LysM domain-containing protein

Overview
NameLysM domain-containing protein
Smed IDSMED30034968
Length (bp)2086
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LysM domain-containing protein (SMED30034968) t-SNE clustered cells

Violin plots show distribution of expression levels for LysM domain-containing protein (SMED30034968) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LysM domain-containing protein (SMED30034968) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LysM domain-containing protein (SMED30034968) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034968

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034968h1SMcG0000750 Contig325GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034968h1SMcG0019778 Contig325GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30034968h1SMcG0019778 dd_Smed_v4_5399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034968h1SMcG0019778 dd_Smed_v4_5399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034968h1SMcG0019778 Contig53537newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034968h1SMcG0019778 Contig53537uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LysM domain-containing protein vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 122.479 bits (306), Expect = 4.479e-31
Identity = 73/167 (43.71%), Postives = 97/167 (58.08%), Query Frame = 2
Query: 1136 VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            VA    + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+ L +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:   34 VATVKADLESESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTL 199          
BLAST of LysM domain-containing protein vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 122.865 bits (307), Expect = 7.112e-31
Identity = 73/167 (43.71%), Postives = 97/167 (58.08%), Query Frame = 2
Query: 1136 VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            VA    + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+ L +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:   61 VATVKADLESESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTL 226          
BLAST of LysM domain-containing protein vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 125.946 bits (315), Expect = 2.924e-29
Identity = 76/184 (41.30%), Postives = 106/184 (57.61%), Query Frame = 2
Query: 1097 KSWELVDTSQQSV----VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            + WE+  T+++ +    VA    + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+ L +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  649 REWEI--TTREDINSKQVATVKADLESESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTL 829          
BLAST of LysM domain-containing protein vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 125.946 bits (315), Expect = 3.388e-29
Identity = 76/184 (41.30%), Postives = 106/184 (57.61%), Query Frame = 2
Query: 1097 KSWELVDTSQQSV----VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            + WE+  T+++ +    VA    + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+ L +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  642 REWEI--TTREDINSKQVATVKADLESESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTL 822          
BLAST of LysM domain-containing protein vs. Ensembl Human
Match: OXR1 (oxidation resistance 1 [Source:HGNC Symbol;Acc:HGNC:15822])

HSP 1 Score: 125.176 bits (313), Expect = 6.059e-29
Identity = 73/167 (43.71%), Postives = 97/167 (58.08%), Query Frame = 2
Query: 1136 VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            VA    + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+ L +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  691 VATVKADLESESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTL 856          
BLAST of LysM domain-containing protein vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 113.62 bits (283), Expect = 1.279e-26
Identity = 67/198 (33.84%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 1094 DKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATN---CPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWR--------PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND 1654
            ++ WELV  S+   +   L   +E +        TSQIL+E MI  +   LP    G     +Y +  HG+SL T+YRKM   +    P LL+I+D    VFGA +S  +  ++H++GTG++ +  WR           ++Y WT D+ +F+   +D  +IG  SG + +W +  L +G S+  ETF+N  LCGD  D
Sbjct:  234 NREWELVTVSE---MCRRLSLDQELELPIPDGAATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQD 427          
BLAST of LysM domain-containing protein vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 113.62 bits (283), Expect = 1.279e-26
Identity = 67/198 (33.84%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 1094 DKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATN---CPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWR--------PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND 1654
            ++ WELV  S+   +   L   +E +        TSQIL+E MI  +   LP    G     +Y +  HG+SL T+YRKM   +    P LL+I+D    VFGA +S  +  ++H++GTG++ +  WR           ++Y WT D+ +F+   +D  +IG  SG + +W +  L +G S+  ETF+N  LCGD  D
Sbjct:  234 NREWELVTVSE---MCRRLSLDQELELPIPDGAATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQD 427          
BLAST of LysM domain-containing protein vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 113.62 bits (283), Expect = 1.279e-26
Identity = 67/198 (33.84%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 1094 DKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATN---CPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWR--------PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND 1654
            ++ WELV  S+   +   L   +E +        TSQIL+E MI  +   LP    G     +Y +  HG+SL T+YRKM   +    P LL+I+D    VFGA +S  +  ++H++GTG++ +  WR           ++Y WT D+ +F+   +D  +IG  SG + +W +  L +G S+  ETF+N  LCGD  D
Sbjct:  234 NREWELVTVSE---MCRRLSLDQELELPIPDGAATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQD 427          
BLAST of LysM domain-containing protein vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 115.161 bits (287), Expect = 2.798e-26
Identity = 67/198 (33.84%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 1094 DKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATN---CPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWR--------PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND 1654
            ++ WELV  S+   +   L   +E +        TSQIL+E MI  +   LP    G     +Y +  HG+SL T+YRKM   +    P LL+I+D    VFGA +S  +  ++H++GTG++ +  WR           ++Y WT D+ +F+   +D  +IG  SG + +W +  L +G S+  ETF+N  LCGD  D
Sbjct:  624 NREWELVTVSE---MCRRLSLDQELELPIPDGAATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQD 817          

HSP 2 Score: 61.2326 bits (147), Expect = 1.834e-9
Identity = 53/197 (26.90%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTD--------ASSTNRIS----LRASHKSHPGTA-----------SRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLS 682
            +Y + + DTL++VA   +CT   L   NK++    ++FPGQK+ +P  +  ++ D         SS N+IS         +  PG A              SAP+P  R  + E++ D +  ++F+K K  ++   S  +  GTLL+TP  L+FDP     D+    V  N   ++  G+   ++ + S++ + ++S
Sbjct:   13 DYTITETDTLERVAASHDCTVGELMKLNKMA--SRMVFPGQKILVPLANADDVFDPPSSASSLKSSGNQISGIENAEDGIRKGPGGAVPAHVRRGSFTKTQSAPIP--RGSNDEADTDCL--QRFLKIKVKQVTE-SDGTVSGTLLVTPNCLMFDP-----DVSHPLVKENGPDLY--GMVANMDEIQSVSVYKEIS 195          
BLAST of LysM domain-containing protein vs. Ensembl Celegans
Match: lmd-3 (LysM Domain (Peptidoglycan binding) protein [Source:UniProtKB/TrEMBL;Acc:Q3Y409])

HSP 1 Score: 115.161 bits (287), Expect = 2.940e-26
Identity = 67/198 (33.84%), Postives = 104/198 (52.53%), Query Frame = 2
Query: 1094 DKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATN---CPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWR--------PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND 1654
            ++ WELV  S+   +   L   +E +        TSQIL+E MI  +   LP    G     +Y +  HG+SL T+YRKM   +    P LL+I+D    VFGA +S  +  ++H++GTG++ +  WR           ++Y WT D+ +F+   +D  +IG  SG + +W +  L +G S+  ETF+N  LCGD  D
Sbjct:  634 NREWELVTVSE---MCRRLSLDQELELPIPDGAATSQILDELMIRQVMDILPPRAEGYPWVNIYNSEKHGFSLATMYRKMAEFDEDLSPVLLIIRDTKEHVFGAVVSSAIRPNDHFFGTGDSCLL-WRFTGEVPHTRELRQYNWTGDNQYFVNAAKDSLSIGAGSGRNGLWLDADLNHGSSQKCETFDNEPLCGDDQD 827          

HSP 2 Score: 61.2326 bits (147), Expect = 2.008e-9
Identity = 53/197 (26.90%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTD--------ASSTNRIS----LRASHKSHPGTA-----------SRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLS 682
            +Y + + DTL++VA   +CT   L   NK++    ++FPGQK+ +P  +  ++ D         SS N+IS         +  PG A              SAP+P  R  + E++ D +  ++F+K K  ++   S  +  GTLL+TP  L+FDP     D+    V  N   ++  G+   ++ + S++ + ++S
Sbjct:   23 DYTITETDTLERVAASHDCTVGELMKLNKMA--SRMVFPGQKILVPLANADDVFDPPSSASSLKSSGNQISGIENAEDGIRKGPGGAVPAHVRRGSFTKTQSAPIP--RGSNDEADTDCL--QRFLKIKVKQVTE-SDGTVSGTLLVTPNCLMFDP-----DVSHPLVKENGPDLY--GMVANMDEIQSVSVYKEIS 205          
BLAST of LysM domain-containing protein vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078816)

HSP 1 Score: 112.464 bits (280), Expect = 4.070e-28
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 2
Query: 1193 GTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRT 1666
            G ++IL E     L + LP+   G + SL++ T  HG++L ++YRKM     P L++I+D  + VFGA  S +LH+S+H+YGTGE+ ++ + P FK + WT ++ +F+KG+ +  +IG   G   +W +  L  GRS+   T+ N  L    + V +T
Sbjct:   28 GKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKT 185          
BLAST of LysM domain-containing protein vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0273430)

HSP 1 Score: 112.464 bits (280), Expect = 4.070e-28
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 2
Query: 1193 GTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRT 1666
            G ++IL E     L + LP+   G + SL++ T  HG++L ++YRKM     P L++I+D  + VFGA  S +LH+S+H+YGTGE+ ++ + P FK + WT ++ +F+KG+ +  +IG   G   +W +  L  GRS+   T+ N  L    + V +T
Sbjct:   28 GKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKT 185          
BLAST of LysM domain-containing protein vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078814)

HSP 1 Score: 112.849 bits (281), Expect = 4.746e-28
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 2
Query: 1193 GTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRT 1666
            G ++IL E     L + LP+   G + SL++ T  HG++L ++YRKM     P L++I+D  + VFGA  S +LH+S+H+YGTGE+ ++ + P FK + WT ++ +F+KG+ +  +IG   G   +W +  L  GRS+   T+ N  L    + V +T
Sbjct:   49 GKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKT 206          
BLAST of LysM domain-containing protein vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078817)

HSP 1 Score: 112.849 bits (281), Expect = 4.746e-28
Identity = 55/148 (37.16%), Postives = 90/148 (60.81%), Query Frame = 2
Query: 1193 GTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            G ++IL E     L + LP+   G + SL++ T  HG++L ++YRKM     P L++I+D  + VFGA  S +LH+S+H+YGTGE+ ++ + P FK + WT ++ +F+KG+ +  +IG   G   +W +  L  GRS+   T+ N  L
Sbjct:   46 GKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPL 193          
BLAST of LysM domain-containing protein vs. Ensembl Fly
Match: mtd (gene:FBgn0013576 transcript:FBtr0078815)

HSP 1 Score: 112.464 bits (280), Expect = 2.307e-27
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 2
Query: 1193 GTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRT 1666
            G ++IL E     L + LP+   G + SL++ T  HG++L ++YRKM     P L++I+D  + VFGA  S +LH+S+H+YGTGE+ ++ + P FK + WT ++ +F+KG+ +  +IG   G   +W +  L  GRS+   T+ N  L    + V +T
Sbjct:  103 GKTEILTEEHREKLCSHLPARAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSDHFYGTGESLLYKFNPSFKVFHWTGENMYFIKGNMESLSIGAGDGRFGLWLDGDLNQGRSQQCSTYGNEPLAPQEDFVIKT 260          
BLAST of LysM domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-15d5.11 (si:ch211-15d5.11 [Source:ZFIN;Acc:ZDB-GENE-131121-177])

HSP 1 Score: 137.502 bits (345), Expect = 1.836e-33
Identity = 76/178 (42.70%), Postives = 107/178 (60.11%), Query Frame = 2
Query: 1103 WELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            WE+V   + ++ A    E +   +        S IL+   + +++  LP    G    L Y T  HG SL T+YRK+ AT+ P L+LIKD++  VFG+F+S  LH S+ +YGTGETF+F   P FK ++WT ++SFF+KGD D FAIG  SGH  +W ++ L  GRS P  TFNN +L
Sbjct:  463 WEIVSAEESALKAPGSTEPDSLSYI----LSQSVILDAQQVKEISRELPPRTIGYTWQLSYSTDKHGASLKTLYRKLSATDSPVLILIKDHNQQVFGSFLSHPLHPSDAFYGTGETFLFLSHPRFKCFKWTGENSFFIKGDLDSFAIGGGSGHFGLWVDERLFLGRSSPCFTFNNCSL 636          
BLAST of LysM domain-containing protein vs. Ensembl Zebrafish
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 114.39 bits (285), Expect = 2.138e-28
Identity = 64/160 (40.00%), Postives = 93/160 (58.13%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            E E F+P L    S +L+   I  LA  LP    G   SL + T  HG S+ ++YR M++ + P L++IKD+   +FGA  S    +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A+G   G   +W +  L +GR+   +TF NP L 
Sbjct:   39 EPETFRPNL-TEPSVLLQPEHIEKLAKHLPPRTIGYPWSLAFSTSKHGMSMKSLYRAMQSQDSPVLMVIKDSDGQMFGALASQPFKVSDGFYGTGETFVFTFYPEFEVFKWTGDNMFFIKGDMDSLAVGGGGGEFGLWLDGDLYHGRTHSCKTFGNPMLS 197          
BLAST of LysM domain-containing protein vs. Ensembl Zebrafish
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 116.701 bits (291), Expect = 1.521e-26
Identity = 64/159 (40.25%), Postives = 93/159 (58.49%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E F+P L    S +L+   I  LA  LP    G   SL + T  HG S+ ++YR M++ + P L++IKD+   +FGA  S    +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A+G   G   +W +  L +GR+   +TF NP L
Sbjct:  667 EPETFRPNL-TEPSVLLQPEHIEKLAKHLPPRTIGYPWSLAFSTSKHGMSMKSLYRAMQSQDSPVLMVIKDSDGQMFGALASQPFKVSDGFYGTGETFVFTFYPEFEVFKWTGDNMFFIKGDMDSLAVGGGGGEFGLWLDGDLYHGRTHSCKTFGNPML 824          

HSP 2 Score: 55.0694 bits (131), Expect = 2.982e-7
Identity = 42/154 (27.27%), Postives = 66/154 (42.86%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-------------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY+VE  DTL  +A+KF+ T + L   NKL  F   + PG+ L +P  +                    ++  D     +  L   H+ H  +      P    R  SS SE ++   ++F+K     I +  K    G LL+TP  ++FDP +
Sbjct:   98 EYVVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGKVLYVPDPEYISSAESSPSLSPISPLSPTSSEADLEKATK-GLDHVHRRHSSSTGLAHGPPRPARVVSSTSEEEEALTEKFLKMNCKYITD-GKGIVSGVLLVTPNNIMFDPHK 247          
BLAST of LysM domain-containing protein vs. Ensembl Zebrafish
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 112.464 bits (280), Expect = 2.818e-25
Identity = 49/119 (41.18%), Postives = 75/119 (63.03%), Query Frame = 2
Query: 1280 VYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
             + T  HG S+ ++YR M++ + P L++IKD+   +FGA  S    +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A+G   G   +W +  L +GR+   +TF NP L
Sbjct:  614 AFSTSKHGMSMKSLYRAMQSQDSPVLMVIKDSDGQMFGALASQPFKVSDGFYGTGETFVFTFYPEFEVFKWTGDNMFFIKGDMDSLAVGGGGGEFGLWLDGDLYHGRTHSCKTFGNPML 732          

HSP 2 Score: 55.4546 bits (132), Expect = 2.118e-7
Identity = 42/154 (27.27%), Postives = 66/154 (42.86%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-------------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY+VE  DTL  +A+KF+ T + L   NKL  F   + PG+ L +P  +                    ++  D     +  L   H+ H  +      P    R  SS SE ++   ++F+K     I +  K    G LL+TP  ++FDP +
Sbjct:    2 EYVVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGKVLYVPDPEYISSAESSPSLSPISPLSPTSSEADLEKATK-GLDHVHRRHSSSTGLAHGPPRPARVVSSTSEEEEALTEKFLKMNCKYITD-GKGIVSGVLLVTPNNIMFDPHK 151          
BLAST of LysM domain-containing protein vs. Ensembl Zebrafish
Match: LO017815.1 (nuclear receptor coactivator 7-like [Source:NCBI gene;Acc:792958])

HSP 1 Score: 103.99 bits (258), Expect = 2.172e-24
Identity = 67/184 (36.41%), Postives = 102/184 (55.43%), Query Frame = 2
Query: 1097 KSWELVDTSQQ----SVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            ++W++V   QQ    SV + A  + E +   P L    SQIL+E  +  L + +P+   G+   LVY T  HG SL T+YR+M   + P L++I+D    VFGAF SD   +S++ YGTGETF++ + P F+ + WT ++S+F++G  D   +G   G   +W +  L  G S    TF N  L
Sbjct:   58 ENWQIVSVKQQKRRTSVCSSA--DSESDDLLPVL-INHSQILKELHLEQLMSHIPARAQGNQWKLVYSTAVHGTSLRTLYRQMAELDRPVLMVIRDTDGQVFGAFSSDPFRVSSYCYGTGETFLYSFSPEFQVFRWTGENSYFVRGFLDSLQMGGGGGPFGLWLDADLYRGSSYSCNTFCNRPL 238          
BLAST of LysM domain-containing protein vs. Ensembl Xenopus
Match: fbxo10 (F-box protein 10 [Source:Xenbase;Acc:XB-GENE-987647])

HSP 1 Score: 125.946 bits (315), Expect = 2.543e-32
Identity = 78/200 (39.00%), Postives = 114/200 (57.00%), Query Frame = 2
Query: 1043 CKYNHFNNEDLDISIDNDKS-WELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTA-SGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            C Y    N +L+ ++ +D+S +E +  S+ +   +   + +EE+  P L  G SQI     I  L   LP  + G +  L+Y T   G+SL T+YR M   + P LL++KDN   VFGA+ +  LHISN +YGTGETF+F + P  K + WT D+SFF++GD D    G   +G   +W +  L +GRS+  ETFNN  L
Sbjct:    6 CSYAPLEN-NLNEALSSDESDFEYIHESEVTKPTETKGKVKEEQDDPVL-IGISQIFGADSIKQLCQHLPPRVLGHSWKLLYSTDKDGFSLRTMYRTMNNVSSPVLLIVKDNEGRVFGAYSTIELHISNTFYGTGETFLFSFTPELKVFRWTGDNSFFVRGDADAITFGGGKTGSIGLWLDGDLYHGRSQRCETFNNQIL 203          
BLAST of LysM domain-containing protein vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 116.316 bits (290), Expect = 3.644e-26
Identity = 68/159 (42.77%), Postives = 91/159 (57.23%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E F+P L    S +L+   I  L   LP    G   +LVY T  HG SL T+YR M   + P LL+IKD+   +FGA  S+   IS+ +YGTGETF+F + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N  L
Sbjct:  657 EPESFRPNL-SDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTMLGLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCIL 814          

HSP 2 Score: 54.6842 bits (130), Expect = 5.518e-7
Identity = 42/146 (28.77%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   + PGQ L +P  D                 + +++      S  S   T+S   + +  +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP +
Sbjct:   96 EYTVETRDSLNSIALKFDTTPNELVQLNKL--FSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEEEAFTEKFLKINCKYITD-GKGTVNGVLLVTPNNIMFDPHK 238          
BLAST of LysM domain-containing protein vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 115.931 bits (289), Expect = 4.304e-26
Identity = 68/159 (42.77%), Postives = 91/159 (57.23%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E F+P L    S +L+   I  L   LP    G   +LVY T  HG SL T+YR M   + P LL+IKD+   +FGA  S+   IS+ +YGTGETF+F + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N  L
Sbjct:  663 EPESFRPNL-SDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTMLGLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCIL 820          

HSP 2 Score: 54.6842 bits (130), Expect = 5.254e-7
Identity = 42/146 (28.77%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   + PGQ L +P  D                 + +++      S  S   T+S   + +  +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP +
Sbjct:   95 EYTVETRDSLNSIALKFDTTPNELVQLNKL--FSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEEEAFTEKFLKINCKYITD-GKGTVNGVLLVTPNNIMFDPHK 237          
BLAST of LysM domain-containing protein vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 115.931 bits (289), Expect = 4.327e-26
Identity = 68/159 (42.77%), Postives = 91/159 (57.23%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E F+P L    S +L+   I  L   LP    G   +LVY T  HG SL T+YR M   + P LL+IKD+   +FGA  S+   IS+ +YGTGETF+F + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N  L
Sbjct:  617 EPESFRPNL-SDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTMLGLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCIL 774          

HSP 2 Score: 55.0694 bits (131), Expect = 4.053e-7
Identity = 42/146 (28.77%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   + PGQ L +P  D                 + +++      S  S   T+S   + +  +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP +
Sbjct:   56 EYTVETRDSLNSIALKFDTTPNELVQLNKL--FSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEEEAFTEKFLKINCKYITD-GKGTVNGVLLVTPNNIMFDPHK 198          
BLAST of LysM domain-containing protein vs. Ensembl Xenopus
Match: tbl2 (transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GENE-5852596])

HSP 1 Score: 115.931 bits (289), Expect = 4.503e-26
Identity = 68/159 (42.77%), Postives = 91/159 (57.23%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E F+P L    S +L+   I  L   LP    G   +LVY T  HG SL T+YR M   + P LL+IKD+   +FGA  S+   IS+ +YGTGETF+F + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N  L
Sbjct:  664 EPESFRPNL-SDPSSLLQTDQIEKLTKHLPPRTIGYPWTLVYSTAKHGMSLKTLYRTMLGLDTPVLLVIKDSDAQIFGALASEPFKISDCFYGTGETFLFTFCPDFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHTCKTFGNCIL 821          

HSP 2 Score: 54.6842 bits (130), Expect = 5.301e-7
Identity = 42/146 (28.77%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   + PGQ L +P  D                 + +++      S  S   T+S   + +  +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP +
Sbjct:   96 EYTVETRDSLNSIALKFDTTPNELVQLNKL--FSRAVVPGQLLYVPDPDYISSVESSPSLSPISPLSPTSSEAEFEKSTVSMEITSSPAYSAIRPSRVVSSTSEEEEAFTEKFLKINCKYITD-GKGTVNGVLLVTPNNIMFDPHK 238          
BLAST of LysM domain-containing protein vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 122.094 bits (305), Expect = 4.319e-31
Identity = 73/167 (43.71%), Postives = 97/167 (58.08%), Query Frame = 2
Query: 1136 VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            VA A  + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+   +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:   34 VAPAKADLEPESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTL 199          
BLAST of LysM domain-containing protein vs. Ensembl Mouse
Match: Tldc2 (TBC/LysM associated domain containing 2 [Source:MGI Symbol;Acc:MGI:2686178])

HSP 1 Score: 117.087 bits (292), Expect = 1.680e-29
Identity = 65/159 (40.88%), Postives = 94/159 (59.12%), Query Frame = 2
Query: 1163 EEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            ++  +PQL    SQ+L  S I  L+  LP  + G   SLV+ T   G+SL  +YR+M+  + P LLL++D    +FGAF S  + +S  +YGTGETF+F + P  K ++WT  +SFF+KGD D   +G+ SG   +W +  L +G S P  TFNN  L 
Sbjct:   25 QDPVEPQL-TEASQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLA 182          
BLAST of LysM domain-containing protein vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 125.946 bits (315), Expect = 1.919e-29
Identity = 76/184 (41.30%), Postives = 106/184 (57.61%), Query Frame = 2
Query: 1097 KSWELVDTSQQSV----VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            + WE+  T+++ +    VA A  + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+   +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  554 REWEI--TTREDINSKQVAPAKADLEPESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTL 734          

HSP 2 Score: 50.8322 bits (120), Expect = 5.310e-6
Identity = 41/152 (26.97%), Postives = 67/152 (44.08%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   +  GQ L +P  +                     ++A      +   +H      AS +S   P  R  SS SE ++   ++F+K    + + + K +  G LL+TP  ++FDP +
Sbjct:   11 EYTVESRDSLNSIALKFDTTPNELVQLNKL--FSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTTPDVAHPKEAPPASTVSGIRP-ARVVSSTSEEEEAFTEKFLKINC-KYITIGKGTVSGVLLVTPNNIMFDPHK 158          
BLAST of LysM domain-containing protein vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 125.946 bits (315), Expect = 1.919e-29
Identity = 76/184 (41.30%), Postives = 106/184 (57.61%), Query Frame = 2
Query: 1097 KSWELVDTSQQSV----VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            + WE+  T+++ +    VA A  + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+   +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  554 REWEI--TTREDINSKQVAPAKADLEPESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTL 734          

HSP 2 Score: 50.8322 bits (120), Expect = 5.310e-6
Identity = 41/152 (26.97%), Postives = 67/152 (44.08%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   +  GQ L +P  +                     ++A      +   +H      AS +S   P  R  SS SE ++   ++F+K    + + + K +  G LL+TP  ++FDP +
Sbjct:   11 EYTVESRDSLNSIALKFDTTPNELVQLNKL--FSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTTPDVAHPKEAPPASTVSGIRP-ARVVSSTSEEEEAFTEKFLKINC-KYITIGKGTVSGVLLVTPNNIMFDPHK 158          
BLAST of LysM domain-containing protein vs. Ensembl Mouse
Match: Oxr1 (oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:2179326])

HSP 1 Score: 125.946 bits (315), Expect = 1.919e-29
Identity = 76/184 (41.30%), Postives = 106/184 (57.61%), Query Frame = 2
Query: 1097 KSWELVDTSQQSV----VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            + WE+  T+++ +    VA A  + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+   +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  554 REWEI--TTREDINSKQVAPAKADLEPESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTL 734          

HSP 2 Score: 50.8322 bits (120), Expect = 5.310e-6
Identity = 41/152 (26.97%), Postives = 67/152 (44.08%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD-----------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  D+L  +A+KF+ T + L   NKL  F   +  GQ L +P  +                     ++A      +   +H      AS +S   P  R  SS SE ++   ++F+K    + + + K +  G LL+TP  ++FDP +
Sbjct:   11 EYTVESRDSLNSIALKFDTTPNELVQLNKL--FSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTTPDVAHPKEAPPASTVSGIRP-ARVVSSTSEEEEAFTEKFLKINC-KYITIGKGTVSGVLLVTPNNIMFDPHK 158          
BLAST of LysM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0IID2|TLDC2_BOVIN (TLD domain-containing protein 2 OS=Bos taurus OX=9913 GN=TLDC2 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 8.358e-29
Identity = 65/159 (40.88%), Postives = 93/159 (58.49%), Query Frame = 2
Query: 1163 EEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            E    PQL  G SQ+L  S ++ L+  LP  + G + SL + T   G+SL ++YR+M+  + P LL+++D    +FGAF S  L +S  +YGTGETF+F + P  K ++WT  +SFF+KGD D   +G  SG   +W +  L  G S P  TFNN  L 
Sbjct:   44 EHPMVPQL-AGASQVLGASEMSQLSLHLPPRVTGYSWSLAFCTSRDGFSLQSLYRQMEGHSGPVLLVLRDQDGQMFGAFSSSALRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGCGSGRFGLWLDGDLYRGGSHPCATFNNEVLA 201          
BLAST of LysM domain-containing protein vs. UniProt/SwissProt
Match: sp|A2ACG1|TLDC2_MOUSE (TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.175e-28
Identity = 65/159 (40.88%), Postives = 94/159 (59.12%), Query Frame = 2
Query: 1163 EEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            ++  +PQL    SQ+L  S I  L+  LP  + G   SLV+ T   G+SL  +YR+M+  + P LLL++D    +FGAF S  + +S  +YGTGETF+F + P  K ++WT  +SFF+KGD D   +G+ SG   +W +  L +G S P  TFNN  L 
Sbjct:   25 QDPVEPQL-TEASQVLGASEIKQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEGHSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDSLMMGSGSGQFGLWLDGDLYHGGSYPCATFNNEVLA 182          
BLAST of LysM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N573|OXR1_HUMAN (Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 3.325e-28
Identity = 73/167 (43.71%), Postives = 97/167 (58.08%), Query Frame = 2
Query: 1136 VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            VA    + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+ L +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  692 VATVKADLESESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTL 857          
BLAST of LysM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4KMM3|OXR1_MOUSE (Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3)

HSP 1 Score: 124.79 bits (312), Expect = 3.345e-28
Identity = 73/167 (43.71%), Postives = 97/167 (58.08%), Query Frame = 2
Query: 1136 VADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            VA A  + E E F+P L    S++L    I  L   LP    G   +LVY TG HG SL T+YR M   + P L++IKD+   VFGA  S+   +S+ +YGTGETFVF + P F+ ++WT D+ FF+KGD D  A G   G  A+W +  L +GRS   +TF N TL
Sbjct:  684 VAPAKADLEPESFRPNL-SDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTL 849          
BLAST of LysM domain-containing protein vs. UniProt/SwissProt
Match: sp|A0PJX2|TLDC2_HUMAN (TLD domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TLDC2 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 3.518e-28
Identity = 63/154 (40.91%), Postives = 90/154 (58.44%), Query Frame = 2
Query: 1178 PQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            PQL    SQ+L  S I  L+   P  + G   SLV+ T   G+SL ++YR+M+  + P LL+++D    +FGAF S  + +S  +YGTGETF+F + P  K ++WT  +SFF+KGD D   +G+ SG   +W +  L  G S P  TFNN  L 
Sbjct:   47 PQL-TEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLA 199          
BLAST of LysM domain-containing protein vs. TrEMBL
Match: A0A3R7FS10 (TLD domain-containing protein 2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=TLDC2 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 3.378e-50
Identity = 122/320 (38.12%), Postives = 173/320 (54.06%), Query Frame = 2
Query:  863 FGIPKDRIEEAYSFLIISGIGSGFDEKPSSKXXXXXXXXXXXXSRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND---VDRTNAENTINLLSNNK------SSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            F IP DRI E ++FL+ +G+G+                        N ++ + S  SS +    H  N+ L               S++S+V +AL+  E     P ++ GTS IL + M+ DL  + P++  GSNL LVY+T   GYSL T+YRK +      LLLI+D S  VFGA MS+ +H S H+YGTGET VFHW P FK+Y+WTK + FFM+G    F IG  SG +AIWF++ LKYGRSEPT+TF+NP L G   +      +N +NT     N+       ++ VS +    ++      F+I+CLE+W  
Sbjct:  313 FKIPTDRIAEVFAFLLRAGVGA------------------------NHNKRLTSSSSSHLVDDEH--NKSL---------------SRRSMVEEALECMESATPLPGMYNGTSAILSDDMLEDLGANFPTHWIGSNLRLVYKTEQDGYSLHTLYRKAREVTGGVLLLIRDTSGMVFGALMSETMHCSQHFYGTGETCVFHWSPDFKRYDWTKKNYFFMRGSPASFQIGGQSGRNAIWFDEALKYGRSEPTDTFDNPILSGRLAEFQFASLSNPDNTSTDQENDNPRDDPDTNVVSPNHSVASADVDSIPFLIDCLELWEL 591          
BLAST of LysM domain-containing protein vs. TrEMBL
Match: A0A0X3P3L1 (TLD domain-containing protein 2 OS=Schistocephalus solidus OX=70667 GN=TLDC2 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 7.175e-50
Identity = 101/224 (45.09%), Postives = 141/224 (62.95%), Query Frame = 2
Query: 1124 QQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            +QS+V  AL + E   F+  L   TS IL++ M++DL+  LP +  G  + LV+ T   G+SL ++YRK +      LLLI+D +NT FGA +S+ +  S H+YGTGE+ VFHW+P FK+Y+WTK + FFM+G  DCF IG  SGHSAIWF+++LKYGRSE T+TF+NP LCG      R  A+  I+   +NKS       +  +  P    F+I+ LEVW  
Sbjct:  422 RQSIVEKALDDMEAVPFELSLGEATSVILDDQMLHDLSQGLPLHWVGYGMRLVFSTDHDGFSLNSLYRKTEEVKNVVLLLIRDTTNTAFGAVLSERMRCSLHFYGTGESCVFHWKPAFKRYDWTKKNYFFMRGAPDCFLIGAQSGHSAIWFDESLKYGRSEATDTFDNPVLCGQS----RHAAKGIIHRTPSNKS------LQPNDVRPSSVPFIIDQLEVWEM 635          

HSP 2 Score: 65.855 bits (159), Expect = 2.190e-7
Identity = 54/169 (31.95%), Postives = 78/169 (46.15%), Query Frame = 2
Query:  164 YIVEDGDTLQKVAVKF-NCTASNLASENKLSHF---QSILFPGQKLKIP---KVDGTNL---------------------TDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDK 586
            YIV+ GD+L  +A +F N T + LA  NKL      Q  LFPGQKL +P   ++   N+                     TD  +TN+        + P +AS I  P  + R  S      D+ E+ FVK  A RI++LSK    G L++TP  + FD    + +L +
Sbjct:   13 YIVQAGDSLMSIAARFGNITPAQLARFNKLGMLGVGQPPLFPGQKLYVPSPEEMAAQNVRLRHFPGAATRVNALTADFSGTDHHATNQGVFSTPASNVPRSAS-IHVPANSDRKLSETQA--DVMERLFVKTPARRILHLSKTPVDGILIVTPDAVCFDALATASELSE 178          
BLAST of LysM domain-containing protein vs. TrEMBL
Match: A0A4S2LGX2 (LysM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007230 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.027e-49
Identity = 121/320 (37.81%), Postives = 172/320 (53.75%), Query Frame = 2
Query:  863 FGIPKDRIEEAYSFLIISGIGSGFDEKPSSKXXXXXXXXXXXXSRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND---VDRTNAENTINLLSNNK------SSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            F IP DRI E ++FL+ +G+G+                        N ++ + S  SS +    H  N+ L               S++S+V +AL+  E     P ++ GTS IL   M+ DL  + P++  GSNL L+Y+T   GYSL T+YRK +      LLLI+D S  VFGA MS+ +H S H+YGTGET VFHW P FK+Y+WTK + FFM+G    F IG  SG +AIWF++ LKYGRSEPT+TF+NP L G  ++      +N +NT     N        ++ VS +    ++      F+I+CLE+W  
Sbjct:  374 FKIPTDRIAEVFAFLLRAGVGA------------------------NHNKRLTSSSSSHLVGDEH--NKSL---------------SRRSMVEEALECMESATPLPSMYDGTSAILSHDMLEDLGANFPTHWIGSNLRLIYKTEQDGYSLHTLYRKARNVTAGVLLLIRDTSGMVFGALMSETMHCSQHFYGTGETCVFHWSPDFKRYDWTKKNYFFMRGSPASFQIGGQSGRNAIWFDEALKYGRSEPTDTFDNPILSGRLDEFQFASLSNPDNTSTDQENGNPRDGPDTNVVSPNHSVASADLDSIPFLIDCLELWEL 652          
BLAST of LysM domain-containing protein vs. TrEMBL
Match: G7Y8Z8 (LysM domain-containing protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_103061 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.955e-49
Identity = 122/320 (38.12%), Postives = 173/320 (54.06%), Query Frame = 2
Query:  863 FGIPKDRIEEAYSFLIISGIGSGFDEKPSSKXXXXXXXXXXXXSRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND---VDRTNAENTINLLSNNK------SSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            F IP DRI E ++FL+ +G+G+                        N ++ + S  SS +    H  N+ L               S++S+V +AL+  E     P ++ GTS IL + M+ DL  + P++  GSNL LVY+T   GYSL T+YRK +      LLLI+D S  VFGA MS+ +H S H+YGTGET VFHW P FK+Y+WTK + FFM+G    F IG  SG +AIWF++ LKYGRSEPT+TF+NP L G   +      +N +NT     N+       ++ VS +    ++      F+I+CLE+W  
Sbjct:  388 FKIPTDRIAEVFAFLLRAGVGA------------------------NHNKRLTSSSSSHLVDDEH--NKSL---------------SRRSMVEEALECMESATPLPGMYNGTSAILSDDMLEDLGANFPTHWIGSNLRLVYKTEQDGYSLHTLYRKAREVTGGVLLLIRDTSGMVFGALMSETMHCSQHFYGTGETCVFHWSPDFKRYDWTKKNYFFMRGSPASFQIGGQSGRNAIWFDEALKYGRSEPTDTFDNPILSGRLAEFQFASLSNPDNTSTDQENDNPRDDPDTNVVSPNHSVASADVDSIPFLIDCLELWEL 666          
BLAST of LysM domain-containing protein vs. TrEMBL
Match: A0A3P7LCT0 (TLDc domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS7021 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 3.109e-48
Identity = 97/221 (43.89%), Postives = 139/221 (62.90%), Query Frame = 2
Query: 1133 VVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            +V  AL + E   F+  L   TS IL++ M++DL+  LP +  G  +  V+ T   G+SL ++YRK +      LLLI+D +NT FGA +S+ +  S H+YGTGE+ VFHW+P FK+Y+WTK + FFM+G  DCF IG  SGHSAIWF+++LKYGRSE T+TF+NP LCG         A+  I+ + ++KS  +  +    +S P    F+I+ LEVW  
Sbjct:    1 MVEKALDDMESIPFELSLGGSTSVILDDEMLHDLSQGLPLHWVGYGMRPVFSTDHDGFSLNSLYRKTEEVKNVVLLLIRDTTNTTFGAVLSERMRCSLHFYGTGESCVFHWKPTFKRYDWTKKNYFFMRGAPDCFLIGAKSGHSAIWFDESLKYGRSEATDTFDNPVLCGQSMHA----AKGVISRIPSSKS--LQPNDVCLSSVP----FIIDQLEVWEM 211          
BLAST of LysM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-15d5.11 (oxidation resistance protein 1-like [Source:NCBI gene;Acc:103021501])

HSP 1 Score: 133.65 bits (335), Expect = 4.100e-35
Identity = 62/119 (52.10%), Postives = 82/119 (68.91%), Query Frame = 2
Query: 1280 VYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
             Y T  HG SL T+YRK+  ++ P LL+I+D++  VFG F+S  L  S+ +YGTGETF+F  RP FK + WT ++SFF+KGD D FAIG  SGH  +W ++TL  GRS P  TFNN +L
Sbjct:   92 AYSTSKHGASLKTLYRKLSVSDSPVLLIIRDDNQQVFGGFLSHPLRPSDTFYGTGETFLFLLRPRFKCFHWTGENSFFIKGDLDSFAIGGGSGHFGLWLDETLYLGRSSPCYTFNNCSL 210          
BLAST of LysM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-15d5.11 (oxidation resistance protein 1-like [Source:NCBI gene;Acc:103021501])

HSP 1 Score: 139.813 bits (351), Expect = 2.688e-34
Identity = 80/188 (42.55%), Postives = 108/188 (57.45%), Query Frame = 2
Query: 1091 NDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMIND------LATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            N   WE+V          +L   +E         G S IL +S+I D      L++ LP    G +  L Y T  HG SL T+YRK+  ++ P LL+I+D++  VFG F+S  L  S+ +YGTGETF+F  RP FK + WT ++SFF+KGD D FAIG  SGH  +W ++TL  GRS P  TFNN +L
Sbjct:  445 NGDEWEMVSVEDSRGRVSSLSADKEPD-------GMSDILRQSLILDAQQVRELSSELPPRTVGHSWKLAYSTSKHGASLKTLYRKLSVSDSPVLLIIRDDNQQVFGGFLSHPLRPSDTFYGTGETFLFLLRPRFKCFHWTGENSFFIKGDLDSFAIGGGSGHFGLWLDETLYLGRSSPCYTFNNCSL 625          
BLAST of LysM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-15d5.11 (oxidation resistance protein 1-like [Source:NCBI gene;Acc:103021501])

HSP 1 Score: 139.813 bits (351), Expect = 4.823e-34
Identity = 80/188 (42.55%), Postives = 108/188 (57.45%), Query Frame = 2
Query: 1091 NDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMIND------LATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            N   WE+V          +L   +E         G S IL +S+I D      L++ LP    G +  L Y T  HG SL T+YRK+  ++ P LL+I+D++  VFG F+S  L  S+ +YGTGETF+F  RP FK + WT ++SFF+KGD D FAIG  SGH  +W ++TL  GRS P  TFNN +L
Sbjct:  526 NGDEWEMVSVEDSRGRVSSLSADKEPD-------GMSDILRQSLILDAQQVRELSSELPPRTVGHSWKLAYSTSKHGASLKTLYRKLSVSDSPVLLIIRDDNQQVFGGFLSHPLRPSDTFYGTGETFLFLLRPRFKCFHWTGENSFFIKGDLDSFAIGGGSGHFGLWLDETLYLGRSSPCYTFNNCSL 706          
BLAST of LysM domain-containing protein vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 130.568 bits (327), Expect = 6.346e-31
Identity = 73/186 (39.25%), Postives = 104/186 (55.91%), Query Frame = 2
Query: 1097 KSWEL-----VDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            K WE+     V++   + +  +L   E E FKP +    S +LE   I  LA  LP    G   +L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FF+KGD D  A G  SG   +W +  L +GRS   +TF NP L 
Sbjct:  630 KEWEITTKEEVNSKHGTSITASL---EPETFKPNM-TEPSDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYRIMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLS 811          

HSP 2 Score: 51.9878 bits (123), Expect = 2.027e-6
Identity = 48/160 (30.00%), Postives = 67/160 (41.88%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIP-------------------------KVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  DTL  +A+KF+ T + L   NKL  F   + PGQ L +P                         + D   +TD+    R    AS           SA  P +R  SS SE ++   ++F+K     I +  K    G LL+TP  ++FDP R
Sbjct:   97 EYSVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPAS------IPPAFSALRP-SRVVSSTSEEEEALTEKFLKINCKYITD-GKGVVSGVLLVTPNNIMFDPHR 246          
BLAST of LysM domain-containing protein vs. Ensembl Cavefish
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:103022741])

HSP 1 Score: 130.183 bits (326), Expect = 6.486e-31
Identity = 73/186 (39.25%), Postives = 104/186 (55.91%), Query Frame = 2
Query: 1097 KSWEL-----VDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLC 1639
            K WE+     V++   + +  +L   E E FKP +    S +LE   I  LA  LP    G   +L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FF+KGD D  A G  SG   +W +  L +GRS   +TF NP L 
Sbjct:  623 KEWEITTKEEVNSKHGTSITASL---EPETFKPNM-TEPSDLLEAEQIEKLAKHLPPRTIGYPWTLAFSTSKHGMSIKTLYRIMQGQDSPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFSFFPDFEAYKWTGDNMFFIKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPMLS 804          

HSP 2 Score: 51.9878 bits (123), Expect = 1.856e-6
Identity = 48/160 (30.00%), Postives = 67/160 (41.88%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIP-------------------------KVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  DTL  +A+KF+ T + L   NKL  F   + PGQ L +P                         + D   +TD+    R    AS           SA  P +R  SS SE ++   ++F+K     I +  K    G LL+TP  ++FDP R
Sbjct:  101 EYSVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKVTDSDGAPRSEAPAS------IPPAFSALRP-SRVVSSTSEEEEALTEKFLKINCKYITD-GKGVVSGVLLVTPNNIMFDPHR 250          
BLAST of LysM domain-containing protein vs. Ensembl Sea Lamprey
Match: oxr1b (oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2438])

HSP 1 Score: 139.428 bits (350), Expect = 1.594e-34
Identity = 74/157 (47.13%), Postives = 99/157 (63.06%), Query Frame = 2
Query: 1166 EKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E +KP L+  +S ILE+  IN LA +LP    G   +L Y T  HG SL T+YR M   + P LL+IKD    +FGA  SD   +S+H+YGTGETF+F + P ++ Y+WT D+ FF+KGD D  AIG  SG   +W ++ L +GRS   +TFNN TL
Sbjct:  641 EAWKPVLNS-SSSILEQDHINKLAANLPPRTVGYPWTLAYSTSKHGMSLKTLYRTMVGLDSPMLLVIKDTDRQIFGALSSDPFKVSDHFYGTGETFLFTFNPEYQCYKWTGDNLFFIKGDMDSLAIGGGSGQFGLWLDEDLYHGRSHFCKTFNNETL 796          

HSP 2 Score: 55.4546 bits (132), Expect = 3.787e-8
Identity = 45/159 (28.30%), Postives = 64/159 (40.25%), Query Frame = 2
Query:  155 MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD----------------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            M EY     DTL  +A+KF+ T + L   NKL  F  ++ PGQ L  P  D                                   + R S +  P T+S    P  + R  SS SE ++   ++F+K     I N  K    G LL+TP  ++FDP +
Sbjct:   23 MMEYTAGAQDTLNSIALKFDTTPNELVQLNKL--FSRMIVPGQMLYCPDPDYMSSEGSSPSVSPVSPLSPTSSEAEFEKLQDMEPATQRPSERPAPATSS--PNPARSARVVSSTSEEEEALSERFLKINCKYITN-GKGVVGGVLLVTPNNIMFDPHK 176          
BLAST of LysM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002915.1 (pep scaffold:Pmarinus_7.0:GL486283:803:7015:1 gene:ENSPMAG00000002672.1 transcript:ENSPMAT00000002915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 2.428e-33
Identity = 58/119 (48.74%), Postives = 77/119 (64.71%), Query Frame = 2
Query: 1280 VYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
             Y T  HG SL T+YR M   + P LL+IKD    +FGA  SD   +S+H+YGTGETF+F + P ++ Y+WT D+ FF+KGD D  AIG  SG   +W ++ L +GRS   +TFNN TL
Sbjct:   18 AYSTSKHGMSLKTLYRTMVGLDSPMLLVIKDTDRQIFGALSSDPFKVSDHFYGTGETFLFTFNPEYQCYKWTGDNLFFIKGDMDSLAIGGGSGQFGLWLDEDLYHGRSHFCKTFNNETL 136          
BLAST of LysM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008752.1 (pep scaffold:Pmarinus_7.0:GL487419:1521:5503:-1 gene:ENSPMAG00000007923.1 transcript:ENSPMAT00000008752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 3.149e-29
Identity = 63/160 (39.38%), Postives = 88/160 (55.00%), Query Frame = 2
Query: 1160 EEEKFKPQLHCGTSQILEESMI-NDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E  +P L  G S +L++  +   L+  LP    G    L Y T THG SL T+YR +   + P LL ++D    VFGA  S+   +S H+YGTGE F+F + P  K Y WT D++FF+KGD D   +G+  G   +W +  L +GRS   +TF N  L
Sbjct:    6 EGEVLRPLL-IGQSNVLQQFHVEQQLSRHLPPRTVGYPWQLKYGTATHGTSLRTLYRALAPLSSPVLLTVQDTHKQVFGALASEPFKVSEHFYGTGECFLFTFNPDLKVYRWTGDNTFFIKGDLDSLGMGSGRGAFGLWLDSDLYHGRSHHCDTFGNAPL 164          
BLAST of LysM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003437.1 (pep scaffold:Pmarinus_7.0:GL481497:1413:14222:1 gene:ENSPMAG00000003138.1 transcript:ENSPMAT00000003437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 4.365e-16
Identity = 68/255 (26.67%), Postives = 110/255 (43.14%), Query Frame = 2
Query:  857 FIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKXXXXXXXXXXXXSRINDSQMVRSFESSFICKYNHFNNEDL----DISIDNDKSWELVDTSQQSVVADALKEF---EEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGR 1600
            + F +PKDR+++ Y+F               ++   E                  S E  F+    H + E L    D   D+   WE+V T ++++   +L      E E   P L+   S +L+   I      L SN+          T  H   + T+Y+     N  +    + ++  VFGAF+S  +  ++HYYGTGETF++ + P FK + WT ++SFF+ GD+D   IG   G   +W    L + R
Sbjct:   48 YWFAVPKDRVDQLYTFF--------------AQWTPEVCGCGGGAGGGGGGGGDGSGELGFVVLERH-DAEALEAIEDFYSDSSMDWEIV-TLEEALRRQSLHTLTDSEPEPMWPTLNV-ESNLLQHHHIEKYIMKLKSNIFYMRYIFCQATCRHCRQVATLYQPRLLQNQAACSAAEADTQ-VFGAFVSSAIRCNDHYYGTGETFLYTFNPDFKIFRWTGENSFFISGDKDSLVIGGGDGVFGLWLGGDLHHTR 284          
BLAST of LysM domain-containing protein vs. Ensembl Nematostella
Match: EDO46287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQH3])

HSP 1 Score: 110.923 bits (276), Expect = 2.668e-28
Identity = 61/148 (41.22%), Postives = 88/148 (59.46%), Query Frame = 2
Query: 1199 SQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRP--IFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            S+I+ E  I  L   LPS   G    LVY T  HG+SL T+YR M+  + P L++I+D+ + +FG   S  L IS+ +YGTGE+F+F +      K Y+WT +++FFMKG RD  A G+  GH  +W ++   +G S   ET+ N TL
Sbjct:    5 SEIITEKQIKQLNKLLPSRTVGHTWMLVYSTFLHGFSLKTLYRNMECYDSPMLIIIRDDEHQIFGVLSSLPLRISDGFYGTGESFLFKFMEDGTIKDYKWTGENNFFMKGSRDSVAFGSGRGHFGLWLDEDFYHGSSNKCETYGNDTL 152          
BLAST of LysM domain-containing protein vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 138.272 bits (347), Expect = 1.950e-33
Identity = 80/192 (41.67%), Postives = 108/192 (56.25%), Query Frame = 2
Query: 1067 EDLDISIDNDKSWELVDTSQ-QSVVADALK-EFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            ED  I+  N K WE+    +  S    ++K E E E FKP L    S +LE   I  LA +LP    G    L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FFMKGD D  A G  SG   +W +  L +GRS   +TF NP L
Sbjct:  616 EDEPITDLNVKEWEITTKEEVNSKHGPSIKAELEPETFKPNL-TEPSDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYRAMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPML 806          

HSP 2 Score: 52.7582 bits (125), Expect = 1.214e-6
Identity = 44/155 (28.39%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD--------------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  DTL  +A+KF+ T + L   NKL  F   + PGQ L +P  +                     +      +T+  +L      HP   S +      +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP R
Sbjct:  120 EYSVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKATDSDALPRPDAVHPPVFSALRQ----SRVVSSTSEEEEALTEKFLKISCKYITD-GKGAVSGVLLVTPNNIMFDPHR 267          
BLAST of LysM domain-containing protein vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 134.806 bits (338), Expect = 2.595e-32
Identity = 71/161 (44.10%), Postives = 94/161 (58.39%), Query Frame = 2
Query: 1154 EFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E E FKP L    S +LE   I  LA +LP    G    L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FFMKGD D  A G  SG   +W +  L +GRS   +TF NP L
Sbjct:  674 ELEPETFKPNL-TEPSDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYRAMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPML 833          

HSP 2 Score: 52.7582 bits (125), Expect = 1.259e-6
Identity = 44/155 (28.39%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD--------------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  DTL  +A+KF+ T + L   NKL  F   + PGQ L +P  +                     +      +T+  +L      HP   S +      +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP R
Sbjct:  120 EYSVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKATDSDALPRPDAVHPPVFSALR----QSRVVSSTSEEEEALTEKFLKISCKYITD-GKGAVSGVLLVTPNNIMFDPHR 267          
BLAST of LysM domain-containing protein vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 134.42 bits (337), Expect = 2.704e-32
Identity = 71/161 (44.10%), Postives = 94/161 (58.39%), Query Frame = 2
Query: 1154 EFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E E FKP L    S +LE   I  LA +LP    G    L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FFMKGD D  A G  SG   +W +  L +GRS   +TF NP L
Sbjct:  588 ELEPETFKPNL-TEPSDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYRAMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPML 747          

HSP 2 Score: 52.7582 bits (125), Expect = 1.184e-6
Identity = 42/136 (30.88%), Postives = 61/136 (44.85%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKL-KIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  DTL  +A+KF+ T + L   NKL  F   + PGQ    +P+ D                     HP   S +      +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP R
Sbjct:   72 EYSVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGQDSDALPRPDAV-------------------HPPVFSALR----QSRVVSSTSEEEEALTEKFLKISCKYITD-GKGAVSGVLLVTPNNIMFDPHR 181          
BLAST of LysM domain-containing protein vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 132.88 bits (333), Expect = 8.982e-32
Identity = 71/161 (44.10%), Postives = 94/161 (58.39%), Query Frame = 2
Query: 1154 EFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTL 1636
            E E E FKP L    S +LE   I  LA +LP    G    L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FFMKGD D  A G  SG   +W +  L +GRS   +TF NP L
Sbjct:  638 ELEPETFKPNL-TEPSDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYRAMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFGNPML 797          
BLAST of LysM domain-containing protein vs. Ensembl Medaka
Match: oxr1b (oxidation resistance 1 [Source:NCBI gene;Acc:101166078])

HSP 1 Score: 128.642 bits (322), Expect = 2.647e-30
Identity = 68/157 (43.31%), Postives = 92/157 (58.60%), Query Frame = 2
Query: 1154 EFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFN 1624
            E E E FKP L    S +LE   I  LA +LP    G    L + T  HG S+ T+YR M+  + P L++IKD+   VFGA  S+   +S+ +YGTGETF+F + P F+ Y+WT D+ FFMKGD D  A G  SG   +W +  L +GRS   +TF+
Sbjct:  651 ELEPETFKPNL-TEPSDLLEADQIEKLAKNLPPRTIGYPWRLAFGTAKHGMSIKTLYRAMQGQDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFLFTFYPEFEVYKWTGDNMFFMKGDMDSLAFGGGSGEFGLWLDGDLYHGRSHSCKTFH 806          

HSP 2 Score: 52.373 bits (124), Expect = 1.403e-6
Identity = 44/155 (28.39%), Postives = 67/155 (43.23%), Query Frame = 2
Query:  161 EYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVD--------------------GTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPER 565
            EY VE  DTL  +A+KF+ T + L   NKL  F   + PGQ L +P  +                     +      +T+  +L      HP   S +      +R  SS SE ++   ++F+K     I +  K +  G LL+TP  ++FDP R
Sbjct:   97 EYSVESRDTLNSIALKFDTTPNELVQLNKL--FSRAVVPGQVLYVPDPEYVSSVGSSPSLSPISPLSPTSSEADLEKATDSDALPRPDAVHPPVFSALR----QSRVVSSTSEEEEALTEKFLKISCKYITD-GKGAVSGVLLVTPNNIMFDPHR 244          
BLAST of LysM domain-containing protein vs. Planmine SMEST
Match: SMESG000014261.1 (SMESG000014261.1)

HSP 1 Score: 1037.33 bits (2681), Expect = 0.000e+0
Identity = 544/547 (99.45%), Postives = 547/547 (100.00%), Query Frame = 2
Query:  155 MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLSEVIDEQXXXXXXXXXXXXXXCKDHLYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKXXXXXXXXXXXXSRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLSEVIDEQEILNNDNESEELNDCKDHLYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKEIEEQDQFEENESRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVD+SQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATSLPSNLGGSNLSLVYQTGTHGYSLGTIYRKMKATNCP+LLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHW+PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF
Sbjct:    1 MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLSEVIDEQEILNNDNESEELNDCKDHLYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKEIEEQDQFEENESRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVDSSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATSLPSNLGGSNLSLVYQTGTHGYSLGTIYRKMKATNCPTLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWQPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF 547          
BLAST of LysM domain-containing protein vs. Planmine SMEST
Match: SMESG000014261.1 (SMESG000014261.1)

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 513/547 (93.78%), Postives = 516/547 (94.33%), Query Frame = 2
Query:  155 MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLSEVIDEQXXXXXXXXXXXXXXCKDHLYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKXXXXXXXXXXXXSRINDSQMVRSFESSFICKYNHFNNEDLDISIDNDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKMKATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF 1795
            MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLSEVIDEQEILNNDNESEELNDCKDHLYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKEIEEQDQFEENESRINDSQM                               LVD+SQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATSLPSNLGGSNLSLVYQTGTHGYSLGTIYRKMKATNCP+LLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHW+PIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF
Sbjct:    1 MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKVDGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIAEKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINNAEPIFNVGLYICLESVYSLNTFSKLSEVIDEQEILNNDNESEELNDCKDHLYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSFLIISGIGSGFDEKPSSKEIEEQDQFEENESRINDSQM-------------------------------LVDSSQQSVVADALKEFEEEKFKPQLHCGTSQILEESMINDLATSLPSNLGGSNLSLVYQTGTHGYSLGTIYRKMKATNCPTLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWQPIFKKYEWTKDSSFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCNDVDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRF 516          
BLAST of LysM domain-containing protein vs. Planmine SMEST
Match: SMESG000009764.1 (SMESG000009764.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.100e-11
Identity = 37/119 (31.09%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 1199 SQILEESMINDLATXXXXXXXXXXXXXVYQTGTHGYSLGTIYRKM-KATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTA 1552
            S IL    + +L   +P    G+   L+Y T   G+SL T+YR +  +T    +L+++D ++ VFGA  +  + +S  +YG G T +F W P F+K++  +++++ + GD   F IG++
Sbjct:  223 SDILNSEQLKELINHVPKEAFGAKWDLIYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 341          
BLAST of LysM domain-containing protein vs. Planmine SMEST
Match: SMESG000038268.1 (SMESG000038268.1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.284e-11
Identity = 30/92 (32.61%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1280 VYQTGTHGYSLGTIYRKM-KATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTA 1552
            +Y T   G+SL T+YR +  +T    +L+++D ++ VFGA  +  + +S  +YG G T +F W P F+K++  +++++ + GD   F IG++
Sbjct:  395 IYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 486          
BLAST of LysM domain-containing protein vs. Planmine SMEST
Match: SMESG000038268.1 (SMESG000038268.1)

HSP 1 Score: 65.0846 bits (157), Expect = 9.095e-11
Identity = 30/92 (32.61%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1280 VYQTGTHGYSLGTIYRKM-KATNCPSLLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDSSFFMKGDRDCFAIGTA 1552
            +Y T   G+SL T+YR +  +T    +L+++D ++ VFGA  +  + +S  +YG G T +F W P F+K++  +++++ + GD   F IG++
Sbjct:  383 IYATYRDGWSLQTLYRNVFDSTRNACILILRDLNHNVFGAICNTYIRMSRSFYGNGLTVLFRWNPNFEKFKCVQNNNYILFGDPKYFVIGSS 474          
The following BLAST results are available for this feature:
BLAST of LysM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OXR14.479e-3143.71oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
OXR17.112e-3143.71oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
OXR12.924e-2941.30oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
OXR13.388e-2941.30oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
OXR16.059e-2943.71oxidation resistance 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmd-31.279e-2633.84LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-31.279e-2633.84LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-31.279e-2633.84LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-32.798e-2633.84LysM Domain (Peptidoglycan binding) protein [Sour... [more]
lmd-32.940e-2633.84LysM Domain (Peptidoglycan binding) protein [Sour... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtd4.070e-2836.08gene:FBgn0013576 transcript:FBtr0078816[more]
mtd4.070e-2836.08gene:FBgn0013576 transcript:FBtr0273430[more]
mtd4.746e-2836.08gene:FBgn0013576 transcript:FBtr0078814[more]
mtd4.746e-2837.16gene:FBgn0013576 transcript:FBtr0078817[more]
mtd2.307e-2736.08gene:FBgn0013576 transcript:FBtr0078815[more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-15d5.111.836e-3342.70si:ch211-15d5.11 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
oxr1b2.138e-2840.00oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
oxr1b1.521e-2640.25oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
oxr1b2.818e-2541.18oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
LO017815.12.172e-2436.41nuclear receptor coactivator 7-like [Source:NCBI g... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxo102.543e-3239.00F-box protein 10 [Source:Xenbase;Acc:XB-GENE-98764... [more]
tbl23.644e-2642.77transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
tbl24.304e-2642.77transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
tbl24.327e-2642.77transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
tbl24.503e-2642.77transducin (beta)-like 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Oxr14.319e-3143.71oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
Tldc21.680e-2940.88TBC/LysM associated domain containing 2 [Source:MG... [more]
Oxr11.919e-2941.30oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oxr11.919e-2941.30oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
Oxr11.919e-2941.30oxidation resistance 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of LysM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IID2|TLDC2_BOVIN8.358e-2940.88TLD domain-containing protein 2 OS=Bos taurus OX=9... [more]
sp|A2ACG1|TLDC2_MOUSE1.175e-2840.88TLD domain-containing protein 2 OS=Mus musculus OX... [more]
sp|Q8N573|OXR1_HUMAN3.325e-2843.71Oxidation resistance protein 1 OS=Homo sapiens OX=... [more]
sp|Q4KMM3|OXR1_MOUSE3.345e-2843.71Oxidation resistance protein 1 OS=Mus musculus OX=... [more]
sp|A0PJX2|TLDC2_HUMAN3.518e-2840.91TLD domain-containing protein 2 OS=Homo sapiens OX... [more]
back to top
BLAST of LysM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7FS103.378e-5038.13TLD domain-containing protein 2 (Fragment) OS=Clon... [more]
A0A0X3P3L17.175e-5045.09TLD domain-containing protein 2 OS=Schistocephalus... [more]
A0A4S2LGX21.027e-4937.81LysM domain-containing protein OS=Opisthorchis fel... [more]
G7Y8Z81.955e-4938.13LysM domain-containing protein (Fragment) OS=Clono... [more]
A0A3P7LCT03.109e-4843.89TLDc domain-containing protein OS=Dibothriocephalu... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-15d5.114.100e-3552.10oxidation resistance protein 1-like [Source:NCBI g... [more]
si:ch211-15d5.112.688e-3442.55oxidation resistance protein 1-like [Source:NCBI g... [more]
si:ch211-15d5.114.823e-3442.55oxidation resistance protein 1-like [Source:NCBI g... [more]
oxr1b6.346e-3139.25oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
oxr1b6.486e-3139.25oxidation resistance 1 [Source:NCBI gene;Acc:10302... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oxr1b1.594e-3447.13oxidation resistance 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000002915.12.428e-3348.74pep scaffold:Pmarinus_7.0:GL486283:803:7015:1 gene... [more]
ENSPMAT00000008752.13.149e-2939.38pep scaffold:Pmarinus_7.0:GL487419:1521:5503:-1 ge... [more]
ENSPMAT00000003437.14.365e-1626.67pep scaffold:Pmarinus_7.0:GL481497:1413:14222:1 ge... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LysM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO462872.668e-2841.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LysM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oxr1b1.950e-3341.67oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
oxr1b2.595e-3244.10oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
oxr1b2.704e-3244.10oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
oxr1b8.982e-3244.10oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
oxr1b2.647e-3043.31oxidation resistance 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of LysM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014261.10.000e+099.45SMESG000014261.1[more]
SMESG000014261.10.000e+093.78SMESG000014261.1[more]
SMESG000009764.13.100e-1131.09SMESG000009764.1[more]
SMESG000038268.18.284e-1132.61SMESG000038268.1[more]
SMESG000038268.19.095e-1132.61SMESG000038268.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034968 ID=SMED30034968|Name=LysM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2086bp
ATTTAATCAACATTTAGGTAAAACTATATATGTATTTTTATCTACAAATT
TGTCAAATTCAAATTTAAATTTTTTATAAAGCTAATCAAAAATTTTTGGT
ATTAACTTAATTATTTTATCAGTTTTTTAAATTTATGATTATTTCCAAAG
TTCGATGGAAGAATATATCGTAGAAGATGGTGACACTCTTCAAAAAGTTG
CTGTCAAGTTTAATTGTACCGCTAGTAATTTGGCCTCTGAAAATAAATTG
TCTCATTTTCAGTCAATTTTATTTCCAGGACAAAAACTAAAAATACCTAA
AGTTGACGGAACTAATTTAACTGACGCTTCTTCAACGAATCGAATCTCTT
TAAGAGCTTCTCACAAATCTCATCCAGGAACTGCTAGCAGAATATCGGCT
CCAATGCCAACTACTCGTAGTTATAGTTCGGAATCAGAACTGGATGACAT
TGCAGAAAAGCAATTTGTTAAATTTAAAGCCAACAGAATAGTTAATTTGT
CCAAAAATTCTTGTCCCGGTACACTTCTAATCACGCCGAAGTTTTTAGTT
TTTGATCCGGAACGTAAATCGCAGGATTTGGATAAGGATGAAGTAATAAA
CAATGCAGAACCGATTTTCAATGTTGGCTTATATATCTGCTTAGAATCAG
TTTATTCCTTGAACACATTCTCAAAATTATCGGAAGTAATCGATGAGCAG
GAAATACTCAACAATGACAATGAATCAGAGGAATTAAATGATTGTAAAGA
CCACTTGTACTTGATTGTGAAAGCGACGCCATTATCCGATGCATACAATG
GTCCTCCGTTCAACGCTTTGAGAATTTACAGACTTCAACCACCTGGAGCT
AAAATATTTATTTTCGGAATTCCAAAAGACCGAATCGAGGAAGCATATTC
TTTTTTGATTATTTCCGGAATCGGAAGCGGATTTGATGAGAAACCGTCAT
CCAAAGAAATTGAAGAGCAAGATCAATTCGAAGAAAACGAATCAAGAATA
AATGATTCACAAATGGTTAGAAGTTTTGAATCGTCTTTCATTTGCAAATA
TAACCATTTCAACAACGAAGACCTAGATATTTCTATAGATAACGATAAAT
CATGGGAGTTAGTTGATACATCACAGCAAAGTGTTGTTGCAGATGCTTTA
AAAGAATTTGAAGAAGAAAAATTCAAACCTCAATTACATTGCGGCACAAG
TCAAATATTAGAAGAATCTATGATTAATGATTTAGCGACAAGCTTGCCAT
CAAACCTAGGTGGAAGCAATTTATCTTTAGTCTATCAAACTGGTACTCAC
GGGTACAGCTTAGGGACAATCTATCGGAAAATGAAAGCCACGAATTGTCC
TTCATTGCTACTTATAAAAGATAATTCCAATACGGTATTCGGTGCATTTA
TGTCGGATAATCTCCACATCAGTAATCATTATTACGGAACTGGTGAAACT
TTTGTTTTTCATTGGCGACCAATATTTAAAAAATATGAATGGACTAAAGA
TAGCAGTTTTTTTATGAAAGGTGACAGAGATTGTTTTGCAATTGGAACTG
CGAGTGGTCATAGTGCAATTTGGTTCGAGGATACGTTGAAATACGGTAGA
AGTGAACCGACAGAGACATTTAATAATCCTACACTTTGTGGCGATTGCAA
CGATGTTGATCGCACGAATGCAGAAAATACAATCAATCTTTTATCGAACA
ATAAATCCTCTACAGTTTCTAATCACTCCAAAAGTGAAAACTCAACACCC
AAAGGATTTTATTTTGTTATTAATTGTCTGGAAGTTTGGAGGTTCTCGGT
TTAAAGCAACCAATCCAGTTTAAAACTTTCATAATCATTTTTGCACAACT
ATTGATTTTATTTAGAGTTTTGATTTGTACAAGTTTAGAGAGCCATGTAC
AGTCTTGTTGATTATAAAATTTTATATTAGTTATTTTTCCGTCAAGTGAA
AATATGGGTTTTGATGGTTGTGAAGTTATATCAACATTGGATTTATTTTG
AAAATTAGTGTCATTTTTATCATGTTTAAAAATAGTCTAGTGGAAACTTT
TCAATCCGAGCAAATAAATCACTCTATTTAGTAAAA
back to top

protein sequence of SMED30034968-orf-1

>SMED30034968-orf-1 ID=SMED30034968-orf-1|Name=SMED30034968-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=550bp
MEEYIVEDGDTLQKVAVKFNCTASNLASENKLSHFQSILFPGQKLKIPKV
DGTNLTDASSTNRISLRASHKSHPGTASRISAPMPTTRSYSSESELDDIA
EKQFVKFKANRIVNLSKNSCPGTLLITPKFLVFDPERKSQDLDKDEVINN
AEPIFNVGLYICLESVYSLNTFSKLSEVIDEQEILNNDNESEELNDCKDH
LYLIVKATPLSDAYNGPPFNALRIYRLQPPGAKIFIFGIPKDRIEEAYSF
LIISGIGSGFDEKPSSKEIEEQDQFEENESRINDSQMVRSFESSFICKYN
HFNNEDLDISIDNDKSWELVDTSQQSVVADALKEFEEEKFKPQLHCGTSQ
ILEESMINDLATSLPSNLGGSNLSLVYQTGTHGYSLGTIYRKMKATNCPS
LLLIKDNSNTVFGAFMSDNLHISNHYYGTGETFVFHWRPIFKKYEWTKDS
SFFMKGDRDCFAIGTASGHSAIWFEDTLKYGRSEPTETFNNPTLCGDCND
VDRTNAENTINLLSNNKSSTVSNHSKSENSTPKGFYFVINCLEVWRFSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036779LysM_dom_sf
IPR006571TLDc_dom
IPR018392LysM_dom
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005515protein binding
GO:0016491oxidoreductase activity
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005730nucleolus
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0006979response to oxidative stress
GO:0007628adult walking behavior
GO:0043524negative regulation of neuron apoptotic process
GO:0051402neuron apoptotic process
GO:0055114oxidation-reduction process
GO:0071447cellular response to hydroperoxide
GO:1900408negative regulation of cellular response to oxidative stress
GO:1902083negative regulation of peptidyl-cysteine S-nitrosylation
GO:1903204negative regulation of oxidative stress-induced neuron death
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018392LysM domainSMARTSM00257LysM_2coord: 3..48
e-value: 7.2E-7
score: 38.8
IPR018392LysM domainPFAMPF01476LysMcoord: 4..48
e-value: 2.0E-8
score: 34.1
IPR018392LysM domainPROSITEPS51782LYSMcoord: 2..47
score: 12.706
IPR018392LysM domainCDDcd00118LysMcoord: 4..47
e-value: 9.25838E-8
score: 46.3245
IPR006571TLDc domainSMARTSM00584109ultracoord: 349..548
e-value: 2.5E-43
score: 159.9
IPR006571TLDc domainPFAMPF07534TLDcoord: 375..545
e-value: 1.0E-23
score: 84.1
IPR036779LysM domain superfamilyGENE3DG3DSA:3.10.350.10coord: 2..54
e-value: 2.0E-11
score: 45.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 66..89
NoneNo IPR availablePANTHERPTHR23354NUCLEOLAR PROTEIN 7/ESTROGEN RECEPTOR COACTIVATOR-RELATEDcoord: 269..495
coord: 3..139
NoneNo IPR availablePANTHERPTHR23354:SF69OXIDATION RESISTANCE PROTEIN 1coord: 269..495
coord: 3..139
NoneNo IPR availablePROSITEPS51886TLDCcoord: 350..548
score: 27.956
NoneNo IPR availableSUPERFAMILYSSF54106LysM domaincoord: 3..48