSNDNIPVCDKVYYTISIPENTSVGQSLIHL-NCTDQD-SGENAHLLYHMVSGHSKFVVD--NVTGIMSLNKLLDFE-EKPTVFTVAIEVIDHGRPPLSLVVFVNVTVDNVNDNYPSFGQDNYTFWISEGDFAVDHAIVGVVSAHDLDADSSNCPLCGKLQYTLGNSTGPFAIDKDTGVLRAVGSLDREGIKNYTFSVIAQDSIPNRPLVNVTMVTVNLLDVNDNDPVFDRDVYTANVSEDASPGLTVLKIRAVDNDLAS-NANVSYSIVSGNTGA-AFHVDNVTGEIKLVSKL------EREKITS---YTLTVGSADGGAVPRRSTALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKVVTTDPDEVHNGRVEYNLT----SDAFRVDPFTGIITTTRALDRESIPAYNLMVTARNSNSSDMEVNCS-VHVIVMDTNDHTPSFTMARYY--ISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEESLFR---INYTTGIVTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRP----------TFTHAHYDGNVLEGQVGAVAAIVVALDK-----------DEEIN--ADIVYSIIGGNTDNS----FAINNKSGSIYTLLHLDRETTDRYILTVLASDRGEPAMNSSTNVTIHVNDV 1271          

HSP 6 Score: 125.946 bits (315), Expect = 4.354e-29
Identity = 162/634 (25.55%), Postives = 274/634 (43.22%), Query Frame = 1
Query:  373 SVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVL----DVNDEPPSYILNPEKLVIDETNKSG-ILVGQITV-------FDRDSVSINRGIKCTETNHET-QALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELRE-YTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTV-NKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLT-SHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSA 2214
            S   ++I ++D++DN P       T+ + E +   + V+ +    D D  + N  + Y ++ D  AF ++         R L   D E    Y   ++A   N   M  N +V + V++ ND  P F+   Y  S  E   +   + +V AVD D G N  +RY L+   + F+IN   G + L+  LD E    +   ++A D      +    T+L    DVND  P++            +  G +L GQ+          D+D   IN  I  +     T  +  +     S        +YT+  LDRET  D  I T  +  D G +  + ++ ++ ++V+D+NDN P   ++   V  +EN   G  ++   A+D D G NA + ++  ++V  G F I    G + +   LDRE +N+++   +A D       S      I + D+NDN P     +   +I EN P    I  + A ++DEG   +++FK+S        T+ N TG + + +  DRE  S+    I   D    + +   +V++ VN  DEND  P I   E+                      +V +S    +G  +A + A D D  + ++++Y + NSA
Sbjct:  951 STALVIIYVMDVNDNSPVCLHDTQTVRLLENLPAGHFVVKV-VTTDPD-EVHNGRVEYNLTSD--AFRVDPFTGIITTTRAL---DRESIPAYNLMVTARNSNSSDMEVNCSVHVIVMDTNDHTPSFTMARYYISTPETTPVGSTLFRVRAVDGDDGINAEVRYTLMGEESLFRINYTTGIVTLVSSLDRENKAQYQLEVEARDRGIPESNANSTTILIRVGDVNDNRPTFT---------HAHYDGNVLEGQVGAVAAIVVALDKDE-EINADIVYSIIGGNTDNSFAINNKSGS--------IYTLLHLDRETT-DRYILT-VLASDRG-EPAMNSSTNVTIHVNDVNDNKPNITNNPGVVVTRENTPPGSLVYILSASDLDEGSNARVAFS-GYAVPDGKFSIKPN-GEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYSVNISENGPSEEVIVQVNASERDEG---KLLFKISSGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPSRMALGYVTIFVN--DENDFAPVIEQCEQ----------------------LVSVSENAHIGSAVASINAVDKDDPSNTKITYSVGNSA 1527          

HSP 7 Score: 81.6481 bits (200), Expect = 1.445e-15
Identity = 112/467 (23.98%), Postives = 195/467 (41.76%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLRYILLPMTNY------FQINNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKL---KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTE-----TNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI---QFSVDSGLFVIDSRT---GWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT 1719
            I+I + D++DN+P F    +   + E   +   V  +  A+DKD  + N +I Y + G ++  +   +N  G  +  L+ +D E   +Y  T+ A  + + +M+++ NVT+ V ++ND  P  +         E+     ++  ++A D D G N R   +  + Y      F I  +GE+ +   LD E    F F   ATD G+    S +    I + D ND  P +      + I E   S  ++ Q+   +RD   +   I   +     T H    +                + T   LDRE +            D G   ++     + + V+D ND AP+    +  V V EN  IG  +    A D+D   N  ITY++    F++ +      S +   G +     LDRE+++ Y +T+ A D         +  + + + D NDN+P   + T
Sbjct: 1160 ILIRVGDVNDNRPTFTHAHYDGNVLE--GQVGAVAAIVVALDKDEEI-NADIVYSIIGGNTDNSFAINNKSG-SIYTLLHLDRETTDRYILTVLASDRGEPAMNSSTNVTIHVNDVNDNKPNITNNPGVVVTRENTPPGSLVYILSASDLDEGSNAR---VAFSGYAVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYSVNISENGPSEEVIVQVNASERDEGKLLFKISSGDPGGYFTIHNVTGV----------------ISTRKPLDREMVSR--FDLTITAEDEGRPSRMALGY-VTIFVNDENDFAPVIEQCEQLVSVSENAHIGSAVASINAVDKDDPSNTKITYSVGNSAFNITTQRLPFSSGSRYRGIIITAGLLDRERQDNYNITVTASDG----NHIATCNIIVRITDVNDNSPVFNQTT 1596          

HSP 8 Score: 61.2326 bits (147), Expect = 2.666e-9
Identity = 102/433 (23.56%), Postives = 180/433 (41.57%), Query Frame = 1
Query:  181 KQIDEELSYSF--GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNM----VIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHN-SRGPRLRLLI--DIDYEKQKQYRFTLSAYQKNDESMSANM-NVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPM--TNYFQINN-DGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEP--PSYILNPEKLV-IDETNKSGILVGQITVFDRDSVS---INRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKE 1422
            ++I+ ++ YS   G   + F+I+ KSG I+TL  +D E          +   +++  +   +  + S   + I + D++DNKP       T     V+ R+N     ++Y+ +A D D    N  +A+      S + + +   S  P   +++   +D E Q ++ F   A        +++M +  + + + ND  P F    Y  ++ E+   +E+I++VNA + D   L + +       YF I+N  G +   + LD E    F  TI A D    +   L    + VNDE      I   E+LV + E    G  V  I   D+D  S   I   +  +  N  TQ L          I++   L     LDRE         N+    +          +I + + D+NDN+P+F  +   + + E
Sbjct: 1202 EEINADIVYSIIGGNTDNSFAINNKSGSIYTLLHLDRET--------TDRYILTVLASDRGEPAMNSSTNVTIHVNDVNDNKPNI-----TNNPGVVVTRENTPPGSLVYILSASDLD-EGSNARVAF------SGYAVPDGKFSIKPNGEIMVRDSLDREAQNRFVFYAMATDSGQPPFNSSMVSFDILIADENDNNPVFDPVHYSVNISENGPSEEVIVQVNASERDEGKLLFKISSGDPGGYFTIHNVTGVISTRKPLDREMVSRFDLTITAEDEGRPSRMALGYVTIFVNDENDFAPVIEQCEQLVSVSENAHIGSAVASINAVDKDDPSNTKITYSVGNSAFNITTQRLPFSSGSRYRGIIITAGL-----LDRER------QDNYNITVTASDGNHIATCNIIVRITDVNDNSPVFNQTTMNISLHE 1603          
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 182.185 bits (461), Expect = 3.114e-46
Identity = 188/679 (27.69%), Postives = 305/679 (44.92%), Query Frame = 1
Query:  391 IIILDIDDNKPEFEKPEFTMEIKEVIHRKNM-VIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILL-----PMTNYFQINNDGELHLIQKLDF-EKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKD-EGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAK---TIMVE 2379
            I +LD++D  P F K E+   I+E  H + + VI    A+ +D    N E+ Y +S  ++  N+   NS G  L L  ++D+EK      T+ A  K    +    NVT+ V++IND +P+F+ +     + ED  +      V+  DAD   L  +       P T +   +N G L L + +D+    +S++  +QA DG     S    L++ V+DVND  P +        + ET      + ++   D DS    R     ++  +T    L             K++    LDRE I +  +    I  D G  R+  ++  + + V D+NDN P F  + Y   VKEN  +   L    A+D D G N  +TY  +F      F++D +TG +   Q LDRE K  Y+ +IVA D     R    TQ+T+ V D ND +P+  +     ++ E+LP+G  + TLIA D D +G N+ I + +      +  ++N+ TG L      DRE   +    +  SD      L +   + +N+LD NDNYP +F+ E    T+   L                      +G V+A V A D+D  +  ++ Y + N  ++      F I++ +G I+  R L  ++     ++V   D G    K++    TI VE
Sbjct:  691 ITVLDVNDEPPIFSKAEYNFTIQE--HSQALSVIGHVHAISRD-KGTNAEVVYSISKGNTD-NIVLINSTG-TLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGG---------KIFIKSKLDREDIEEYNL--KVIAIDHGTPRR-SSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTY--RFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVD-KTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGP--KAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYP-VFINETTFKTVPEKL---------------------PIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTD----GTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVE 1321          

HSP 2 Score: 167.162 bits (422), Expect = 1.237e-41
Identity = 197/785 (25.10%), Postives = 330/785 (42.04%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQ---IDEELSYSFGLITD------IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLID---IDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNL---RYILLP--MTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILL--IYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQL-YTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLD-REKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSDK 2409
            + EN  + T V  +    Q    + EL Y+    T+       F+IDP SG I T   +D E +            +++ V+      L     +++ + D +DN P F +  +   + E     + V+ L  A D DI  +N  I Y +   ++ F L+      PR  L+ +   +D+E Q  Y F ++A      S +A ++V+L   ++ND  P F  + Y    +E+  + + I ++ A+D D       R+I+        F ++  G + L + LD E   ++  T++A DG   + V ++ + ITVLDVNDEPP +        I E +++  ++G +    RD     +G     TN E     + K      +L+     LY    +D E IP   +Y      D G      Y N++I   V DINDN+P F SS   V + E+  IG+  +     D D G    +++++  S    LF +DS TG L L + +D       Y L + A D     R S +  L + V+D ND +P    ++    +LE  P    I  ++A D D GEN RI +            +   G +F     DRE   +   ++   D       +S   V V + D NDN P                      + ++  + VK +  E V   +  V A+D+D  +   ++Y  +   ++      F +DK++GKIT ++ L R+        ++  D G         + V + D+   S K
Sbjct:  398 VWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQI--------PQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQL-LAQDPDIG-ENSLILYSILTPNTPFFLD------PRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSL--TDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRD-----KG-----TNAEV-VYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPS--LYLTVQAKDKGTPPLFGYANVTIA--VIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSL-LSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSS-TAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPR-RSSSADVKVIVDDVNDNNPHF--------------------QQASYAFFVKEN--EPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ------FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPK 1118          

HSP 3 Score: 166.007 bits (419), Expect = 2.804e-41
Identity = 181/656 (27.59%), Postives = 300/656 (45.73%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQIDE----ELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQK-NDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILL--PMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD----GEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQ--LYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVL------DDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ 2016
            F ++EN+P+ T++G +  A   DE     ++Y F      F +D ++G I T +V+D EA        K S   S+          +   ++ +I+ D++D  P+F K ++++ + E +   + ++ L  A D D    N +I Y +     AF+L +       L L+  +D E   ++   + A  K  ++S+     + + V+++ND  P F      ++V E + +  ++  V AVD+D GDN  +RY ++       F+IN   G +  ++ LDFE    +   + ATD     +  +   + I V D ND  P++  NP    I E       V  I   D DS  +N  I  T  +   +A      +++++  LI    T H +DRE I +  +       D     Q  LY   ++ + + D+NDNAP F S      V E+    +Q+    A D D G+   + Y I  S D+G F +D +TG LKL+  LD E   QY L I A D        GS  LT   L      D NDN PE  R+    ++ EN P G  +  + A+D+D G NA + + +         +++K +G + +N + DREKK      +  +  +      S  SV +N++D NDN P+
Sbjct: 1023 FFVKENEPVATYLGAVS-ASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREA--------KASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTL-IATDDDQQGPNSDITYMIVAGPKAFSLNQVTG---VLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDS-GLNSRIWYTIDSQSPRA----HFKINSETGLI---QTTHPIDREEISEYSLKVR--ATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFNFQVTSITALDPDTGQGGNVEYRI-VSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDL-------GSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSY-PFRVSSTSVRINVMDRNDNPPK 1645          

HSP 4 Score: 148.288 bits (373), Expect = 8.390e-36
Identity = 186/741 (25.10%), Postives = 308/741 (41.57%), Query Frame = 1
Query:  208 SFGLITD---IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSG--DHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINND-GELHLIQKLDFEKHQSFSFTIQATDG---EFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINR--------GIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFS-ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVN-KTGSLFSNQVFDREKKSKVCTQIQLSDSAIG--NVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKS 2358
            SF L+++   +F++D  +G +   K+ID      NS     S T+ +           S   + + ++D++D  P F    +T  + E     + +I +  A D D S +N  I+Y      D S F L      G ++ +   +D E  ++Y   + A        S++ +V + V ++ND  P F +  Y   V E+  +   +  V+A D+D G N  + Y        F ++   G++   Q LD E   S+ F+I ATDG     V ++++ + V DVND  P +  N   + ++E    G  +  +   D D    N         G K    N  T  L L                 V  LDRE     I++   +  D G  + L T   I +NV D+NDN P+F +      V E   IG  +    A D D G N  + Y I      G F I+  TG +  ++ LD E  N+Y+L + A D     +K+    +TI V D NDN P   +    + I EN+PI   + T+ A D D G N+RI + +          +N +TG + +    DRE+ S+   +++ +D A    + L +  ++ + I D NDN P+                        N+ YV++    E   F +  + A D D      + Y + +  +       F +D K+G + +   L  + +    + +   D G P L S
Sbjct:  843 SFSLLSNPGTLFNLDSNTGALSLTKLIDYG----NSA---RSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEV-VATDVD-SGENGRISYAFDSKVDTSKFGLRN----GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTL-----------------VSPLDREVTHRHILH--VVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV--------------------SRNLTYVME---DEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK-----FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTS 1523          

HSP 5 Score: 143.665 bits (361), Expect = 1.800e-34
Identity = 174/695 (25.04%), Postives = 305/695 (43.88%), Query Frame = 1
Query:  379 MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM---SGDHSAFNLEEHNSRGPRLRLLID---IDYEKQKQYRFTLSAYQK-NDESMSANMNVTLQVVNINDCAP--EFSKTIYEE-SVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQ-----INNDGELHLIQKLDFEKHQSF---SFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQA-LRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSI--LENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +++ I + D +DNKPEF    ++  I E I     ++ + A+ DKDI   N EI Y +   S   + F +       P   ++++   +DYE ++ Y   + A  K +   +S++  V ++V+++ND  P    S T+     V E+ ++   + +V+  DAD G N  +   L     YF      +N++  + + Q LD E H  F   +  I   D     E   +I V DVND  P +  +  +  + E      LV  +   D+D  S +  +       E+++ L       S+ ++      T   LDRE IP  ++    + +D G    L  N S+ +N+ D NDN P F  S Y   + EN+  G  + Q  A D DIG+N+LI Y+I     +  F +D R G +   + LD E ++ Y   + A D      +S +  + +++ D NDN P + + + +S+   EN  IG  I  L A D+D  + A   F +   +  +  +V+ +G +   ++ DRE +      ++  D   G    +   V + +LD ND  P   ++ K E       +N T  EHS       +S       VI  V A   D    +++ Y +    ++N+      +   +G + +   +  + I    + V  +D G P L     + + ++DI
Sbjct:  156 LRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSAS-DKDIGT-NAEIQYSIETHSDPQAIFGIH------PTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMIT-----TATDLDREQIPQVVL--TVLVHDRG-SPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSIL--TPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG---GRSCNATVHVSLTDLNDNQP-VFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGG-GQDSVNKAIVNITVLDVNDEPP---IFSKAE-------YNFTIQEHSQA-----LS-------VIGHVHAISRDKGTNAEVVYSISKGNTDNIV-----LINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDI 800          

HSP 6 Score: 137.502 bits (345), Expect = 1.575e-32
Identity = 185/713 (25.95%), Postives = 313/713 (43.90%), Query Frame = 1
Query:  385 IVIIILDIDDNKPEFEKPEFTMEIKEVI------HRKNMVIYLPAAVDKDISMKNKEIAYRMSGD-HSAFNL-EEHNSRGPRLRLL------IDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTN---YFQIN-NDGELHLIQKLDFEKHQSFSFTIQATDG----EFVAESKLKITVLDVNDEPP----SYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKD----QMSTDILLIYKLYTV-HSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS----GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSG----STQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSN-QVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +++ + D++DN P F +       K V+       R+ ++     AVD D    + +    +SG+  + F L  + ++ G     L      I +D E+   Y   +SA    + +    + +++ V + ND  PEFS   Y  ++ E+I +   I++V+A D D G N  ++Y +   ++    F I+   G +    +LD+E  +S+   ++A D     +  + + ++I VLDVND  P    SY L     V  E    G  V +++V D DS       K  E N     + LE       M  D+L    +  V  SLDRET      +   +C D G   +  T  S  +NV D+ND AP F    Y+  V EN  +   +    A D+D G N+ + Y I  + +S      F ID  +G +     LDRE+  Q +LT++     VHDR S     +  + + + D NDN P   + + + S+ EN P G  +  L+A D D GEN+ I++ +   +   P  ++    L +N +  D E +S    Q+  +D   G   + + +V V++ D NDN P +F    D ++     F NT                 ++G  I  +KA D D    +   + +E   ++     +F +D  SG IT+ + L R+      + V   D G     +   + + +LD+
Sbjct:   44 VLVYVQDLNDNSPSFVR---GTSAKLVVFENDKDFRQKLI-----AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVT-ENATIGTQVARVSVSDADSG------KNGEVN-----VTLEGGDGYFSMKFDVLNDESIIAVGQSLDRET--HDHFFLKAVCIDKGDPPRT-TEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVL-----VHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPN--TPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATD---GGGRSCNATVHVSLTDLNDNQP-VF----DPSSYSVEYFENT-----------------RIGQSICQLKAIDRDSPKFAITRFIIEQGNAD----EVFSVD-GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDV 696          

HSP 7 Score: 130.183 bits (326), Expect = 2.684e-30
Identity = 188/738 (25.47%), Postives = 312/738 (42.28%), Query Frame = 1
Query:  172 KFAKQIDEELSYSFGLITDIFSIDPKSG---DIHTLKVIDLEALCFNSCADKESATISLNVNVNRQ-------------KTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHS--AFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMN-VTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDNLR--YILLPMT--NYFQINND-GELHLIQKLDFEKHQSFSFTIQATDGEFVAESKL------KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDI--------NDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSG 2262
            K++  ++E+L     L+T I + D + G   DI  + V   +A   N      +    L+  V  +             ++L ++  I I +LD++DN P F        + E +   ++V  +  AVD D    N ++ Y++   ++   F + E       LR L   D+E   +Y   +SA     +    +   VT+ V + ND  P F K      +YE++ ++  +  + A D D G N R  Y +   +   +F+IN++ G +     +D E+   +S  ++ATD  F  + +L      KI + D+ND  P ++      V+ E       V  IT  D D+    +G      N E + +  +  + S D L    L  + SLD E +P   ++ +    D G         S PL  + +        NDN P F    +   V EN   G  + +  A D D G NA +TY+I   V+   F ID  +G +     LDREKK+ Y LT+ A   +   R S ST + I V+D NDN P+ +       + EN P    I TL   D D G N ++++ +   +     T+ + TG L +    DRE K+     +Q  D       T+  ++ + I D+NDN P +F           SL+++T +E +              G  I  + A+D D  +   + Y L N         ++ ID ++G
Sbjct: 1123 KYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAV-LAVDSD-QGDNGKVRYKIVNGNTDGTFKINETTGVISTLRAL---DFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVM-EDEPFNFQVTSITALDPDT---GQG-----GNVEYRIVSPDTGKFSLD-LKTGVLKLIGSLDYEDVPQYTLHIS--ATDLG---------SPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVS-STSVRINVMDRNDNPPKFISPVVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKD-ITPPYYTAFANITIFIEDQNDN-PPVFQ---------QSLYSSTISELT------------PPGTSILNLTASDKDSGSNGNIVYTLSNDT-----YGVYSIDSRTG 1804          

HSP 8 Score: 124.79 bits (312), Expect = 1.155e-28
Identity = 172/753 (22.84%), Postives = 302/753 (40.11%), Query Frame = 1
Query:  121 KFTIEENQPIKTFVGRIKFAKQIDEELSYSF--GLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHR-KNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSA-FNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYIL-----------------------------LPMTNYFQIN-----NDGELHLIQKLDFEKHQSF-SFTIQATDGEFVAESKLKITVLDVNDEP----PSYILN-PEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR--EYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQ 2229
            + +I EN  + +++  ++     D +++YS   G     F +DP +G    + V   +AL + S    ++  + L        +L   M + I ++D +DN P F       ++ E     K   +    A D D S  N ++ Y + +G+ +  F ++         +LL   D E    +   +          S N  V + V ++ND  P F   + E ++ ED     ++  V A D D ++ L Y L                              P+TN  QI+     + G +   + +D     SF    +QA D     +  L    + +  EP    PSY    PE  ++      G  V  + V D  +     G+     ++  +     +    + ++ + K      LD ET    ++  + I  D+   + +   + + +NV D+ND  P+F  S Y     E   +G  +    A D+D G N  + + IQ   D G F ID +TG ++  + LD E    + +++ A D+      +    +TI VLD NDN P  R     D  +LENLP+   +  + A D+D G NAR+ F +          ++K +G L +N  FD E  +     + +  +  GN  L+S++++ VN+ DE++  P                FN        +DY   +    K+G  +  V ATD D  +  ++ +   N  S  L+
Sbjct: 1969 RVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTG---VISVASADALDYEST---KNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVD-SGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLL---DRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDP-LSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMM------GTSVLTVRVTDNAA-----GLPLGRISYNIENSNYFRIGQRSGVISVNK-----PLDYETKRRFLLVVSAID-DTAPSKPV--RVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHT-DVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPS---------------FN-------RMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALK 2668          

HSP 9 Score: 118.627 bits (296), Expect = 1.010e-26
Identity = 138/530 (26.04%), Postives = 214/530 (40.38%), Query Frame = 1
Query:  892 NDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPE-KLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNIS--------------IPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELR-EYT---DFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPL---TVNKTGSLFSNQVFDREKK-----SKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            N G +     LD EK  +++ TI     EF    K   + + V D+ND  PS++     KLV+ E +K          F +  ++++       T   T         +S ++  ++KL +    D +   D ++  + I  D         NIS              + + V D NDN P F +  Y   + EN D+G  + Q  A+D+DIG NA I Y+I+   D   +F I   TG +     LD E K  Y++ + A D+    + S S  + I VLD NDN P +   YT    + + EN  IG  +  +   D D G+N  +   L     Y  +    +N    +   Q  DRE         VC  I   D       T+  S  +N+ D ND  P+                   +  H+   Y  ++     V  ++A+V A D D  + S+L Y + N+         F ID  SG IT    L R+ I    + V+V D G P L    +++V + D
Sbjct:   10 NAGVITTKTVLDREKVSAYNLTIV----EFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKD---------FRQKLIAVDSDFGSNSTQSYTI--------VSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVC--IDKGDPP----RTTEKSFRINVGDVNDCAPK-------------------FDRHT---YETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTD 490          

HSP 10 Score: 112.849 bits (281), Expect = 4.997e-25
Identity = 157/585 (26.84%), Postives = 251/585 (42.91%), Query Frame = 1
Query:  130 IEENQPIKTFVGRIKFAKQIDEELSYSFGLITDI------FSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRM-SGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQINNDGELHLIQK---LDFEKHQSFSFTIQATDGEF---VAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNIS-IPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS-GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYT-DFSILENLPIGHYIGTLIAFDK--DEGENARIMFKL 1821
            I EN PI T V  IK A   D  L+       D       F I+ ++G I T   ID E +   S   K  AT   +     Q  L +   + III D++DN P+F     T  +++     N  +    A+D D + +   + YR+ S D   F+L+        L+L+  +DYE   QY   +SA       +++     + VV++ND  PEF++ ++  +V E+      ++KV A D D G N  L Y +       + + D    LI     LD EK  ++  T+ AT   +   V+ + ++I V+D ND PP +I     L + E N    L+  +TV D D  +  + +    + +   A  + +           +L T   LDRET                I    YT  + I + + D NDN P+F  S Y   + E    G  +    A+D+D G N  I Y +  S D+ G++ IDSRTG +      +   K +Y    +A DQ   D K     + I + D N++AP+  +   +  I  N      +  + A D   D+  N ++ ++L
Sbjct: 1339 IYENVPINTNVTTIK-AHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSL--KVRAT---DQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMED--EPFNFQVTSITALDPD-TGQGGNVEYRIVSPDTGKFSLDLKTGV---LKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPE-NSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTG--------ELSTTTKLDRETKAS----YQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL--SNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQG-QDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRL 1895          

HSP 11 Score: 92.4337 bits (228), Expect = 9.327e-19
Identity = 165/776 (21.26%), Postives = 311/776 (40.08%), Query Frame = 1
Query:  229 IFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAA-VDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEF-SKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILL-----------PMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESK---LKITVLDVNDEPPSYILNPEKLVIDETNKSGIL----VGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIP--DGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLF-PSSQYQV--------------------------GVKENNDIGYQLFQAQATDEDIGKNALITYNIQFS-VDSGLFVIDSRTGWLKLMQPLDREKKNQYM-LTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEG-ENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTS---HVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            ++SID ++G +++       A  F +   +E     +  +   Q   ++++ + I I D +++ P+F K  + + I        +V  + A   D D S  N ++ YR+    ++ +L    S    +R         Q ++   + A       +     V + + NI D  P F ++T    S+ E+  +   I  V A  +    + Y ++           P T    + +         LD+E  ++F   + AT   +V+ +    L I V+D ND  P++  +P  ++      +G      V ++T  D DS +  +      T +E     ++    +T  +   KL     LDRET    D +I       DSGI  +  TN  + + V D+NDN PLF P S+  +                           +K  +  G  + +  ATD+D G NA I Y+   +  D   + ID+ TG +   + +D   ++ ++ + + A+DQ V  +++    + + ++   +   EL  Y    + EN  +G  + T+   D   G    RI + +   + ++     ++G +  N+  D E K +    +    SAI +   S    V V +N+ D ND  P               +F  +        Y+ + S    VG ++  V A D D     ++ + +++       +  F ID+K+G I   R L  + I    V V   D G P + +  ++ + +LD+
Sbjct: 1796 VYSIDSRTGIVYS-------AARFETSIKQEYNFFCIAKD-QGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKST-NGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVAS------ADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF--HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDS---TTGEITTAKL-----LDRETTASFDLVIRGT----DSGIPPK-STNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRA---LVYVRIIITREPKFELPSYFG-KVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFR--IGQRSGVISVNKPLDYETKRRFLLVV----SAIDDTAPSKPVRVPVYINVSDVNDEKP---------------VFGQS-------GYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD----DKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDL 2505          

HSP 12 Score: 53.9138 bits (128), Expect = 5.193e-7
Identity = 74/293 (25.26%), Postives = 118/293 (40.27%), Query Frame = 1
Query: 1552 GWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKT-GSLFSNQV-------FDREKKSKVCTQIQLSDSAIGNVLT-SHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHP-SLKSAKTIMVEILDI 2391
            G +     LDREK + Y LTIV            S  + + V D NDN+P     T   ++       +   LIA D D G N+   + +   ++ ++++ ++   T G L+++ V        DRE+       I  SD   GN      + + + + D NDN P                      E SNV Y   +     VG  I  V A+D D+   +++ Y +E  +     Q+IF I   +G I  N  L  +      + V  ED G    L S+  + +E+LD+
Sbjct:   12 GVITTKTVLDREKVSAYNLTIVEFSTPPK-----SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDG--GNPANHGFLRLSITVEDTNDNKP----------------------EFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDP---QAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDV 272          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 221.09 bits (562), Expect = 7.826e-59
Identity = 232/790 (29.37%), Postives = 355/790 (44.94%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA---FNLEEHNSRG---PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNN---TYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            + ++E QP  T +G +     + D    Y   +      +D K+GDI T ++ ID E L  C  S    +   +   V+V    Q     +++  I + DI+DN P+F     T+ + E       +  +P A D+D S +N    Y ++    A   F L+  + RG   P+L +L ++D E +  Y  T+ A    +    +   + + V + ND +P+F    YE  V E+  +   +++V A D+D G N      L   + P+    +I+   G +++   LD E+  S SF + A D G     SK  + I V D ND  P+  +    LV        I E    G  V  + V D+D    N  + C         LR   D  S D    Y L T   LD E + +       +  DSG      TN S+ + V D+NDN+P+F  + ++V   E N  G  +    ATD D G NA + YNI   S   GLF ID  TG +K   PLDRE K +Y   + A D+     K G+  + I VLD NDN P+  L  Y+ FS+LEN+P    +G +   D D+GENA +   +  D   + +  N TG++ S+  FDREK+S    +++  D       +S+V V +N+LDENDN P +       T   NS F       +  S+VD                VV+A D D    + L + +   A  N  Q +F I   SG+IT+ + + R   GL ++ V V D G P   +   + + +
Sbjct:   26 YRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDC-RSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENT-IMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDE-GENAVVTCVVAGDVPFQLRPASDSTS-DNKRKYFLQTTTPLDYERVKE--YRVEIVAVDSGNPALSSTN-SLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHK-GTATVVIKVLDCNDNDPKFMLSGYS-FSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDG-GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNDPVV-------TKPSNSSFRQLSPVASPDSHVD----------------VVEAEDLDSGPNADLVFSI---AGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 2 Score: 138.272 bits (347), Expect = 1.319e-32
Identity = 141/483 (29.19%), Postives = 217/483 (44.93%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            +I V D+ND  P + L+   + + E    G L       DRDS     G+          A  L   Q++ D    + +L  + +LDRE + D   Y   I    G   Q Y+   + + V D NDN+P F    Y+  V EN+ +G+ + Q +A D D+G N  I Y++  +VD    L  ID  TG + +  PLDRE+ N     +VA D+     KS  T +TI V D NDNAP  E+R     +       I E++P+G  +  +   DKDEGENA +   ++ D  +Q    + + S       L +    D E+  +   +I   DS  GN  L+S  S+ V + D NDN P               +F+ T  E       V  +   + G  I  V ATD D    ++L Y   N   ++  + +F+ID  +G++    PL R+     + +V   D G P  K   T+++++LD
Sbjct:  119 RIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSE--RNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRE-LKDS--YDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQP-KSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDS--GNPALSSTNSLKVQVTDVNDNSP---------------VFSPTIFE-------VDFAEENQPGETILDVTATDADSGTNAELFY---NIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLD 568          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 221.861 bits (564), Expect = 1.319e-58
Identity = 232/790 (29.37%), Postives = 355/790 (44.94%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNR--QKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSA---FNLEEHNSRG---PRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN------LRYILLPMTNYFQIN-NDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESK--LKITVLDVNDEPPSYILNPEKLV--------IDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNN---TYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            + ++E QP  T +G +     + D    Y   +      +D K+GDI T ++ ID E L  C  S    +   +   V+V    Q     +++  I + DI+DN P+F     T+ + E       +  +P A D+D S +N    Y ++    A   F L+  + RG   P+L +L ++D E +  Y  T+ A    +    +   + + V + ND +P+F    YE  V E+  +   +++V A D+D G N      L   + P+    +I+   G +++   LD E+  S SF + A D G     SK  + I V D ND  P+  +    LV        I E    G  V  + V D+D    N  + C         LR   D  S D    Y L T   LD E + +       +  DSG      TN S+ + V D+NDN+P+F  + ++V   E N  G  +    ATD D G NA + YNI   S   GLF ID  TG +K   PLDRE K +Y   + A D+     K G+  + I VLD NDN P+  L  Y+ FS+LEN+P    +G +   D D+GENA +   +  D   + +  N TG++ S+  FDREK+S    +++  D       +S+V V +N+LDENDN P +       T   NS F       +  S+VD                VV+A D D    + L + +   A  N  Q +F I   SG+IT+ + + R   GL ++ V V D G P   +   + + +
Sbjct:  103 YRVQEEQPPNTLIGSLAADHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDC-RSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENT-IMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDE-GENAVVTCVVAGDVPFQLRPASDSTS-DNKRKYFLQTTTPLDYERVKE--YRVEIVAVDSGNPALSSTN-SLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHK-GTATVVIKVLDCNDNDPKFMLSGYS-FSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDG-GKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGG-EPPRSSYVGVTINVLDENDNDPVV-------TKPSNSSFRQLSPVASPDSHVD----------------VVEAEDLDSGPNADLVFSI---AGGNPYQ-LFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 2 Score: 137.887 bits (346), Expect = 2.248e-32
Identity = 141/484 (29.13%), Postives = 217/484 (44.83%), Query Frame = 1
Query: 1000 KITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDIL-LIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVD--SGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELREYTDFS-------ILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            +I V D+ND  P + L+   + + E    G L       DRDS     G+          A  L   Q++ D    + +L  + +LDRE + D   Y   I    G   Q Y+   + + V D NDN+P F    Y+  V EN+ +G+ + Q +A D D+G N  I Y++  +VD    L  ID  TG + +  PLDRE+ N     +VA D+     KS  T +TI V D NDNAP  E+R     +       I E++P+G  +  +   DKDEGENA +   ++ D  +Q    + + S       L +    D E+  +   +I   DS  GN  L+S  S+ V + D NDN P               +F+ T  E       V  +   + G  I  V ATD D    ++L Y   N   ++  + +F+ID  +G++    PL R+     + +V   D G P  K   T+++++LD 
Sbjct:  196 RIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSE--RNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRE-LKDS--YDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQP-KSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDS--GNPALSSTNSLKVQVTDVNDNSP---------------VFSPTIFE-------VDFAEENQPGETILDVTATDADSGTNAELFY---NIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDC 646          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 212.231 bits (539), Expect = 8.656e-56
Identity = 221/789 (28.01%), Postives = 356/789 (45.12%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNRQKTLISV----MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD----GDNLRYILLPMTNYFQI-----NNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVL--DVNDEPPSYILNPEKLVI--------DETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            + + E QP  T +G +     + D    Y   + +    +D K+G+I+T ++ ID E L  C N   D +   +   V++      I +    ++ +I +LDI+DN P+F  P  T+ I E  H   +   +P AVD+D S  N    Y +S    A  L      E+ + + P++ ++ ++D EK+  Y   +          +++  + + V + ND AP+F K  YE  + E+      +++V A DAD    GD + Y L   ++  Q       + G +++   +D E+     F + A D G     SK ++T+   D ND  P+  +    LVI         E    G  V  + V DRD    N  + C         LR    + + D    Y L T   LD E I D  I    +  DSG      TN S+ + V DINDN P F  +  +V   E+N  G ++    ATD D G NA + Y+I  S  + LF I+S TG +++   LDRE   +Y   + A D+ V   K+G+  + I V D NDN P+  L  Y+ FS+ EN+P  + +G +   D D+GEN+++   +  D+  + +  N TG++ S+  FDREK+S    +++  D+      +S+V V +N+LDENDN P            +    N++YT          +         + VVKA D D    ++L Y +       L    F I   SG+I + +       GL ++ V V D G P   +   + V +
Sbjct:   43 YKLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFED-DKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTL-FSIPVAVDRD-SGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGD-IDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGE-NAVVTCVVAGDVPFQLR-PASESANDRKRKYFLQTTTLLDYERIKDYRI--EIVAVDSGNPALSSTN-SLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVP-SKTGTAIVVINVEDRNDNDPKFMLSGYS-FSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDN-GKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAG-DPPRSSYVGVTINVLDENDNAP-----------YVTKPANSSYTH---------LKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGL----FQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          

HSP 2 Score: 123.25 bits (308), Expect = 6.451e-28
Identity = 137/483 (28.36%), Postives = 221/483 (45.76%), Query Frame = 1
Query: 1003 ITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDI-LLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELRE-----YTDF--SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-YLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I VLD+ND  P +      L I E   +G L       DRDS S   G+     +    A +L   Q++ D+   I ++  + +LDRE       Y   I    G K    ++  + + V D NDNAP F  +QY+  + EN+  G+ + Q +A D D G N  I Y++  + D+   L  ID  TG + +   +DRE+ N     +VA D+   + KS   Q+TI++ D NDNAP  E+R      + +F  +I E++PIG  +  +   D+DEGENA +   ++ D  +Q    +++ +       L +  + D E+      +I   DS  GN  L+S  S+ V + D NDN P                F+    E       V  +   + G  +  V ATD D    ++L Y  +E+SA+     S+F+I+  +G+I +   L R+ +   +  V   D G PS      +++ + D
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGS--NGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDS---YDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRG-PNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDS--GNPALSSTNSLKVQVTDINDNTPS---------------FSPALLE-------VNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAA-----SLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVED 586          

HSP 3 Score: 103.605 bits (257), Expect = 6.735e-22
Identity = 100/360 (27.78%), Postives = 166/360 (46.11%), Query Frame = 1
Query: 1351 LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS----GLFV---IDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGK--ITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + V DINDN P F S    + + EN   G       A D D G N +  Y +    D+    GL V   +D +   + ++  LDREKK+ Y L I  +D     R S S  L ITV D NDNAP+  +   +  + EN P GH +  + A D D G N  I + L  + D + + L +++ TG ++   + DRE+ + +   +   D    N  +S   V ++I D+NDN P I      E   I  +       H N  +V  +S    +G  +A+V+ +D D    + ++  +       L+ +    + +  K  +     L  + I   +++++  DSG+P+L S  ++ V++ DI
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRAS-SALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGP-NSKSSKAQVTISIKDQNDNAPAI------EIRGIGLVI------HQN--FVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDI 482          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 212.231 bits (539), Expect = 1.599e-55
Identity = 221/789 (28.01%), Postives = 356/789 (45.12%), Query Frame = 1
Query:  124 FTIEENQPIKTFVGRIKFAKQI-DEELSYSFGLITDIFSIDPKSGDIHTLKV-IDLEAL--CFNSCADKESATISLNVNVNRQKTLISV----MKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNL------EEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD----GDNLRYILLPMTNYFQI-----NNDGELHLIQKLDFEKHQSFSFTIQATD-GEFVAESKLKITVL--DVNDEPPSYILNPEKLVI--------DETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE--LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            + + E QP  T +G +     + D    Y   + +    +D K+G+I+T ++ ID E L  C N   D +   +   V++      I +    ++ +I +LDI+DN P+F  P  T+ I E  H   +   +P AVD+D S  N    Y +S    A  L      E+ + + P++ ++ ++D EK+  Y   +          +++  + + V + ND AP+F K  YE  + E+      +++V A DAD    GD + Y L   ++  Q       + G +++   +D E+     F + A D G     SK ++T+   D ND  P+  +    LVI         E    G  V  + V DRD    N  + C         LR    + + D    Y L T   LD E I D  I    +  DSG      TN S+ + V DINDN P F  +  +V   E+N  G ++    ATD D G NA + Y+I  S  + LF I+S TG +++   LDRE   +Y   + A D+ V   K+G+  + I V D NDN P+  L  Y+ FS+ EN+P  + +G +   D D+GEN+++   +  D+  + +  N TG++ S+  FDREK+S    +++  D+      +S+V V +N+LDENDN P            +    N++YT          +         + VVKA D D    ++L Y +       L    F I   SG+I + +       GL ++ V V D G P   +   + V +
Sbjct:   43 YKLSEEQPPNTLIGSLAADLGLPDSGHLYKLEVGSPYLRVDSKTGEIYTTEIPIDRETLSDCRNLFED-DKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTL-FSIPVAVDRD-SGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGD-IDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGE-NAVVTCVVAGDVPFQLR-PASESANDRKRKYFLQTTTLLDYERIKDYRI--EIVAVDSGNPALSSTN-SLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGV-PSKTGTAIVVINVEDRNDNDPKFMLSGYS-FSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDN-GKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAG-DPPRSSYVGVTINVLDENDNAP-----------YVTKPANSSYTH---------LKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGL----FQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          

HSP 2 Score: 122.865 bits (307), Expect = 9.240e-28
Identity = 137/483 (28.36%), Postives = 221/483 (45.76%), Query Frame = 1
Query: 1003 ITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDI-LLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS--GLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAP--ELRE-----YTDF--SILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGS-------LFSNQVFDREKKSKVCTQIQLSDSAIGN-VLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSY-YLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            I VLD+ND  P +      L I E   +G L       DRDS S   G+     +    A +L   Q++ D+   I ++  + +LDRE       Y   I    G K    ++  + + V D NDNAP F  +QY+  + EN+  G+ + Q +A D D G N  I Y++  + D+   L  ID  TG + +   +DRE+ N     +VA D+   + KS   Q+TI++ D NDNAP  E+R      + +F  +I E++PIG  +  +   D+DEGENA +   ++ D  +Q    +++ +       L +  + D E+      +I   DS  GN  L+S  S+ V + D NDN P                F+    E       V  +   + G  +  V ATD D    ++L Y  +E+SA+     S+F+I+  +G+I +   L R+ +   +  V   D G PS      +++ + D
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGS--NGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDS---YDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRG-PNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDS--GNPALSSTNSLKVQVTDINDNTPS---------------FSPALLE-------VNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAA-----SLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVED 586          

HSP 3 Score: 103.605 bits (257), Expect = 6.571e-22
Identity = 100/360 (27.78%), Postives = 166/360 (46.11%), Query Frame = 1
Query: 1351 LNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDS----GLFV---IDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKL--SMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGK--ITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            + V DINDN P F S    + + EN   G       A D D G N +  Y +    D+    GL V   +D +   + ++  LDREKK+ Y L I  +D     R S S  L ITV D NDNAP+  +   +  + EN P GH +  + A D D G N  I + L  + D + + L +++ TG ++   + DRE+ + +   +   D    N  +S   V ++I D+NDN P I      E   I  +       H N  +V  +S    +G  +A+V+ +D D    + ++  +       L+ +    + +  K  +     L  + I   +++++  DSG+P+L S  ++ V++ DI
Sbjct:  139 IEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRAS-SALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGP-NSKSSKAQVTISIKDQNDNAPAI------EIRGIGLVI------HQN--FVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDI 482          
BLAST of Protocadherin gamma vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 201.06 bits (510), Expect = 3.706e-52
Identity = 214/820 (26.10%), Postives = 362/820 (44.15%), Query Frame = 1
Query:  115 VQKFTIEENQPIKTFVGRIKFAKQI---DEELSYSFGLITDIFSIDPKSGDIHT-LKVIDLEALCFNSCA---DKESATISLNVNV-NRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYL-PAAVDKDISMKNKEIAYRMSGDH---------------------------SAFNLEEHNS----RGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDAD-GDN--LRYILLPMTNYFQI-----NNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDE----PPSYILNPEKLVIDETNKSGIL-----------VGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPE-LREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEI 2382
            V ++ + E  P    VG +     +     E++++    ++ F ID  +G++ T  K ID E L    C    D+    I   V+V    ++ + + +  +IILDI+DN P F  P  T+ ++E  +R    +YL P A D+D      E  Y +  D+                           S F L+  ++    + P+L +   +D E++  Y  TL      D   S+   + + + ++ND  P F K++YE  + E+ S    I+++ A DAD G N  + Y+    T   +       + G L ++ ++D E+     FT+ A D     +      VL++ DE    P   I    ++ +    K G+            +  + V DRD    N  + CT        L+   +         Y L+T   LD ET  +  +    +  DSG    L +N S+ + V D NDN P+F  +  QV   ENN  G ++    ATD D GKNA I+Y++  SV+ G+F IDS +G +++   LDRE+K +Y   ++A D+ ++  + GS  + + V D NDN P+ +++   F + ENL     +G +   D D+G+NA  M     +        N+TG++FS   FDRE+K+    +++  D       ++  +V + ++DENDN P +               N++YT          +     V  V+  V ATD D    + L+Y +       L    F+ID  +G I++   L +   GL ++ V V D+G PS  +   + V +
Sbjct:   29 VLRYRLAEEGPADVRVGNVAADLGMVAGSREVTFTLESGSEFFKIDNITGELTTNEKRIDREKL--QQCQMIFDENECFIDFEVSVIGPAQSWVDLFEGKVIILDINDNTPSFPSPVLTLSVEE--NRPIGTLYLLPTATDRDFGRNGIE-RYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEIRKIGRIFL----KDGVANVAEDVVVDTPIALVQVSDRDQGE-NGIVTCTVVGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVV--IVAVDSG-SPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTTVTATDADSGKNAEISYSLDSSVN-GIFSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQ-GSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAE-MGLFIEEEEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVDGG-DPPRSATATVSLFVMDENDNAPTVTF-----------PINSSYT---------LLPPSSTVRTVVRTVIATDTDTGINADLNYSIIGGNPFRL----FEIDGATGVISLMAKLEQKHYGLHRLVVQVTDNGQPSQSTTTLVHVYV 807          

HSP 2 Score: 81.2629 bits (199), Expect = 5.485e-15
Identity = 103/386 (26.68%), Postives = 159/386 (41.19%), Query Frame = 1
Query: 1363 DINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI--------------------QFSVDSG--------LFVIDSRTG----WLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPEL-REYTDFSILENLPIGHYIGTLIAFDKDEGENARI--MFKLSMDHLYQPLTVNK-TGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNN--------VSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILD 2388
            DINDN P FPS    + V+EN  IG       ATD D G+N +  Y +                    +   D G        L V D+  G     L +   LDRE+++ Y LT+   D     R S +  L + + D NDN P   +   +  + EN   G  I  L A D D G N +I  +F  + + + + L +++ TG L      DRE+ S++   +   D      +    +V +NI DENDN P I      E   I  +F      +   D VV   I        A+V+ +D D           V  + + L+ ++    +Q     +KK   +  + PL  +      V ++  DSG PSL S  +++V++ D
Sbjct:  131 DINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAI-LRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREEVSQLRFTVMARDRGQPPKM-DKATVVLNIKDENDNVPAI------EIRKIGRIFLKDGVANVAEDVVVDTPI--------ALVQVSDRDQGENGIVTCTVVGDVPFQLKPASEMEGEQ-----NKKKYFLHTSAPLDYETTQEYNVVIVAVDSGSPSLTSNNSLLVKVGD 495          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000005850.1 (SMESG000005850.1)

HSP 1 Score: 2021.51 bits (5236), Expect = 0.000e+0
Identity = 1038/1043 (99.52%), Postives = 1040/1043 (99.71%), Query Frame = 1
Query:   28 MVQIIEKLAIVLLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSDKXXXXXXXXXXXXXXFMXXXXXXXXXXXXXXXXXXXXXXXXKPCTGRDRFHNQSYDANYVPSLMFQDQVRHLSPDLGEKQNFEISGNMEGIWGGNTIKNQTLLSNSGGNWNNQRSFGTSNDIYLDNLQKSLQSNEYAPTPQYMTTYNGQNALTLLIRNDEQRSDSGKGASDDDMSYIPRFINDPLSMTRNGYSTYNPNNTMQILPFPGCVFNCSNATYTPVSTALHQPVTECSYIPNTYPSISTHESTNI 3156
            MVQIIEKLAIVLLFQ LYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHT KVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSDKLFN+LNNPLIIGNNFMISLILSVVSALLILILISVIICIVKPCTGRDRFHNQSYDANYVPSLMFQDQVRHLSPDLGEKQNFEISGNMEGIWGGNTIK+QTLLSNSGGNWNNQRSFGTSNDIYLDNLQKSLQSNEYAPTPQYMTTYNGQNALTLLIRNDEQRSDSGKGASDDDMSYIPRFINDPLSMTRNGYSTYNPNNTMQILPFPGCVFNCSNATYTPVSTALHQ VTECSYIPNTYPSISTHESTNI
Sbjct:    1 MVQIIEKLAIVLLFQFLYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTSKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSDKLFNVLNNPLIIGNNFMISLILSVVSALLILILISVIICIVKPCTGRDRFHNQSYDANYVPSLMFQDQVRHLSPDLGEKQNFEISGNMEGIWGGNTIKSQTLLSNSGGNWNNQRSFGTSNDIYLDNLQKSLQSNEYAPTPQYMTTYNGQNALTLLIRNDEQRSDSGKGASDDDMSYIPRFINDPLSMTRNGYSTYNPNNTMQILPFPGCVFNCSNATYTPVSTALHQAVTECSYIPNTYPSISTHESTNI 1043          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000046654.1 (SMESG000046654.1)

HSP 1 Score: 452.21 bits (1162), Expect = 9.964e-140
Identity = 282/806 (34.99%), Postives = 439/806 (54.47%), Query Frame = 1
Query:   49 LAIVLLFQILY-VYSIFFNAFDGVQKFTIEENQPIKTFVG----------RIKFAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYILLPMTN-----YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHET--QALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYE--KDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSS 2403
            + I L+  IL    SI F+ F+G   +TI+EN P    VG           I   K +D    ++F    + F++D +S  + T K IDLE LC   C D     ++L VNV ++  L  V+ + I+I D +DN P F    F  +IKE+++     I LP A+DKD++  N  + Y+++     F L+      PRLRL  DIDYE +  Y  TL A+    + + + + + ++++++NDC P F K ++E  + E+  + ++IIK+ A D D D+ L Y ++  TN      F +   GE+ L++ LD E  Q++   + ATDGEF + SK++I V DVN+ PPSY LNP  L ++E     ILVGQI V D D+  +N  I+C E   ++  Q L+   D     + + Y +++   LDRE  P   IY   IC+D G+  +L +   I L V D+NDN P+F    Y+  +KENN+IG ++ Q  A D+D  +NA I Y+I     +  F I+  +GW+  ++ LDRE+K  Y L I+AI++++    + +T + I V D+NDN PE+       I+ENL    +IG +I+ DKD G N + +F L          + + GSLFS   FDRE K + C  I+++D  +    +S   +CVNILD+NDN P I ++   K++  L +   NN+    S    ++K S+ E  GF IA   A D D    +Q+++ +E+    N    +F ID+ +G I I+R + RD+IG  K+K++  D G  SL++ K I ++I DIP  S
Sbjct:    1 MKIYLIVWILSNSLSIVFSRFEGNLNYTIQENHPSGIQVGFISSDITQIPNIDLPKFLDSSFYFTFRDKNEYFTLDRQSSVLKTAKKIDLEILCPKFCNDDGVGFLNLVVNVWKENQLRGVINVKIVIHDQNDNVPMFLMKSFVKKIKEILYGVGKTIELPKAIDKDVTEINSRVLYKLNKASDTFELQISKDNTPRLRLTKDIDYETKNFYELTLIAWNNGHDELKSYLEIKIEIIDMNDCEPVFKKGLFELVLDENTKIGKLIIKLEATDKDKDSKLVYGMVSSTNSINRETFAVKETGEVILMKTLDVEFRQTYEIPVYATDGEFTSNSKIRIFVRDVNNHPPSYNLNPASLTLEENQPPNILVGQINVKDVDASDVNGDIRCQEPLGKSNLQDLKFVPDPAEYPLTVKYDMFSRVQLDREEAPTRTIY--LICHDGGLHERLTSTSVITLQVLDVNDNPPVFSIPFYKAQIKENNNIGDKVLQVVAHDKDDKENAQIKYSI-LEGPTNFFSINPNSGWITAIRRLDREEKINYQLAILAINKSLKALFNATTTVNIEVTDENDNVPEIYLPKKLEIMENLKPNQFIGNIISEDKDFGNNGKTVFSLINSKETDYFDLKRNGSLFSKITFDRELKDEYCLNIRVNDLGVPISRSSTKPICVNILDDNDNAPVISVHSTLKEQDQLESK--NNSQNLGSE---IIKASVYENPGFKIATAVADDADKGENAQVTFTMEDITDSNQIAPLFIIDEDNGSIKISRIMSRDVIGDYKMKIIACDKGKSSLRTEKIIRIQIQDIPPQS 798          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000036716.1 (SMESG000036716.1)

HSP 1 Score: 404.06 bits (1037), Expect = 1.888e-123
Identity = 275/811 (33.91%), Postives = 435/811 (53.64%), Query Frame = 1
Query:   28 MVQIIEKLAIVLLFQILYVYSIF--FNAFDGVQKFTIEENQPIKTFVGRIK---------FAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGD--HSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYILLPMTN-YFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETN--HETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNI----QFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDR-KSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQ-IFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDI 2391
            M QI   L ++ +FQ L    ++  F  FD + K+ I+ENQP +T +G+I            + + E+++Y F      F +D  +  + T  +IDLE LC + C   E   + L VNV    +L  ++++ I + D++DN P F        +KEVI+     + L  A+D+D+S ++  + Y++  D     F L+  N   P L L   +DYE+ K Y   + A+    ++    +++T++VVNIND  P+F +  YE SV E++ ++ +II+V AVD D D+ + Y     ++ YF +++ G++ L + LDFE        +QA+D EF A +K+ I V+DVNDE P + LNP    I+E     I++GQIT++DRDS + N  + C E    +  QA+  +    S      Y LYT    DRE   D +     +C D   K  L + ++I L + DINDN P+F  + Y V ++ENN +  ++ +  ATD+DIG+N L+TY I      + +  LFVIDS +GW+     LDREK++ Y L IVA D+    + ++ S  + IT++D NDN+P+        I EN   G  +G LIA D DEG+N +++FKL  +H      +   GSL S + FDRE   + C QI+++D     +  +H +VC+NILD NDN P+ IF     + T I+   N+T  + S     + +SI E  GF I   +A+D D    +   + +      +    IF ID + G + + R L ++LIG   V+++VED+G PS   ++ I+V I DI
Sbjct:    1 MKQIKCSLFLLYIFQCLINLRLYYGFTQFDDMIKYAIKENQPGQTRIGKISEDVPLSTQMILRNLSEKINYRFQKQLSYFVLDSNTSILKTKTLIDLEELCPDHCPTGEMGQLYLVVNVWDGLSLKGIIRVEINVQDVNDNVPTFLTSSILKSVKEVIYGVGKSMELQKAIDRDVSKEHNTVTYKLDADIYSDTFMLKVTNDSFPILVLKKALDYERCKLYNLAIWAWNSPADNQKTKLSITIRVVNINDMEPKFKQHKYEVSVEENLPINSMIIQVEAVDEDEDSEITYRSADFSSQYFSVSSKGQIFLKRPLDFETTSLHLIDVQASDNEFNANTKVVINVVDVNDEAPQFNLNPSFCRIEEGQPENIIIGQITIWDRDSDAANGKLSCWEPRNLYNKQAVIFKPPLDSKTFYGKYDLYTRVRFDREETIDDVKKVIIVCDDGAAKNPLTSTMTISLTIADINDNTPIFEKAVYSVSIEENNPVDAKVIKVTATDKDIGRNGLVTYEIDNLRSMNPEKSLFVIDSDSGWVTATLKLDREKESFYQLIIVAKDKGTMPKQQTSSCTINITIIDVNDNSPKFIGPKKLEIFENEKPGTEVGILIATDNDEGDNGKLLFKLLPNHNENFFYLTINGSLQSAKEFDRETTDRYCLQIEINDQGKTPLSITH-TVCINILDVNDNPPRLIFPDYHPKYTWID---NSTVQKES---ITIDLSIYESPGFEILKCEASDLDEGENAAFHFRISLPNDPD----IFSIDPQIGILRVKRKLKKELIGDYNVQIIVEDNGKPSKMHSQKILVRIQDI 800          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000029841.1 (SMESG000029841.1)

HSP 1 Score: 370.163 bits (949), Expect = 8.598e-110
Identity = 257/786 (32.70%), Postives = 412/786 (52.42%), Query Frame = 1
Query:  106 FDGVQKFTIEENQPIKTFVGRIK----------FAKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESMS-ANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYILLP----MTNYFQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI-----YKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQF-SVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQA-VHDRKSGSTQLTITVLDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIP 2394
             D   ++ IEENQP    +G+I           +    D  L +     + +F ++ KSG + T +VIDLE LC  +C  K+   ++L VN+     L  + K+ +II DI+DN P FE+    + IKE+++ +   I LP AVD+D+SMKN EI+Y++      F+LE      P L +L  +D E   Q+   L A+     S + + + + + V++IND  P FSK +Y   V E+  +  I+ K++A+D D D+ LRY        +T+ F+I   G + L++ LD+E    +  + + TDGEF+A +KLK  ++DVNDE P + LNP  + + E N     + Q+TV+DRDS  IN  +KC E N+ T        Q+ + +  I     + +  + SLDR+ +     Y   IC D+GI  +L +  ++ +NV D NDN P+F     Q+ VKEN+     ++   A D D G NA + Y++   + +     ID  +G L   +  DRE+++ Y L I+A DQ+ +  ++S S  + ITVLD+ND  P+L    +F+ILEN P   YIG L A DKDEG N+ I+F L  D       + K GSL+S + FDRE+K +    + L DS + +  +    + V ILD+NDN P I L E  E  L  +   N+  + +N  Y + +SI   V + I  +K  D D+    +++  L     +    ++  +D++  ++     L+RDL    +  ++  D G P+ +S K +M   ++ P
Sbjct:   34 LDNFLQYNIEENQPAGLVIGKISEDIKRNSNPVWFLTSDSNLRFLLSQESSLFELESKSGVLKTKQVIDLERLCPGNCI-KDKGVVNLTVNIWSPSNLQGIAKVSVIIDDINDNFPYFEQSTVEISIKEMLYTRGKTIKLPRAVDRDVSMKNNEISYKLKDSSDYFDLEMKTKFQPVLVVLKTMDSENINQFHLALLAWNSYFPSFNVSELKIIINVIDINDNEPFFSKPLYLIPVPENTPVGSIVHKISALDLDVDSQLRYYSADPGSLITSIFKIEIQGSIRLLRSLDYETQPFYHMSAKVTDGEFIAFTKLKFVIIDVNDETPQFNLNPTNISVFE-NSEPKEIAQVTVYDRDSEDINGKLKCYEPNYSTNK------QIVSFLPNINNPYQFTIKLIRSLDRDILNGDQQYATLICEDNGIPTRLTSTFTLTINVLDRNDNRPIFTQPFVQIAVKENSPTEIPIYTFGAEDIDRGLNARVIYSVMLNTTNDDCCRIDENSGKLFSFKTFDREQRSFYKLIIIATDQSQIDPKQSTSISVNITVLDENDEKPQLLPPYNFTILENQPQMTYIGLLKAQDKDEGANSGIIFSLVTDINSVFFLLLKNGSLYSRRRFDREEKEEFSLDVNLEDSGLHHTNSVKSRIYVKILDQNDNAPVINLPEF-EKVLFQTQSKNSELDQNNYFYRLNVSIHSSVQYPIGQIKVVDRDIGENGKVTLKLIPELQDPKVPNLLSLDEEKNELYTTSSLNRDLKDCYQYTILAMDHGRPNRRSEKKVMFCFVNQP 810          
BLAST of Protocadherin gamma vs. Planmine SMEST
Match: SMESG000020970.1 (SMESG000020970.1)

HSP 1 Score: 367.466 bits (942), Expect = 1.897e-108
Identity = 264/821 (32.16%), Postives = 434/821 (52.86%), Query Frame = 1
Query:   19 FTLMVQIIEKLAIVLLFQILYVYSIFFNAFD------GVQKFTIEENQPIKTFVGRIK---FAKQIDEELSYSFGL---ITDIFSIDPKSGDIHTLKVIDLEALCFNS-C--ADKESATISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRKNMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDIDYEKQKQYRFTLSAYQKNDESM-SANMNVTLQVVNINDCAPEFSKTIYEESVYEDISLDEIIIKVNAVDADGDN-LRYILLPMTNY-----FQINNDGELHLIQKLDFEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDETNKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLIYKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDNAPLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSGLFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHD-RKSGSTQLTITVLDDNDNAPELREYTD-FSILENLPIGHYIGTLIAFDKDEGENARIMFKL---SMDHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNV--LTSHVSVCVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREKVGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITINRPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIP 2394
            F+ +  ++ +L+ V+LF ++  +S F +A D      G   + I+ENQP    VG +      KQ      Y F L     + FS+ P S  + T K+IDLE+LC +S C    KE   ++L   V R K  I  ++I II+ D++DN P F+   +T  IKE+I+     I LP A DKD+S+ N +I+Y +    + F+        P L ++ ++D E    +R  L A+ +N  S  +A++++T+ + +IND  P FS++IY+  + E++ L+  I+++ A D D  + L++I++P  N      F I++ G ++LI+ LD+E    +   ++ TDGEF +  ++++ ++DVND  P + LNPE LVI E   S  L+G I V+D+DS  ++ GI+C E      A+R +  + +++      +Y    +DR+ I     ++  IC D GI  +L    ++ L V D NDN+P F  + Y V VKEN    Y L    ATD+D G N+ I Y I        F ID  +G +  +Q LDREK++ Y +T+VA D A+++ R + +  + I V+D ND AP + E  + FS+ EN PIG  IG LIA D D G+N + +F L   +  H ++ LT    GSL +   FDRE  S+V   ++++   IG    L+S  +VC+ ILDENDN P+I       + + + +    Y++++  D  + +S  E     I     +D D     Q+++ ++          +F ++     I + R   +       V ++ +D G P  +++K IMV+  DIP
Sbjct:    9 FSFLNFLLFRLS-VMLFDLVLGHS-FVSARDSSSLSFGTINYWIKENQPPGLVVGNLLDNLPYKQYFISPGYHFVLQKESEEFFSLKPGSSMLTTSKLIDLESLCGSSDCYNGTKEFQVVAL---VMRDKQFIQELRINIIVEDVNDNDPFFKNASYTKNIKEIIYGPGKSIDLPRAFDKDLSLINNQISYSLQETSTYFHFSVSKDGKPILIIIKELDAETIDTHRLILIAWNQNYPSRPTASLSITIVIDDINDNEPRFSQSIYKVPILENVELNHQILQLKATDKDKTSRLQFIIVPTINVEIAKTFAISDQGMIYLIKHLDYETAPKYEIPVRVTDGEFSSNGRVEVVIIDVNDCAPQFTLNPENLVISENTLSKTLLGNIVVYDQDSAYVDSGIECRE-GSPNDAMRFDITENNSERTKKINIYLNQEIDRDQINGDRRFSVIICNDMGINNRLTATFTVTLTVLDANDNSPQFTLTDYVVRVKENLKPQYPLIDVSATDKDDGVNSQIKYFISDHTHQQYFKIDENSGKIIGIQSLDREKQDYYQVTVVATDLAINEIRHTSTATVHIHVIDVNDCAPRINESLNTFSVYENQPIGTVIGKLIATDCDIGQNGKFIFTLIPSAFSHYFELLT---NGSLLTKVSFDRESLSQVKFSLRITVRDIGEEIHLSSKTAVCIKILDENDNSPKI-------SVIPDFIAAYNYSDNNTTDCSITVSKTESTNSPIFPFTFSDLDDGPNGQVAFSMKIYPISLKSNQLFYLNVTEKAIKLKRSWQQSDGNRFLVTLIAKDKGSPPRETSKVIMVQFADIP 813          
The following BLAST results are available for this feature:
BLAST of Protocadherin gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH13.479e-5927.25protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH19.283e-5927.25protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDHGA121.968e-5131.13protocadherin gamma subfamily A, 12 [Source:HGNC S... [more]
PCDHGA122.036e-5131.13protocadherin gamma subfamily A, 12 [Source:HGNC S... [more]
PCDHGA63.635e-5128.86protocadherin gamma subfamily A, 6 [Source:HGNC Sy... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-12.378e-4527.03FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-19.346e-3926.68FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-14.281e-3626.45Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-14.281e-3626.45Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
cdh-17.016e-3525.38CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.718e-4925.69gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.718e-4925.69gene:FBgn0284247 transcript:FBtr0343249[more]
kug4.797e-4728.84gene:FBgn0261574 transcript:FBtr0346077[more]
kug4.797e-4728.84gene:FBgn0261574 transcript:FBtr0332721[more]
kug5.363e-4728.97gene:FBgn0261574 transcript:FBtr0332722[more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.816e-6629.42protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.843e-6629.55protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.17.986e-5828.06protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.19.172e-5828.06protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.11.241e-5728.06protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh172.994e-5827.86protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.168e-5827.86protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh173.649e-5827.86protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh174.166e-5827.86protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh174.959e-5827.86protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11.735e-6027.25protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.735e-6027.25protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.026e-5527.77protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Cdh235.378e-5427.70cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:M... [more]
Cdh231.802e-5328.03cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN1.671e-5827.25Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q2PZL6|FAT4_MOUSE1.743e-5227.93Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fa... [more]
sp|O35161|CELR1_MOUSE1.745e-5227.02Cadherin EGF LAG seven-pass G-type receptor 1 OS=M... [more]
sp|P58365|CAD23_RAT3.028e-5227.31Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23... [more]
sp|Q99PF4|CAD23_MOUSE3.490e-5227.63Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1... [more]
back to top
BLAST of Protocadherin gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EUK15.451e-11030.79Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3UI689.124e-11030.63Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3TLN63.938e-10631.78Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A0R3WM043.971e-10630.55Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A158R8H88.108e-10630.49Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.330e-6430.03protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a2.223e-6430.03protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh111.480e-5628.26protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.566e-5628.30protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh1b1.027e-5528.05protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.279e-4726.75protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000009557.12.437e-4326.23pep scaffold:Pmarinus_7.0:GL476748:59426:101420:1 ... [more]
ENSPMAT00000008517.11.508e-4226.77pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
si:ch211-199f5.16.180e-3926.14protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.11.773e-3825.32pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461892.146e-5427.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482375.684e-4925.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.584e-4827.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410058.606e-4826.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404703.114e-4627.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a7.826e-5929.37protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a1.319e-5829.37protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b8.656e-5628.01protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b1.599e-5528.01protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh7b3.706e-5226.10protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005850.10.000e+099.52SMESG000005850.1[more]
SMESG000046654.19.964e-14034.99SMESG000046654.1[more]
SMESG000036716.11.888e-12333.91SMESG000036716.1[more]
SMESG000029841.18.598e-11032.70SMESG000029841.1[more]
SMESG000020970.11.897e-10832.16SMESG000020970.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034969 ID=SMED30034969|Name=Protocadherin gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=3466bp
CTCCTGATTTCTTAACTCTTCACCTTGATGGTGCAAATAATCGAAAAACT
TGCAATTGTACTTCTATTTCAAATTCTTTACGTATATTCAATTTTTTTCA
ATGCATTTGATGGAGTACAGAAATTCACAATCGAAGAAAACCAACCGATA
AAAACATTCGTAGGACGAATCAAATTTGCAAAACAAATTGACGAAGAACT
GTCATATTCATTTGGTCTAATTACGGATATATTTTCCATAGATCCGAAAT
CAGGAGATATCCACACGTTGAAGGTTATTGACCTTGAAGCGTTATGTTTC
AACAGTTGTGCCGATAAAGAATCGGCAACTATCTCTCTAAATGTCAATGT
CAACCGACAGAAAACTCTAATTTCCGTGATGAAAATCGTCATAATCATTC
TCGATATCGATGACAATAAACCAGAATTCGAAAAACCAGAATTCACAATG
GAAATCAAAGAAGTAATACATAGAAAAAATATGGTTATTTATTTACCAGC
CGCTGTTGATAAAGATATTTCAATGAAAAACAAAGAAATTGCTTATCGGA
TGTCCGGTGATCATTCTGCATTTAACTTAGAAGAACATAACTCAAGGGGT
CCAAGGTTGCGATTGCTAATCGACATAGATTATGAAAAACAAAAACAATA
CCGATTCACTTTGTCTGCATATCAAAAAAACGATGAAAGCATGTCCGCAA
ATATGAATGTAACTTTGCAAGTTGTCAACATCAATGATTGTGCACCGGAA
TTTAGTAAAACAATTTATGAAGAATCTGTCTATGAAGATATCAGTCTTGA
TGAAATCATTATAAAGGTTAACGCTGTAGATGCAGATGGAGATAATTTAA
GGTATATTTTACTTCCGATGACGAATTATTTTCAAATTAATAATGATGGA
GAGTTACATTTGATTCAGAAATTAGATTTCGAGAAACATCAATCATTTAG
TTTCACAATTCAGGCTACAGATGGCGAATTTGTGGCTGAATCTAAATTAA
AAATTACCGTTCTTGACGTCAACGATGAACCACCTAGTTATATTTTAAAT
CCAGAAAAACTCGTAATCGACGAAACAAACAAAAGCGGGATACTCGTCGG
TCAAATTACAGTTTTTGATCGTGATTCCGTTTCTATTAACAGAGGAATTA
AGTGTACGGAAACCAATCACGAAACTCAAGCATTAAGATTGGAGAAAGAC
CAAATGAGCACTGATATTTTATTAATATATAAATTATATACAGTTCATTC
TCTTGATCGAGAAACAATACCAGATGGGATTATTTATACCAATTTTATTT
GTTATGATTCTGGAATTAAACGTCAACTTTATACCAATATTTCCATTCCT
TTGAATGTTCATGACATTAATGATAATGCTCCTCTCTTTCCTAGTTCACA
GTATCAAGTTGGGGTTAAAGAAAATAATGATATCGGTTACCAACTATTTC
AGGCACAGGCCACTGACGAAGATATTGGTAAAAATGCTCTTATCACGTAC
AATATTCAGTTTTCAGTGGATTCTGGTTTGTTTGTCATAGATTCCCGGAC
CGGTTGGTTAAAATTGATGCAACCCCTCGACCGTGAAAAAAAGAATCAAT
ATATGCTGACAATTGTAGCAATAGACCAAGCCGTTCATGATCGTAAATCA
GGATCAACACAGTTGACTATCACTGTACTTGATGATAATGACAATGCTCC
GGAATTGCGAGAGTATACAGATTTTTCAATCTTGGAAAATCTACCAATTG
GTCATTACATTGGAACATTAATCGCCTTTGATAAAGACGAAGGAGAAAAT
GCTAGAATTATGTTTAAACTTAGCATGGATCACCTTTACCAACCTCTTAC
AGTGAATAAAACAGGATCATTATTTTCCAATCAAGTTTTTGATAGAGAGA
AAAAAAGCAAAGTTTGTACACAAATCCAATTGAGTGATTCCGCAATCGGA
AATGTATTAACATCTCACGTATCAGTTTGCGTCAATATTCTCGATGAAAA
TGATAATTATCCACAAATATTTTTATACGAAAAGGATGAAACAACGCTTA
TAAATTCTCTCTTCAACAATACTTACACGGAACACTCCAATGTTGATTAC
GTTGTGAAAATGTCAATTCGGGAAAAGGTTGGATTCGTTATAGCGGTTGT
AAAAGCAACGGATAATGATGTTAATAATGTCAGCCAATTGTCGTATTACT
TAGAAAATTCAGCCTCAGAGAACCTTCAACAGTCCATTTTTGATATTGAT
AAAAAATCTGGAAAAATAACAATAAATAGACCATTGCATAGGGATTTAAT
AGGATTGCAGAAAGTGAAGGTCATGGTAGAGGATTCTGGACATCCTTCTT
TAAAATCTGCCAAAACTATCATGGTGGAAATACTCGACATTCCACAGTCA
TCCGATAAGCTATTCAACATTTTAAATAATCCTTTAATAATTGGAAATAA
CTTCATGATTTCTTTGATTTTATCTGTCGTGTCGGCCTTGTTGATTCTTA
TTCTCATTAGTGTTATCATTTGTATTGTAAAGCCGTGTACAGGCCGGGAT
AGGTTTCACAATCAATCATATGACGCTAATTACGTTCCAAGCCTTATGTT
CCAGGATCAAGTTCGACATTTATCTCCAGATTTAGGAGAAAAGCAGAACT
TTGAAATATCCGGAAACATGGAAGGTATTTGGGGTGGAAATACAATAAAA
AATCAAACATTATTATCAAACTCAGGAGGAAACTGGAATAATCAACGATC
TTTTGGAACATCCAATGACATATATCTCGATAATTTACAAAAGTCACTTC
AAAGCAATGAATATGCACCTACCCCTCAATACATGACAACGTATAATGGT
CAGAATGCATTAACATTATTAATAAGAAATGATGAACAAAGATCAGACAG
TGGGAAAGGCGCTAGTGATGATGACATGTCTTATATACCAAGATTCATCA
ACGATCCTTTATCAATGACTAGAAATGGCTATTCCACATATAATCCAAAC
AATACTATGCAAATTCTGCCATTCCCTGGCTGTGTATTTAATTGCTCTAA
CGCGACATATACTCCAGTTTCAACAGCCCTACACCAGCCAGTGACTGAAT
GTAGCTATATACCAAACACTTATCCTTCGATATCTACTCACGAATCGACA
AATATCTAGAATGTCAAGAACTAATCGTATTATTTAAGTCCGAGAATTAT
TTCATAATTCACAATTTTATTTCCAAAACATATCACACTGTTATATTTTT
TAATCAAAAATATGATCTCACGGATCCAGTTGATTTCAATAATTGGAAGA
GAAGAATTCACAGAAATTCCATAATTCACATTCCGATTCAAGTCCTTGTC
AATATATTTTTCTATCAACATAAATTTCAATTTGTTCATAAAAATTTGTT
TTTACTGTCATTAATTTTAACATTTGTAAAACTTTTTCATGGAAACTACG
TATCATTTTCTTTTGA
back to top

protein sequence of SMED30034969-orf-1

>SMED30034969-orf-1 ID=SMED30034969-orf-1|Name=SMED30034969-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1044bp
MVQIIEKLAIVLLFQILYVYSIFFNAFDGVQKFTIEENQPIKTFVGRIKF
AKQIDEELSYSFGLITDIFSIDPKSGDIHTLKVIDLEALCFNSCADKESA
TISLNVNVNRQKTLISVMKIVIIILDIDDNKPEFEKPEFTMEIKEVIHRK
NMVIYLPAAVDKDISMKNKEIAYRMSGDHSAFNLEEHNSRGPRLRLLIDI
DYEKQKQYRFTLSAYQKNDESMSANMNVTLQVVNINDCAPEFSKTIYEES
VYEDISLDEIIIKVNAVDADGDNLRYILLPMTNYFQINNDGELHLIQKLD
FEKHQSFSFTIQATDGEFVAESKLKITVLDVNDEPPSYILNPEKLVIDET
NKSGILVGQITVFDRDSVSINRGIKCTETNHETQALRLEKDQMSTDILLI
YKLYTVHSLDRETIPDGIIYTNFICYDSGIKRQLYTNISIPLNVHDINDN
APLFPSSQYQVGVKENNDIGYQLFQAQATDEDIGKNALITYNIQFSVDSG
LFVIDSRTGWLKLMQPLDREKKNQYMLTIVAIDQAVHDRKSGSTQLTITV
LDDNDNAPELREYTDFSILENLPIGHYIGTLIAFDKDEGENARIMFKLSM
DHLYQPLTVNKTGSLFSNQVFDREKKSKVCTQIQLSDSAIGNVLTSHVSV
CVNILDENDNYPQIFLYEKDETTLINSLFNNTYTEHSNVDYVVKMSIREK
VGFVIAVVKATDNDVNNVSQLSYYLENSASENLQQSIFDIDKKSGKITIN
RPLHRDLIGLQKVKVMVEDSGHPSLKSAKTIMVEILDIPQSSDKLFNILN
NPLIIGNNFMISLILSVVSALLILILISVIICIVKPCTGRDRFHNQSYDA
NYVPSLMFQDQVRHLSPDLGEKQNFEISGNMEGIWGGNTIKNQTLLSNSG
GNWNNQRSFGTSNDIYLDNLQKSLQSNEYAPTPQYMTTYNGQNALTLLIR
NDEQRSDSGKGASDDDMSYIPRFINDPLSMTRNGYSTYNPNNTMQILPFP
GCVFNCSNATYTPVSTALHQPVTECSYIPNTYPSISTHESTNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 507..533
score: 30.39
coord: 306..318
score: 29.53
coord: 542..559
score: 47.48
coord: 242..271
score: 31.15
coord: 433..452
score: 38.39
coord: 452..465
score: 41.32
coord: 67..86
score: 29.71
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 157..240
e-value: 7.5E-9
score: 45.4
coord: 581..662
e-value: 9.1E-8
score: 41.8
coord: 476..558
e-value: 5.5E-24
score: 95.7
coord: 49..132
e-value: 0.037
score: 18.4
coord: 264..336
e-value: 1.4E-17
score: 74.4
coord: 360..452
e-value: 0.25
score: 9.9
coord: 708..789
e-value: 1.0E-6
score: 38.3
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 459..551
e-value: 2.3E-20
score: 72.9
coord: 695..786
e-value: 3.5E-9
score: 37.0
coord: 566..655
e-value: 1.1E-9
score: 38.6
coord: 154..232
e-value: 1.1E-6
score: 28.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 685..788
e-value: 3.5E-16
score: 61.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 27..132
e-value: 4.2E-12
score: 48.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 559..662
e-value: 1.9E-19
score: 72.1
coord: 334..449
e-value: 2.7E-8
score: 36.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 133..237
e-value: 3.3E-15
score: 58.5
coord: 238..333
e-value: 2.8E-19
score: 71.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 450..558
e-value: 2.9E-31
score: 110.3
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 515..903
coord: 32..559
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 455..560
score: 26.268
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 27..134
score: 13.531
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 687..804
score: 17.565
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 243..338
score: 20.262
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 560..664
score: 17.587
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 135..242
score: 16.754
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 339..454
score: 13.224
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 33..108
e-value: 3.87186E-7
score: 47.3082
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 153..237
e-value: 1.67875E-8
score: 51.1602
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 566..660
e-value: 8.56176E-19
score: 80.4353
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 691..788
e-value: 3.7465E-16
score: 72.7313
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 246..333
e-value: 8.4557E-20
score: 83.1317
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 458..556
e-value: 1.05699E-28
score: 108.555
NoneNo IPR availableTMHMMTMhelixcoord: 812..834
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 548..558
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 442..452
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 652..662
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 443..566
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 696..788
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 32..134
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 231..318
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 326..430
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 548..665
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 128..242