Myosin head

NameMyosin head
Smed IDSMED30034967
Length (bp)5512
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Myosin head (SMED30034967) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin head (SMED30034967) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin head (SMED30034967) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin head (SMED30034967) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 7

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034967h1SMcG0009230 dd_Smed_v4_2912_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Myosin head vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 1239.17 bits (3205), Expect = 0.000e+0
Identity = 767/1680 (45.65%), Postives = 1138/1680 (67.74%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL     + D+E + K    K +R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK +KL   ++  +  ++  E    + A+   SL+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL ++   L+Q+LEE A   +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L+IK+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 1238.4 bits (3203), Expect = 0.000e+0
Identity = 767/1680 (45.65%), Postives = 1138/1680 (67.74%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL     + D+E + K    K +R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK +KL   ++  +  ++  E    + A+   SL+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL ++   L+Q+LEE A   +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L+IK+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Human
Match: MYH9 (myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:7579])

HSP 1 Score: 1227.23 bits (3174), Expect = 0.000e+0
Identity = 776/1713 (45.30%), Postives = 1136/1713 (66.32%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LLS   E +K  LLL   + YRFL NG  +I G  +   F ET+EA++IMGI +EEQ  + RVIS V+ +GN+ FK++RN+DQA++PDN+ AQK++HLLG+ VTD T+  L PRIKVGR+ V KAQTKEQA+F++EA++KA YERMF+WLV RIN+ LDK KRQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIEK  G   IL+LLDEEC+FPKATDKSFVEK+++ Q  HPK  K  + +   DF + HYAG+VDY A++WL KNMDPLN+N+  LL +S+  FV  +WKD +  + L   A   ET      +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K++  LVLDQL+CNGVLEGIRICRQG+PNR++FQEF+QRY+IL P ++ +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    R QQ+ A++++QRN  AYLKLRNW WWRLFTKVKPLL V+RQEE +  KEEEL K+ +         TE + +  QL  EK++L  +LQ E     +AE+ R +L+ K +E + +  +LEA+  E++E+   L+ ++ K++Q + +L EQLE EE  RQKLQLEK + E K  +L++E   ++D+  KL K+KK ++DR+ E    L+EEE+K+K L+KLK +HE +IT+LE++L RE   RQ+LE+TRR+LE +  + S+Q+ E  + + +LK +LA  E EL     +++EE   K +  K++R+ E  I +L+EDLE+ERA+R++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+ +L+KT E E K  E++IQE+R+KH+   E+L EQLE+T + K   E +K  LE E  +L+ E +     + + + KRK +E QL EL  +  E ++ + E  +K+ KL   ++     +   ++ +++  +   +L+ + +D +  L +E   KL +   L+ VE+E+ + ++Q +EEE  +  LEK    L  Q+   K K  +    L+  +E+ +KL +++  L+Q+ EE  A  +K+EK+K +LQ EL+D     D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E+ AE+ER       E+ DL  ++DD GK++  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE +K ++++ +++E EL+D++  R+    A++KLE++++DL   +D   K +++ ++QL+K Q+   +  R+L +  A R+E+L Q K+ EKK K+ + E+ +L EEL  +E+ ++ A  ER+E   E  +       A EE++R E R   LEEELEE Q      +D  KK +LQ++   ++L  ER      E  +   E+  K+ + +LQE+E  +  KYK  ++ L+ ++ Q E QL+NET E+    +  R+ +KK+KD+LLQ+D+ R+N E  K+Q DKA+ ++ +LK +L E E+E     A++RKL R+LEDATE+ D +  ++ SLK++     G L F    V  R+ + G   GD + E+
BLAST of Myosin head vs. Ensembl Human
Match: MYH10 (myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:7568])

HSP 1 Score: 1226.08 bits (3171), Expect = 0.000e+0
Identity = 767/1701 (45.09%), Postives = 1140/1701 (67.02%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD       A  + ++S                T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL     + D+E + K    K +R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK +KL   ++  +  ++  E    + A+   SL+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL ++   L+Q+LEE A   +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L+IK+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Human
Match: MYH11 (myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC:7569])

HSP 1 Score: 1220.3 bits (3156), Expect = 0.000e+0
Identity = 762/1680 (45.36%), Postives = 1119/1680 (66.61%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FHIFY +++  K +M++ LLL   + Y FL NG   I    + + F ET+EA+ IMG ++EEQ  I +V+SSV+ +GN+ FK++RN+DQA++PDN+ AQK+ HL+G+ VTD T++ L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+W++TR+N+ LDK  RQG +F+GILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     G+L+LLDEEC+FPKATDKSFVEKL   Q  HPK  K  + +   +FS+ HYAG+VDY A  WL KNMDPLN+NV  LL  S+  FV  +WKD +  V L   A          S+T+KGM RTV QL+KE L KL++ L NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL    + +GFMDGK A   ++ ALE+D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +I+ FQA  RG+LARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +  KE+EL+K  +  +K   E  E ++   QL EEK  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++  +L+ ++ K+ Q++ DL EQLE EE  RQKLQLEK + E K  +L+DE   +DD+ +KL K++K +++R+++    L+EEE+K K L+KLK +HE++I+ELE +L +E  +RQ+LE+ +R+LE +  +  EQ+ +  + + +LK +LA  E EL     +LD+E+  K    K++R+ EG I DL+EDL++ERAAR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T+L+K  + E ++ E+++QE+R+KH    E+L EQLE+  + K   + +K  LEKE  DL+ E R    A+ EV+ K+K LE Q+ EL ++  + ++ + E  +K++KL   VE     ++  E    + A+ + SL  + +D +  L +ET  KL +   LR +EEER ++QDQ DEE   +  LE+H   L  Q+   K K  + +  ++  +E  K+  +EI NLTQQ EE AA  +K+EK+K +LQ EL+D     D+QR    N ++K +K +  L E     +     R+  + + R+KETK + L   +E+  E   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +++E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE R+ + ++  + E EL+D++  RA    AK+KLE +++DL  + D   K +E+ ++QL+K Q+   + QR+L++  A RDE+    K+ EKK K+ + ++ +L E+L  +E+ RK A  E+EE   E  S ++  N  Q+E++R E R   LEEELEE Q       D  +K + Q E   +EL  ER      E  +   E+  K+ +++L E+E  +  K+K+ ++ L+ ++ Q E Q+E E  EK   ++  ++ DKK+K++LLQ+++ RK  E  K Q +K N +V +LK +L E E+E+  + A +RKL R+L++ATES + +  ++ +LKS+
BLAST of Myosin head vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 1092.41 bits (2824), Expect = 0.000e+0
Identity = 703/1685 (41.72%), Postives = 1080/1685 (64.09%), Query Frame = 1
            I F   G+ +GANIE YLLEK+RV+RQA +ERSFHIFYQ+L    ++ K+  LL  +  YRFL N   ++  +D+VQ F+ TI +++IMG  D+E   I RV+S+V+L+GN+EF Q++ SDQA L D+ V QK+ HLLGL V ++ KAFL+PRIKVGRE V+KAQ +EQAEF+VEAI+KA YER+FKWLVTRIN++LD+  RQG +FIGILDIAGFEIF++NSFEQ+CINYTNEKLQQLFN+TMF+LEQEEY++EGI W++IDFGLDLQPTIDLIEK MG+L+LLDEEC FPKA DKSFVEKL KT  KHPK    + RS   F+V HYAGRVDY A++WL KNMDPLNENVV L+Q S  PFV  IWKDAE F  + A    ET FG R+RKGM RTVSQLHKE L KL++ L NT+PHFVRCIIPNHEK+  KI S LVL+QL+CNGVLEGIRICRQG+PNR+ FQEF+ RY+IL P  + + F+DGK +  +++ AL++D NLY+IGQSK+FF+ GV+A LEE+RDL++++LI+ FQA  RGFL+R+    R QQ +AIRIIQRN +AYLKLRNW WWRLFTKVKPLL VTR ++ +  K++EL+   + L K   +F E +K L+Q+  E+  +  +LQQE  N  + +D R +L  + +E + ++ ++  + SE++++  K  +++ K  + V DL EQLE EEQ RQKL L+K +++Q+   L++   E+ D   KL+K+K+ +++++      L + E++ K   K K R E  + ELE  L+RE   + +LE+ +R+L  EL+++ + L EK   +++L  +L   + EL    T+ DEE     ++ KQ+RD +  I +LRED+ETER AR++AE  +R+   ++E +K ++ D    +    + + +++EE+   ++  E      E KI+E + K + + E+L +Q+E+  K++   E  +NQ ++E  D++ E    Q +R ++DKKRK  E  L+E+     E+D+ K+   +QLE+    ++ L  + E+      +++     A  QIQ L  +       + +ET  K+      R +E+E+  + D+ +E E  R  LEK            + KA E   + QQ +E+ KK  R++ +L +QLEES    E++ +SKKK+Q ELED+S   ++ R+   +++++ KK E+ + E   E+ A+Q+    R+ + ++ RD+ET+++ LL +++ M+E   E +R + +L +EL D    +DD GKN+  LE+ K  LE E+ ++++ ME+LE+    L + +D RL +E+ N  +K+   R +  K+   EE R+ ++K+ +DLE EL+++K  ++   + ++K+E ++ +L  +L++  + KE+Y +QLKK Q    E Q + +E    ++++   +++ ++K++A + E  +L E    +E L +       E     +        + EE++R E +   LEEELEE Q+      D ++K  +QLE   ++L  ER      E +K + E++ +D + ++ ELE     + + Q++ L+ +V   E QL  E  EK   +R  R+ +K++ D   Q ++ ++  E  K  L+K+N +   L+ +L E EDE +  +   R + R+ +D  ++ + L  ++ +L+ 
BLAST of Myosin head vs. Ensembl Celegans
Match: nmy-2 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5EBY3])

HSP 1 Score: 959.518 bits (2479), Expect = 0.000e+0
Identity = 650/1713 (37.95%), Postives = 1025/1713 (59.84%), Query Frame = 1
            + F   G  +GANIE YLLEK+RV++QA  ERSFHIFYQLL   +K + ++ LL   +S Y+F+ NG + ++G+D+     ET+ A+ IMG+ DEE   I RV+S+VML GN+EF  +++N+DQA L +++VAQKIA LLG+ VT++ +AFLKP+IKV R+ V +AQ+ +Q  FSV AI+KA YER+F+WLV R+N++LD+ ++Q  +FIGILDIAGFEIFE NSFEQLCINYTNEKLQQLFN+TMFV EQ+EY  EG+ W+++DFGL+LQPTIDLI+K MGI+S LD+ C FP+  D+SFV++L  T  +HPK    E RS  DF+V HYAGRVDY +E W  KNMDPLNENV+ +L+ S    +  +WKD  +  +LSA  + +    FGSR  +KGM RTVSQL+KE L +L+S LNNTNPHFVRCIIPNHEK+   + + LVLDQL+CNGVLEGIRICRQG+P R+ FQEF+QRY+ +L P     GFMDGK A  +++  LEVD NL++IGQSKIFF++GV+A  EE RD ++S+LI  FQA  RG+L R+    R +Q  AI+I+QRN +A+++LR W WWRL TKVKPLL VT ++E++A +E+ELK   + L ++    ++ K+ +E++ EE++ L   L  E     +  +ER +++ +  E + ++ E+  +   +++K  K + +  KL + V  L E LE EE++RQKL LEKNS+E +  +L+ +  E++D  +KL K+KK +++R  +  + L +E +++KQL K K R E  + E+ D+L +E   R + E  RR  E +L+E  E  +EK    ++L  +L   E+EL ++  + DEEL A+  + +++R+    + D  E+   E+AAR +AEK +RD AEE+E+ K EL ++   +  H +   KR+EE   L+K  E   K+ E  ++E++ ++  K E+L E +++  ++K++ + +K+  E +  +   E  N  +AR+E +KKRK  E  L+E  ++  E      + + K++K+   +E  Q A   D   N+N         L  +N  L   LS+ TEA                     ++E+ R R  L    + LE  + A   +A +D+  L  Q++I K++                 NRE+    ++ +E   + E            K E++KKK   E ED         +     +RK +K +  L E        QQ R+   +  RD ETK + L  ++ + ++   ++E+ K  L  E+ +L+  +DDAGKN+  LE+ K +L+ E+   +  + +LE+        + R++V +  +++ F+R+L  +E++ ++ +K +  K ++L  EL+ ++  R +    K+K+E ++ +L  + + + +  ED  RQL+K Q    + Q D+ E  A  ++ L   +D EK+ +A ++EI +LT ++      ++ A AER+E I E  SL  A++ + EE++R E +  +LE++L+E  +A     +  +K   QLE   ++L  ER      E  K   E+  +D + QLQ+ E     + +TQ++  + +V+  E QL  E  +K +  R  R+ + KM ++   L+E ++  E  +  +D+ N ++ +L+++L + E E   L    +   R  E+ T+  + L   +  LK R  T
BLAST of Myosin head vs. Ensembl Celegans
Match: myo-5 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q21000])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 568/1755 (32.36%), Postives = 940/1755 (53.56%), Query Frame = 1
            I F   G  AGA+IE YLLEK+RVI+QA  ERS+HIFYQ+ S   K   +   L   +  Y F+     +I G+D+ +    T EA  IM  T  E+  +F + + +M MG ++FKQ    +QA L +    +    L  ++      A LKPR+KVG E V+K Q  +Q  ++V A++KA++ RMF WL+ R N+TLD        FIG+LDIAGFEIF++NSFEQL IN+ NEKLQQ FNH MFVLEQEEY++EGI WE+IDFGLDLQ  I+LIEK +GI+S+LDEEC  PKA+D +   KL      KHP        KG+ ++    ++ HYAG V Y  + WLEKN DPLN+  V +L+  K N   +  +W D   +  V  +A   ++     + +     TVS +++ESL KL+ +L+ T+PHF+RCIIPN  K+   I++ LVL+QL CNGVLEGIRICR+G+PNR+ F +FKQRY +L      +   D K A E++  AL  D +L    ++ G +K+FFKAGV+A LEE RD  +  ++ KFQ   R +LA+   + ++ Q   + ++QRN  A+  LR+W W++LF +VKPL+  +++ E     E++ K L +   +   +  + +    +L+ EK  L  +L+QE+ +  + E+   KL  +  + +  +A +  +  +++EK + L + + K++Q+   L + +   E T +K + EK + + +   LQDE     E+  KL+K  K ++ V+ +L E +     EE K   L+K K + E+ + ELED L RE   RQD E+ RR++E ELK   E + E N    + +Q +   + EL  +Q++L++E    A + +Q+++    IQ+L E+L+ ER +R +AEK + +   E+E L   L + G  ++  +E  +KRE E+  LR+  E    N E+ +  LRKKH     +L +QL+   K +   E  KN  ++E ++L     VE +  QN     ++  K LE QL ++   T+++D    EQ   I +LT       +  + + N N    RQ++  + +    NR          +LK  L  ET  +  + + +   + E    ++  +EE+  +  +++      +++Q ++ K     V  +E L   +E  +KL  ++  + +QLE +   I  +EK+K++L  +LEDA    D   S   + ++K K  +  L+E  ++  A+    E   ++ R   T+  +L  ++E+  E+   ++R+   L +EL D++    + GK++  L++ + +LE E +ELQ  +++ E           R  +E++ I++  ++ L +KE+ FE  RK   +  + +++ L+ +   RA +   K+KLE +V +L   LD + K   D  + +KK Q    E Q             RD   +  +R ++L Q K+          ++A + E   QSE+ R+ A   +AE +++++E   + SL+ A       +++ E   Q L+ E+EE  +    +D+  KK  +       EL +E+E    +   K   E  +KD Q +L E E    K  K QL+ L  R+++ E +LE E     +  ++ R  D+K ++L  Q+DE +K++E M + ++K  +++   K ++ + E   +   A  R+L   +EDA E  D  EN +Q L+ +  +  G   F  R +   ++ TG
BLAST of Myosin head vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 558/1713 (32.57%), Postives = 921/1713 (53.77%), Query Frame = 1
            I F K G  A  +IE YLLEK+RVIRQA  ER +HIFYQ+ S       K  LL   +  Y F+      I GID+V+ F  T EA  I+  +  E++  +R++S+ M MGNM+FKQ    +QA       A+K +++ G+   +  KA  KPR+KVG E VSK Q  EQ  ++V A++K +Y R+F WLV + N TLD+       FIG+LDIAGFEIF+ NSFEQL IN+ NEKLQQ FNH MFVLEQEEY +EGI W +IDFGLDLQ  I+LIEK +GI+S+LDEEC  PKATD +   KL+     KH     PK  KG+ +    F++ HYAG V Y    WLEKN DPLN+ VV  +++S     +  IW+D        +           + + G   TVS L++ESL  L+++LN T+PHF+RCIIPN +K+   I++ LVL+QL CNGVLEGIRICR+G+PNR L  +F QRY IL  +       D K  AE +++ L  D +L    ++IG +K+FFKAGV+A LE+ RD ++++++  FQ+  R  L  K+ + R++Q   + I+QRN  ++  LR W W++L+ KVKP+L   ++ E +    +++K L D L K      E ++   +L EEK  L   L+  K    DAE+   KL  + K++   ++EL  + ++++++ + ++  + K++ EV  L +Q++  E + +K + EK S + +   LQDE  + D+ ++KL K+KK  ++   + M  L  EE K    +K+K + E  + +LED L RE  AR DL++ +R++E ELK   E + E      DL+  L   E+EL  + ++L++E    + + +Q++D +  I +L E+LE ER +R +A++ K D   E+E L  +L + G  +   +E  +KRE E+  LR+  E  N N E+++  LRKKHT    +L +QL++ NK K   E  K Q  ++  DL+ +     + ++  +K  K  E QL EL ++  E  +  ++                 QLE    ++N+LT +  Q   Q++    T ++ AR+ Q++  + ++       + EA+   ++    +             E +N ++     Q+ +      + KA  + E L + DE+     R+   I  L + L+ + +    +EK+K +L  +L+DA    D +R+  + +  ++K K  +  ++E  K+   +    +   +D R+  T + +     E++ E    + R+  +L +E+ DL+    + G+++  +++   +LE E +ELQ  +++ E           R  VE++ I++  ++ + +KE+ FE  RK   +  + ++  L+ +   +A +   K+KLE ++ +L   LD   KA  D  + LK++Q    E Q  ++E      +   Q  + EK+     +E  +L      +E+ RK A  E  +A  +     A  +     +++ E   Q +  +L+E  N +   ++  KK          EL  E+E    V+  +   E+ LK+ Q +L E E    K  K  ++ L+ RV + E++L+ E       ++   + D+++++L  Q+DE +KN E +++ +DK  +++   K ++ E E+  N NL+  K +LT  LEDA E  D  EN +  ++S+
BLAST of Myosin head vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 653.284 bits (1684), Expect = 0.000e+0
Identity = 558/1713 (32.57%), Postives = 921/1713 (53.77%), Query Frame = 1
            I F K G  A  +IE YLLEK+RVIRQA  ER +HIFYQ+ S       K  LL   +  Y F+      I GID+V+ F  T EA  I+  +  E++  +R++S+ M MGNM+FKQ    +QA       A+K +++ G+   +  KA  KPR+KVG E VSK Q  EQ  ++V A++K +Y R+F WLV + N TLD+       FIG+LDIAGFEIF+ NSFEQL IN+ NEKLQQ FNH MFVLEQEEY +EGI W +IDFGLDLQ  I+LIEK +GI+S+LDEEC  PKATD +   KL+     KH     PK  KG+ +    F++ HYAG V Y    WLEKN DPLN+ VV  +++S     +  IW+D        +           + + G   TVS L++ESL  L+++LN T+PHF+RCIIPN +K+   I++ LVL+QL CNGVLEGIRICR+G+PNR L  +F QRY IL  +       D K  AE +++ L  D +L    ++IG +K+FFKAGV+A LE+ RD ++++++  FQ+  R  L  K+ + R++Q   + I+QRN  ++  LR W W++L+ KVKP+L   ++ E +    +++K L D L K      E ++   +L EEK  L   L+  K    DAE+   KL  + K++   ++EL  + ++++++ + ++  + K++ EV  L +Q++  E + +K + EK S + +   LQDE  + D+ ++KL K+KK  ++   + M  L  EE K    +K+K + E  + +LED L RE  AR DL++ +R++E ELK   E + E      DL+  L   E+EL  + ++L++E    + + +Q++D +  I +L E+LE ER +R +A++ K D   E+E L  +L + G  +   +E  +KRE E+  LR+  E  N N E+++  LRKKHT    +L +QL++ NK K   E  K Q  ++  DL+ +     + ++  +K  K  E QL EL ++  E  +  ++                 QLE    ++N+LT +  Q   Q++    T ++ AR+ Q++  + ++       + EA+   ++    +             E +N ++     Q+ +      + KA  + E L + DE+     R+   I  L + L+ + +    +EK+K +L  +L+DA    D +R+  + +  ++K K  +  ++E  K+   +    +   +D R+  T + +     E++ E    + R+  +L +E+ DL+    + G+++  +++   +LE E +ELQ  +++ E           R  VE++ I++  ++ + +KE+ FE  RK   +  + ++  L+ +   +A +   K+KLE ++ +L   LD   KA  D  + LK++Q    E Q  ++E      +   Q  + EK+     +E  +L      +E+ RK A  E  +A  +     A  +     +++ E   Q +  +L+E  N +   ++  KK          EL  E+E    V+  +   E+ LK+ Q +L E E    K  K  ++ L+ RV + E++L+ E       ++   + D+++++L  Q+DE +KN E +++ +DK  +++   K ++ E E+  N NL+  K +LT  LEDA E  D  EN +  ++S+
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0306576)

HSP 1 Score: 1260.36 bits (3260), Expect = 0.000e+0
Identity = 785/1689 (46.48%), Postives = 1143/1689 (67.67%), Query Frame = 1
            I F   GF +GANIETYLLEK+R IRQA +ER+FHIFYQLL+  + E +   +L ++  Y FL NG+  + G+D+   F  T++++ IMG+T E+   IFR++S+V+L G+M+F+Q+RN+DQATLPDN+VAQKIAHLLGL VTDMT+AFL PRIKVGR+ V+KAQTKEQ EF+VEAI+KA YERMFKWLV RINR+LD+ KRQG +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W++IDFGLDLQPTIDLI+K  GI++LLDEEC+FPKATDK+FV+KL+     HPK  K +FR   DF++ HYAGRVDY A KWL KNMDPLNEN+V LLQ S  PFV +IWKDAE  V ++  A  +TQFG+RTRKGM RTVS L+KE L KL+  L NTNP+FVRCIIPNHEKR  KI++ LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY++L P  + +GFMDGK A E+++ ALE+D NLY++GQSKIFF+AGV+A LEE+RD +IS LI+ FQA+ RGFLAR+N Q R+QQ+NAIRIIQRN  AYLKLRNW WWRL+TKVKPLL VT+QEE +  KE+ELK++ + L+       E ++  +Q   EK  L+ +LQ E     +AE+ R +L  + +E ++++ ELE +  E++E++  L  ++ KL+  + DL EQLE EE  RQKLQLEK  L+ K  + +++ A  DD+  KL+K+KK +++R  +   TL+EEE+K K L+KLK +HE  I+ELE++L ++   RQ+ +R++R++E E+ +  EQL E+   +D+++ +LA  E EL +   ++DEE   KA   K  R+ E  + +++EDLE E+AAR +AEK++RD +EE+EALK+EL D+  T+    E   KRE+E+  L+K+ E E  N E  + ++R KH+ +   + +QLE   K K   E +K  LE E  DL+ E R+  ++R E D++RK  E Q+ EL  +  E ++ + E  EK  KL    E    Q++  E   + A +   +++ +  + +  L +ET  KL + + LR +E E+  +Q+Q +E++  +   E+    +  QMQ  K KA ED++L ++ +E  K+LN++I  L +Q++E  A  ++++KSKKK+Q+ELEDA+   ++QR++ L  ++K K    N ++++ E+ A+     Q R+  +++ R+KETK++ +  ++++  ++  ++E ++  L  EL DL+  Q  A KN+  LE+ K  LE+++ EL+   E+LE++       K RL+V +  +++ F+R+L+ KE+  EE R+ ++K+ +DLE ELD+++  R +   +K+KLE +++++   ++M  K KED L+  KK Q+   +  RD +E  A ++EL    K+ E+K KA + E+ +LTE+L  SE+ R+ A  ER+E   E    IA N NK     +E++R E R   LEEELEE Q+      D  +K  LQ+E   +EL NE+      E  +   E+  K+ + +L E+E     K K  ++ L+ ++   E QLENE  E+    + NRK DKK+K+L + +++ R++ +  K Q+DK N ++  LK  L E E+E    K  KRK  R+ ED  ES++ +  +I SLK+  RR   +G
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302572)

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 785/1689 (46.48%), Postives = 1143/1689 (67.67%), Query Frame = 1
            I F   GF +GANIETYLLEK+R IRQA +ER+FHIFYQLL+  + E +   +L ++  Y FL NG+  + G+D+   F  T++++ IMG+T E+   IFR++S+V+L G+M+F+Q+RN+DQATLPDN+VAQKIAHLLGL VTDMT+AFL PRIKVGR+ V+KAQTKEQ EF+VEAI+KA YERMFKWLV RINR+LD+ KRQG +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W++IDFGLDLQPTIDLI+K  GI++LLDEEC+FPKATDK+FV+KL+     HPK  K +FR   DF++ HYAGRVDY A KWL KNMDPLNEN+V LLQ S  PFV +IWKDAE  V ++  A  +TQFG+RTRKGM RTVS L+KE L KL+  L NTNP+FVRCIIPNHEKR  KI++ LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY++L P  + +GFMDGK A E+++ ALE+D NLY++GQSKIFF+AGV+A LEE+RD +IS LI+ FQA+ RGFLAR+N Q R+QQ+NAIRIIQRN  AYLKLRNW WWRL+TKVKPLL VT+QEE +  KE+ELK++ + L+       E ++  +Q   EK  L+ +LQ E     +AE+ R +L  + +E ++++ ELE +  E++E++  L  ++ KL+  + DL EQLE EE  RQKLQLEK  L+ K  + +++ A  DD+  KL+K+KK +++R  +   TL+EEE+K K L+KLK +HE  I+ELE++L ++   RQ+ +R++R++E E+ +  EQL E+   +D+++ +LA  E EL +   ++DEE   KA   K  R+ E  + +++EDLE E+AAR +AEK++RD +EE+EALK+EL D+  T+    E   KRE+E+  L+K+ E E  N E  + ++R KH+ +   + +QLE   K K   E +K  LE E  DL+ E R+  ++R E D++RK  E Q+ EL  +  E ++ + E  EK  KL    E    Q++  E   + A +   +++ +  + +  L +ET  KL + + LR +E E+  +Q+Q +E++  +   E+    +  QMQ  K KA ED++L ++ +E  K+LN++I  L +Q++E  A  ++++KSKKK+Q+ELEDA+   ++QR++ L  ++K K    N ++++ E+ A+     Q R+  +++ R+KETK++ +  ++++  ++  ++E ++  L  EL DL+  Q  A KN+  LE+ K  LE+++ EL+   E+LE++       K RL+V +  +++ F+R+L+ KE+  EE R+ ++K+ +DLE ELD+++  R +   +K+KLE +++++   ++M  K KED L+  KK Q+   +  RD +E  A ++EL    K+ E+K KA + E+ +LTE+L  SE+ R+ A  ER+E   E    IA N NK     +E++R E R   LEEELEE Q+      D  +K  LQ+E   +EL NE+      E  +   E+  K+ + +L E+E     K K  ++ L+ ++   E QLENE  E+    + NRK DKK+K+L + +++ R++ +  K Q+DK N ++  LK  L E E+E    K  KRK  R+ ED  ES++ +  +I SLK+  RR   +G
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302574)

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 785/1689 (46.48%), Postives = 1143/1689 (67.67%), Query Frame = 1
            I F   GF +GANIETYLLEK+R IRQA +ER+FHIFYQLL+  + E +   +L ++  Y FL NG+  + G+D+   F  T++++ IMG+T E+   IFR++S+V+L G+M+F+Q+RN+DQATLPDN+VAQKIAHLLGL VTDMT+AFL PRIKVGR+ V+KAQTKEQ EF+VEAI+KA YERMFKWLV RINR+LD+ KRQG +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W++IDFGLDLQPTIDLI+K  GI++LLDEEC+FPKATDK+FV+KL+     HPK  K +FR   DF++ HYAGRVDY A KWL KNMDPLNEN+V LLQ S  PFV +IWKDAE  V ++  A  +TQFG+RTRKGM RTVS L+KE L KL+  L NTNP+FVRCIIPNHEKR  KI++ LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY++L P  + +GFMDGK A E+++ ALE+D NLY++GQSKIFF+AGV+A LEE+RD +IS LI+ FQA+ RGFLAR+N Q R+QQ+NAIRIIQRN  AYLKLRNW WWRL+TKVKPLL VT+QEE +  KE+ELK++ + L+       E ++  +Q   EK  L+ +LQ E     +AE+ R +L  + +E ++++ ELE +  E++E++  L  ++ KL+  + DL EQLE EE  RQKLQLEK  L+ K  + +++ A  DD+  KL+K+KK +++R  +   TL+EEE+K K L+KLK +HE  I+ELE++L ++   RQ+ +R++R++E E+ +  EQL E+   +D+++ +LA  E EL +   ++DEE   KA   K  R+ E  + +++EDLE E+AAR +AEK++RD +EE+EALK+EL D+  T+    E   KRE+E+  L+K+ E E  N E  + ++R KH+ +   + +QLE   K K   E +K  LE E  DL+ E R+  ++R E D++RK  E Q+ EL  +  E ++ + E  EK  KL    E    Q++  E   + A +   +++ +  + +  L +ET  KL + + LR +E E+  +Q+Q +E++  +   E+    +  QMQ  K KA ED++L ++ +E  K+LN++I  L +Q++E  A  ++++KSKKK+Q+ELEDA+   ++QR++ L  ++K K    N ++++ E+ A+     Q R+  +++ R+KETK++ +  ++++  ++  ++E ++  L  EL DL+  Q  A KN+  LE+ K  LE+++ EL+   E+LE++       K RL+V +  +++ F+R+L+ KE+  EE R+ ++K+ +DLE ELD+++  R +   +K+KLE +++++   ++M  K KED L+  KK Q+   +  RD +E  A ++EL    K+ E+K KA + E+ +LTE+L  SE+ R+ A  ER+E   E    IA N NK     +E++R E R   LEEELEE Q+      D  +K  LQ+E   +EL NE+      E  +   E+  K+ + +L E+E     K K  ++ L+ ++   E QLENE  E+    + NRK DKK+K+L + +++ R++ +  K Q+DK N ++  LK  L E E+E    K  KRK  R+ ED  ES++ +  +I SLK+  RR   +G
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0100466)

HSP 1 Score: 1259.97 bits (3259), Expect = 0.000e+0
Identity = 785/1689 (46.48%), Postives = 1143/1689 (67.67%), Query Frame = 1
            I F   GF +GANIETYLLEK+R IRQA +ER+FHIFYQLL+  + E +   +L ++  Y FL NG+  + G+D+   F  T++++ IMG+T E+   IFR++S+V+L G+M+F+Q+RN+DQATLPDN+VAQKIAHLLGL VTDMT+AFL PRIKVGR+ V+KAQTKEQ EF+VEAI+KA YERMFKWLV RINR+LD+ KRQG +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W++IDFGLDLQPTIDLI+K  GI++LLDEEC+FPKATDK+FV+KL+     HPK  K +FR   DF++ HYAGRVDY A KWL KNMDPLNEN+V LLQ S  PFV +IWKDAE  V ++  A  +TQFG+RTRKGM RTVS L+KE L KL+  L NTNP+FVRCIIPNHEKR  KI++ LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY++L P  + +GFMDGK A E+++ ALE+D NLY++GQSKIFF+AGV+A LEE+RD +IS LI+ FQA+ RGFLAR+N Q R+QQ+NAIRIIQRN  AYLKLRNW WWRL+TKVKPLL VT+QEE +  KE+ELK++ + L+       E ++  +Q   EK  L+ +LQ E     +AE+ R +L  + +E ++++ ELE +  E++E++  L  ++ KL+  + DL EQLE EE  RQKLQLEK  L+ K  + +++ A  DD+  KL+K+KK +++R  +   TL+EEE+K K L+KLK +HE  I+ELE++L ++   RQ+ +R++R++E E+ +  EQL E+   +D+++ +LA  E EL +   ++DEE   KA   K  R+ E  + +++EDLE E+AAR +AEK++RD +EE+EALK+EL D+  T+    E   KRE+E+  L+K+ E E  N E  + ++R KH+ +   + +QLE   K K   E +K  LE E  DL+ E R+  ++R E D++RK  E Q+ EL  +  E ++ + E  EK  KL    E    Q++  E   + A +   +++ +  + +  L +ET  KL + + LR +E E+  +Q+Q +E++  +   E+    +  QMQ  K KA ED++L ++ +E  K+LN++I  L +Q++E  A  ++++KSKKK+Q+ELEDA+   ++QR++ L  ++K K    N ++++ E+ A+     Q R+  +++ R+KETK++ +  ++++  ++  ++E ++  L  EL DL+  Q  A KN+  LE+ K  LE+++ EL+   E+LE++       K RL+V +  +++ F+R+L+ KE+  EE R+ ++K+ +DLE ELD+++  R +   +K+KLE +++++   ++M  K KED L+  KK Q+   +  RD +E  A ++EL    K+ E+K KA + E+ +LTE+L  SE+ R+ A  ER+E   E    IA N NK     +E++R E R   LEEELEE Q+      D  +K  LQ+E   +EL NE+      E  +   E+  K+ + +L E+E     K K  ++ L+ ++   E QLENE  E+    + NRK DKK+K+L + +++ R++ +  K Q+DK N ++  LK  L E E+E    K  KRK  R+ ED  ES++ +  +I SLK+  RR   +G
BLAST of Myosin head vs. Ensembl Fly
Match: zip (gene:FBgn0265434 transcript:FBtr0302573)

HSP 1 Score: 1259.59 bits (3258), Expect = 0.000e+0
Identity = 785/1689 (46.48%), Postives = 1143/1689 (67.67%), Query Frame = 1
            I F   GF +GANIETYLLEK+R IRQA +ER+FHIFYQLL+  + E +   +L ++  Y FL NG+  + G+D+   F  T++++ IMG+T E+   IFR++S+V+L G+M+F+Q+RN+DQATLPDN+VAQKIAHLLGL VTDMT+AFL PRIKVGR+ V+KAQTKEQ EF+VEAI+KA YERMFKWLV RINR+LD+ KRQG +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W++IDFGLDLQPTIDLI+K  GI++LLDEEC+FPKATDK+FV+KL+     HPK  K +FR   DF++ HYAGRVDY A KWL KNMDPLNEN+V LLQ S  PFV +IWKDAE  V ++  A  +TQFG+RTRKGM RTVS L+KE L KL+  L NTNP+FVRCIIPNHEKR  KI++ LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY++L P  + +GFMDGK A E+++ ALE+D NLY++GQSKIFF+AGV+A LEE+RD +IS LI+ FQA+ RGFLAR+N Q R+QQ+NAIRIIQRN  AYLKLRNW WWRL+TKVKPLL VT+QEE +  KE+ELK++ + L+       E ++  +Q   EK  L+ +LQ E     +AE+ R +L  + +E ++++ ELE +  E++E++  L  ++ KL+  + DL EQLE EE  RQKLQLEK  L+ K  + +++ A  DD+  KL+K+KK +++R  +   TL+EEE+K K L+KLK +HE  I+ELE++L ++   RQ+ +R++R++E E+ +  EQL E+   +D+++ +LA  E EL +   ++DEE   KA   K  R+ E  + +++EDLE E+AAR +AEK++RD +EE+EALK+EL D+  T+    E   KRE+E+  L+K+ E E  N E  + ++R KH+ +   + +QLE   K K   E +K  LE E  DL+ E R+  ++R E D++RK  E Q+ EL  +  E ++ + E  EK  KL    E    Q++  E   + A +   +++ +  + +  L +ET  KL + + LR +E E+  +Q+Q +E++  +   E+    +  QMQ  K KA ED++L ++ +E  K+LN++I  L +Q++E  A  ++++KSKKK+Q+ELEDA+   ++QR++ L  ++K K    N ++++ E+ A+     Q R+  +++ R+KETK++ +  ++++  ++  ++E ++  L  EL DL+  Q  A KN+  LE+ K  LE+++ EL+   E+LE++       K RL+V +  +++ F+R+L+ KE+  EE R+ ++K+ +DLE ELD+++  R +   +K+KLE +++++   ++M  K KED L+  KK Q+   +  RD +E  A ++EL    K+ E+K KA + E+ +LTE+L  SE+ R+ A  ER+E   E    IA N NK     +E++R E R   LEEELEE Q+      D  +K  LQ+E   +EL NE+      E  +   E+  K+ + +L E+E     K K  ++ L+ ++   E QLENE  E+    + NRK DKK+K+L + +++ R++ +  K Q+DK N ++  LK  L E E+E    K  KRK  R+ ED  ES++ +  +I SLK+  RR   +G
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh11a (myosin, heavy chain 11a, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-050531-1])

HSP 1 Score: 1226.85 bits (3173), Expect = 0.000e+0
Identity = 758/1680 (45.12%), Postives = 1135/1680 (67.56%), Query Frame = 1
            I F   GF  GANIETYLLEK+R IRQA  ER+FHIFY +++ TK +++  LLL   + YRFL  G   I G  + + ++ET+EA++IMG + EE+  + +V+S+V+ +GN+EFK++RN +QAT+PDN+ AQK+ HL G+ VTD T+A L PRIKVGRE V KAQTKEQA+F++EA++KAMYER+F+W++ R+N+ LDK KRQG +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEKL  T   H K  K  + +   +FSV+HYAGRVDY A  WL KNMDPLN+NV  LL  S+ PFVQ +WKDA+  V L   A          S+T+KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL    + +GFMDGK A   ++  L++D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQ+ +RGFLARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +++KEEEL+K  +  +K   E  +      QL +E+ +L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++ + L+ ++ K+ +++ DL E LE EE  RQKLQLEK + + K  +L+D+   +DD+ +KL K++K +++R+ +  + L+EEE+K+K L+KLK +HE++I+ELE +L +E   RQ+L++ +R+LE E  +  EQ+ +  + + DLK +LA  E EL     +L++E   K    K++R+ EG I DL+EDLE+ERAAR++AEK KRD  EE+EALKSEL DT  T+    E   KRE+E+TLL++  E E++  E+++QE+R+KHT   E+L EQLE++ + K+  E +K  LEKE ++L VE R+    + +V+ K+K LE QL +L +R  ++++ K E  ++++K+T  +E     ++  E  N + ++ + SL  + +D +  L++ET  KL++   LR +E++R  +Q+Q DEE   +  +E+H   L  Q+  FK K  E +  ++  +E  K+L R++     Q EE AA  +K+EK+K +LQ ELED     D+QR    N ++K KK +  L E     +     R+  + + R+KETK + L   +E+ +E   E ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++ ++K+ ++LE EL+D++  R ++  +K+KLE +++DL  +++ + K +++ ++QL+K Q+   + QR+L +  A R+E+L   K+ E+K K  + E+ +L E+L  +E+ +K   AER+E   E  S  +  +   +E++R E + Q LEEELEE Q      +D  +K + Q++   +EL  ER      E  +   E+  K+ + +LQE+E  +  K+K+ +S L+ +V Q E QLE E+ +K   ++  R+ DKK+K+++ Q+++ RK  E  K+Q DKA  +V +LK +L E E+E+  + A +RKL R+L++ATE+ D +  ++ SLKS+
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1216.45 bits (3146), Expect = 0.000e+0
Identity = 752/1680 (44.76%), Postives = 1131/1680 (67.32%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FH+FYQLL+   E +++ LLL   + YRFL NG   I G  +   F ET+EA+ IM    EE   + +V+S+V+  GN+ FK++RN+DQA++P+N+ AQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FV+KL++ Q  H K  K  + +   DF + HYAGRVDY A++WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   A   ET FG+  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K+E  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQ+  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWRLFTKVKPLL VTRQEE +  K+EEL K+ +   K   E  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L  K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  +++++   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L K+K + E ++ +LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL  +  + DEE+  K    KQLR+ +  + +L+EDLE+E+AAR++AEK+KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  + E +N ES+IQE+R++H T  E++ EQLE+  + K   E +K  LE +  +L+ E ++ Q A+ E + KRK LE QL E+  R  E +K K E  ++ +K+   ++  +  ++  E    +  + + SL+ + +D +  L +ET  KL + + +R +EEE+ N+ +Q +EEE +R  LEK    L+ Q+   K K  +D   L+  +E+ +KL +++   +Q+LEE A   +K+EK+K +LQ EL+D     D QR    N ++K KK +  L E     A   + R+  + + R+K+TK + +   +++  E   E ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F R+L  +++  EE ++ ++K+ +++E EL+D++  RA    AK+KLE++++D+  +++   KA+++ ++QL+K Q+   + QR+L+E    RDE+  Q K+ EKK K+ + EI +L E+L  SE+ R+ A  ER+E   E  +  +      +E++R E R   LEEELEE Q+     +D  +K ++Q++T  +EL  ER      E  +   E+  KD +++LQELE ++  K+K  ++ L+ ++ Q E QLE E  E+   +++ R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1216.45 bits (3146), Expect = 0.000e+0
Identity = 752/1680 (44.76%), Postives = 1131/1680 (67.32%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FH+FYQLL+   E +++ LLL   + YRFL NG   I G  +   F ET+EA+ IM    EE   + +V+S+V+  GN+ FK++RN+DQA++P+N+ AQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FV+KL++ Q  H K  K  + +   DF + HYAGRVDY A++WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   A   ET FG+  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K+E  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQ+  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWRLFTKVKPLL VTRQEE +  K+EEL K+ +   K   E  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L  K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  +++++   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L K+K + E ++ +LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL  +  + DEE+  K    KQLR+ +  + +L+EDLE+E+AAR++AEK+KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  + E +N ES+IQE+R++H T  E++ EQLE+  + K   E +K  LE +  +L+ E ++ Q A+ E + KRK LE QL E+  R  E +K K E  ++ +K+   ++  +  ++  E    +  + + SL+ + +D +  L +ET  KL + + +R +EEE+ N+ +Q +EEE +R  LEK    L+ Q+   K K  +D   L+  +E+ +KL +++   +Q+LEE A   +K+EK+K +LQ EL+D     D QR    N ++K KK +  L E     A   + R+  + + R+K+TK + +   +++  E   E ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F R+L  +++  EE ++ ++K+ +++E EL+D++  RA    AK+KLE++++D+  +++   KA+++ ++QL+K Q+   + QR+L+E    RDE+  Q K+ EKK K+ + EI +L E+L  SE+ R+ A  ER+E   E  +  +      +E++R E R   LEEELEE Q+     +D  +K ++Q++T  +EL  ER      E  +   E+  KD +++LQELE ++  K+K  ++ L+ ++ Q E QLE E  E+   +++ R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 1216.45 bits (3146), Expect = 0.000e+0
Identity = 752/1680 (44.76%), Postives = 1131/1680 (67.32%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FH+FYQLL+   E +++ LLL   + YRFL NG   I G  +   F ET+EA+ IM    EE   + +V+S+V+  GN+ FK++RN+DQA++P+N+ AQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FV+KL++ Q  H K  K  + +   DF + HYAGRVDY A++WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   A   ET FG+  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K+E  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQ+  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWRLFTKVKPLL VTRQEE +  K+EEL K+ +   K   E  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L  K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  +++++   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L K+K + E ++ +LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL  +  + DEE+  K    KQLR+ +  + +L+EDLE+E+AAR++AEK+KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  + E +N ES+IQE+R++H T  E++ EQLE+  + K   E +K  LE +  +L+ E ++ Q A+ E + KRK LE QL E+  R  E +K K E  ++ +K+   ++  +  ++  E    +  + + SL+ + +D +  L +ET  KL + + +R +EEE+ N+ +Q +EEE +R  LEK    L+ Q+   K K  +D   L+  +E+ +KL +++   +Q+LEE A   +K+EK+K +LQ EL+D     D QR    N ++K KK +  L E     A   + R+  + + R+K+TK + +   +++  E   E ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F R+L  +++  EE ++ ++K+ +++E EL+D++  RA    AK+KLE++++D+  +++   KA+++ ++QL+K Q+   + QR+L+E    RDE+  Q K+ EKK K+ + EI +L E+L  SE+ R+ A  ER+E   E  +  +      +E++R E R   LEEELEE Q+     +D  +K ++Q++T  +EL  ER      E  +   E+  KD +++LQELE ++  K+K  ++ L+ ++ Q E QLE E  E+   +++ R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Zebrafish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 1212.21 bits (3135), Expect = 0.000e+0
Identity = 765/1709 (44.76%), Postives = 1156/1709 (67.64%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FHIFY LL+   + +++ L L + + YRFL NG  +I G  + + F ETI+A +IMGI ++EQ  + +V+S+V+ +GNM FK++RNSDQA++PD++ AQK++HLLG+ VTD T+A L PRIKVGR+ V KAQT+EQAEF+VEA++KA YER+F+WLV RIN+ LDK KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIEK     GIL+LLDEEC+FPKATDKSFVEK+++    +PK  K +  + + DF + HYAG+VDY A +WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   A   E+  G+ +TRKGM RTV QL+KE L+ L++ L NTNP+FVRCIIPNHEK+  K+   LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RD++I+ +II FQA+ RG++AR+    R QQ+ A+R+IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +  KEEEL K+ +  ++   +  E++   +QL  EK+ L  +LQ E    Q+AE+ R +L+ +++E + ++ ELE++  E++E++++ + ++ K++Q + DL +QL+ EE  RQKLQLEK +++ K  +++++   I+D+ +KL K+KK +++R++E    L+EEE+K+K L KLKT+HET+IT+LED+L +E   RQ+LE+ RR+LE +  E  +Q+ E  + + +L+ +LA  E EL     +++EE   K    K +R+ E  I +L+EDLE E+AAR++AEK +RD  EE+EALK+EL DT  ++    E   KRE E+T L+KT E E +  E  + E+R+KH    E+L EQLE++ + K + + +K  LE E N+L +E ++   ++ + + +RK  E QL EL  +  E+++ K E L+K++K+ A +E     +  +E+ + +AA+   +++ + +D +A L +ET  KL +   LR +E+E+ N+++  +EEE ++  +EK     + Q+   K K  ++++ L+  ++  KKL RE+ ++ QQLEE  A+ +K++K+K +LQ EL+D        R      +RK KK +  L E         + R+  + + R+KETK + L  ++E M +   E+ER    L  E+ DL  ++DDAGK++  LER K  +E +++E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE RK ++K+ +++E+EL+D++  RA   + ++KLEL++ +L  ++D+  KA+++ L+QLKK Q+   E+ R+ +++   RDE L Q K+ E+K K+ + EI +L E+L  +++ ++    ER+E   E  S  A N+ + +ER+R E R   LEEELEE   +    +D  KK SLQ E    EL  ER     +EG ++  ++  KD + +LQELE  +  KYK+ ++ L+T++ Q E QL++E  E+ Q ++  R+ +KK+K++LLQ+++ R+N +  K + +KAN ++ ++K +L E E+E     A+ RKL R+LEDATES   +  ++ +LK+  RR    G       NVR  + +TG  + D
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1216.45 bits (3146), Expect = 0.000e+0
Identity = 753/1680 (44.82%), Postives = 1120/1680 (66.67%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LLS   E +K+ LLL   + YRFL NG  +I G  +   F ET+EA+KIMG T+EEQ  + RV+SSV+ +GN+ FK++RN+DQA++PDN+ AQK+ HL+G+ V D T+  L PRIKVGR+ V KAQTKEQA+F++EA++KA YERMF+WLV R+N+ LDK KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIEK  G   IL+LLDEEC+FPKATDKSFVEK+++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +W+D +  V L   +  A+       +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K+++ LVLDQL+CNGVLEGIRICRQG+PNR++FQEF+QRY+IL P ++ +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RDL+I+ +II FQA+ RG+LARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKV+           +  KE EL+K+ ++   +  + +E + +   L++EK++L  +LQ E     +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ D+ K++  + +L EQLE EE  RQKLQLEK ++E K  +L+++   ++D+ SKL K+KK  ++R+ E    L+EEE+K+K L+KLK +HET+I++LE++L RE   RQ+LE+TRR+LE +  +  +Q+ E  + + +LK +LA  E EL     +++EE   K I  K++R+ E  I +L+EDLETERAAR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T L+KT E E +  E +IQE+R+KH+   E+L EQLE+T + K   E +K  LE E N+L+ E +     + + + KRK +E QL EL  +  E D+ + E  EK N+L   ++     +   +  + +  +   +L+ + +D +  L +ET  KL     L+ +E+E+  + +Q +EEE  +  L K    L++QM   K K  E+   L+  +E+ KKL +++ ++ Q+ EE AA  +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+  E  AE+ER    L  E+ DL  ++DD GK++  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  E+ +K ++++ K++E EL+D++  R+    A++KLE++++DL  ++D   K +E+ ++QL+K Q+   + QR+L +  A RD++L Q K+ EKK K+ + E+  + EEL  +E+ ++ A  ER+E   E  +       A EE++R E+R   LEEELEE Q      +D  KK +LQ++   ++L  ER      E  +   ++  K+ + +LQELE  +  K+K  ++ L+ ++ Q E QL+ ET E+   S+  R+ +KK+KD+++Q+D+ R+N E  K+Q +K N ++ +LK ++ E E+E     A +RKL R+LEDATE+ + +  ++ +LKS+
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1208.74 bits (3126), Expect = 0.000e+0
Identity = 753/1680 (44.82%), Postives = 1120/1680 (66.67%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LLS   E +K+ LLL   + YRFL NG  +I G  +   F ET+EA+KIMG T+EEQ  + RV+SSV+ +GN+ FK++RN+DQA++PDN+ AQK+ HL+G+ V D T+  L PRIKVGR+ V KAQTKEQA+F++EA++KA YERMF+WLV R+N+ LDK KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIEK     GIL+LLDEEC+FPKATDKSFVEK+++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +W+D +  V L   +  A+       +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K+++ LVLDQL+CNGVLEGIRICRQG+PNR++FQEF+QRY+IL P ++ +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RDL+I+ +II FQA+ RG+LARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKV+           +  KE EL+K+ ++   +  + +E + +   L++EK++L  +LQ E     +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ D+ K++  + +L EQLE EE  RQKLQLEK ++E K  +L+++   ++D+ SKL K+KK  ++R+ E    L+EEE+K+K L+KLK +HET+I++LE++L RE   RQ+LE+TRR+LE +  +  +Q+ E  + + +LK +LA  E EL     +++EE   K I  K++R+ E  I +L+EDLETERAAR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T L+KT E E +  E +IQE+R+KH+   E+L EQLE+T + K   E +K  LE E N+L+ E +     + + + KRK +E QL EL  +  E D+ + E  EK N+L   ++     +   +  + +  +   +L+ + +D +  L +ET  KL     L+ +E+E+  + +Q +EEE  +  L K    L++Q+   K K  E+   L+  +E+ KKL +++ ++ Q+ EE AA  +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+  E  AE+ER    L  E+ DL  ++DD GK++  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  E+ +K ++++ K++E EL+D++  R+    A++KLE++++DL  ++D   K +E+ ++QL+K Q+   + QR+L +  A RD++L Q K+ EKK K+ + E+  + EEL  +E+ ++ A  ER+E   E      ANN    E++R E+R   LEEELEE Q      +D  KK +LQ++   ++L  ER      E  +   ++  K+ + +LQELE  +  K+K  ++ L+ ++ Q E QL+ ET E+   S+  R+ +KK+KD+++Q+D+ R+N E  K+Q +K N ++ +LK ++ E E+E     A +RKL R+LEDATE+ + +  ++ +LKS+
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH9 (myosin, heavy chain 9, non-muscle [Source:NCBI gene;Acc:100487997])

HSP 1 Score: 1205.66 bits (3118), Expect = 0.000e+0
Identity = 753/1693 (44.48%), Postives = 1117/1693 (65.98%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LLS   E +K+ LLL   + YRFL NG  +I G  +   F ET+EA+KIMG T+EEQ  + RV+SSV+ +GN+ FK++RN+DQA++PDN+ AQK+ HL+G+ V D T+  L PRIKVGR+ V KAQTKEQA+F++EA++KA YERMF+WLV R+N+ LDK KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIEK  G   IL+LLDEEC+FPKATDKSFVEK+++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +W+D     TL A                   A+       +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K+++ LVLDQL+CNGVLEGIRICRQG+PNR++FQEF+QRY+IL P ++ +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RDL+I+ +II FQA+ RG+LARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKV+           +  KE EL+K+ ++   +  + +E + +   L++EK++L  +LQ E     +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ D+ K++  + +L EQLE EE  RQKLQLEK ++E K  +L+++   ++D+ SKL K+KK  ++R+ E    L+EEE+K+K L+KLK +HET+I++LE++L RE   RQ+LE+TRR+LE +  +  +Q+ E  + + +LK +LA  E EL     +++EE   K I  K++R+ E  I +L+EDLETERAAR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T L+KT E E +  E +IQE+R+KH+   E+L EQLE+T + K   E +K  LE E N+L+ E +     + + + KRK +E QL EL  +  E D+ + E  EK N+L   ++     +   +  + +  +   +L+ + +D +  L +ET  KL     L+ +E+E+  + +Q +EEE  +  L K    L++QM   K K  E+   L+  +E+ KKL +++ ++ Q+ EE AA  +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+  E  AE+ER    L  E+ DL  ++DD GK++  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  E+ +K ++++ K++E EL+D++  R+    A++KLE++++DL  ++D   K +E+ ++QL+K Q+   + QR+L +  A RD++L Q K+ EKK K+ + E+  + EEL  +E+ ++ A  ER+E   E  +       A EE++R E+R   LEEELEE Q      +D  KK +LQ++   ++L  ER      E  +   ++  K+ + +LQELE  +  K+K  ++ L+ ++ Q E QL+ ET E+   S+  R+ +KK+KD+++Q+D+ R+N E  K+Q +K N ++ +LK ++ E E+E     A +RKL R+LEDATE+ + +  ++ +LK
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 744/1680 (44.29%), Postives = 1107/1680 (65.89%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FHIFY L+   K   +  LLL     Y FL  G   +   D+   F ET+EA++IMG +++EQ  + RV+SSV+ +GN+ FK++RN+DQA++PD++ AQK+ HL G+ VTD  +  L PRIKVGR+ V KAQTKEQA+F++EA++KA YER+F W++ R+N+ LDK KRQG +F+GILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEK+++ Q  H K  K  + +    F++ HYAG+VDY A  WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   A          S+T+KGM RTV QL+KE L KL++ L NT+P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL    + +GFMDGK +   ++ ALE+D NLY+IGQSK+FF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE + +K+EEL+++N+   KT  E  E +    QL EEK  L  +LQ E   + +AE+ R +L  K +E + ++ E+E +  E++++  +L+ ++ K  Q++ DL EQLE EE  RQKLQLEK + E K  +L+D+   +DD  +KL K+KK +++R+ +    L+EEE+K K L+KLK +HE++I+ELE +L +E   RQ+LE+ +R+LE E  + +EQ+ +  + + +LK +LA  E EL     +L++E   K    K++R+ E  I DL+EDLE+E++AR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T+L++  E E ++ ES++QE+R+KHT   E+L EQLE+  + ++  E SK  LEK+ ++L++E R+   A+ +V+ K+K LE QL EL ++  + ++ + E  EK +++   +E   + +   E  + + ++ +  L  + +D +  L +ET  KL +   LR VE+ER ++Q+Q DEE   +  LE+H   L  Q+   K K  E +  ++  +E  KKL R+I   TQQ EE A+  +K+EK+K +LQ EL+D     D+QR    N ++K KK +  L E     +     R+  + + R+KETK + L   +++  +   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L+ +++  EE R+ ++K+  + E EL+D++  R     AK+KLE++++DL  ++D   +A+++ ++QL+K Q    + QRDL E    R+E+    ++ EKK K+ + E+ +L E+L  +E+ RK A  E+EE   E     +  +  Q+E++R E R   LEEELEE Q       D  +K   Q E   +EL  ER      E  +   E+  K+ + +LQE+E  +  K+K+ ++ L+ +++Q E Q+E E+  +   +   R+ +KK+K+ LLQ+++ RK  E  K+Q +K N +  +LK +L E E+E+  + A++RKL R+L++A ES + L  ++ SLKS+
BLAST of Myosin head vs. Ensembl Xenopus
Match: MYH11 (myosin heavy chain 11 [Source:NCBI gene;Acc:100490639])

HSP 1 Score: 1201.42 bits (3107), Expect = 0.000e+0
Identity = 746/1679 (44.43%), Postives = 1108/1679 (65.99%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FHIFY L+      K  LLL     Y FL  G   +   D+   F ET+EA++IMG +++EQ  + RV+SSV+ +GN+ FK++RN+DQA++PD++ AQK+ HL G+ VTD  +  L PRIKVGR+ V KAQTKEQA+F++EA++KA YER+F W++ R+N+ LDK KRQG +F+GILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEK+++ Q  H K  K  + +    F++ HYAG+VDY A  WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   A          S+T+KGM RTV QL+KE L KL++ L NT+P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL    + +GFMDGK +   ++ ALE+D NLY+IGQSK+FF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE + +K+EEL+++N+   KT  E  E +    QL EEK  L  +LQ E   + +AE+ R +L  K +E + ++ E+E +  E++++  +L+ ++ K  Q++ DL EQLE EE  RQKLQLEK + E K  +L+D+   +DD  +KL K+KK +++R+ +    L+EEE+K K L+KLK +HE++I+ELE +L +E   RQ+LE+ +R+LE E  + +EQ+ +  + + +LK +LA  E EL     +L++E   K    K++R+ E  I DL+EDLE+E++AR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T+L++  E E ++ ES++QE+R+KHT   E+L EQLE+  + ++  E SK  LEK+ ++L++E R+   A+ +V+ K+K LE QL EL ++  + ++ + E  EK +++   +E   + +   E  + + ++ +  L  + +D +  L +ET  KL +   LR VE+ER ++Q+Q DEE   +  LE+H   L  Q+   K K  E +  ++  +E  KKL R+I   TQQ EE A+  +K+EK+K +LQ EL+D     D+QR    N ++K KK +  L E     +     R+  + + R+KETK + L   +++  +   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L+ +++  EE R+ ++K+  + E EL+D++  R     AK+KLE++++DL  ++D   +A+++ ++QL+K Q    + QRDL E    R+E+    ++ EKK K+ + E+ +L E+L  +E+ RK A  E+EE   E     +A+   Q+E++R E R   LEEELEE Q       D  +K   Q E   +EL  ER      E  +   E+  K+ + +LQE+E  +  K+K+ ++ L+ +++Q E Q+E E+ +K    +  R+ +KK+K+ LLQ+++ RK  E  K+Q +K N +  +LK +L E E+E+  + A++RKL R+L++A ES + L  ++ SLKS+
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 764/1680 (45.48%), Postives = 1135/1680 (67.56%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +L   E EL     + D+E + K    K  R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK NKL   ++  +  ++  E    + A+    L+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL +++  L+Q+LEE     +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L++K+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 1233.39 bits (3190), Expect = 0.000e+0
Identity = 764/1680 (45.48%), Postives = 1135/1680 (67.56%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +L   E EL     + D+E + K    K  R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK NKL   ++  +  ++  E    + A+    L+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL +++  L+Q+LEE     +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L++K+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh9 (myosin, heavy polypeptide 9, non-muscle [Source:MGI Symbol;Acc:MGI:107717])

HSP 1 Score: 1231.08 bits (3184), Expect = 0.000e+0
Identity = 769/1713 (44.89%), Postives = 1135/1713 (66.26%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LLS   E +K  LLL   + YRFL NG  +I G  +   F ET+EA++IMGI ++EQ  + RVIS V+ +GN+ FK++RN+DQA++PDN+ AQK++HLLG+ VTD T+  L PRIKVGR+ V KAQTKEQA+F++EA++KA YERMF+WLV RIN+ LDK KRQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIEK  G   IL+LLDEEC+FPKATDKSFVEK+++ Q  HPK  K  + +   DF + HYAG+VDY A++WL KNMDPLN+N+  LL +S+  FV  +WKD +  + L   A   ET      +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K++  LVLDQL+CNGVLEGIRICRQG+PNR++FQEF+QRY+IL P ++ +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    R QQ+ A++++QRN  AYL+LRNW WWRLFTKVKPLL+  R E+ +  KE EL K+ +         TE + +  QL  EK++L  +LQ E     +AE+ R +L+ K +E + +  +LEA+  E++E+   L+ ++ K++Q + +L EQLE EE  RQKLQLEK + E K  +L+++   ++D+  KL K+KK ++DR+ E    L EEE+K+K L+KLK +HE +IT+LE++L RE   RQ+LE+TRR+LE +  + S+Q+ E  + + +LK +LA  E EL     +++EE   K +  K++R+ E  I +L+EDLE+ERA+R++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+++L+KT E E K  E++IQE+R+KH+   E+L +QLE+T + K   E +K  LE E  +L+ E +     + + + KRK +E QL EL  +  E ++ + E  +K+ KL   ++     +   ++ +++  +   +L+ + +D +  L +E   KL +   L+ +E+E+ + ++Q +EEE  +  LEK    L  Q+   K K  +    L+  +E  ++L +++  L+Q+LEE  A  +K+EK+K +LQ EL+D     D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E+ AE+ER       E+ DL  ++DD GK++  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE +K ++++ +++E EL+D++  R+    A++KLE++++DL   +D   K +E+ ++QL+K Q+   +  R+L +  A R+E+L Q K+ EKK K+ + E+ +L EEL  +E+ ++ A  ER+E   E  +       A EE++R E R   LEEELEE Q      +D  KK +LQ++   ++L  ER      E  +   E+  K+ + +LQE+E  +  KYK  ++ L+ ++ Q E QL+NET E+   S+  R+ +KK+KD+LLQ+++ R+N E  K+Q DKA+ ++ +LK +L E E+E     A++RKL R+LEDATE+ D +  ++ SLK++     G L F    V  R+ + G  TGD + E+
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh10 (myosin, heavy polypeptide 10, non-muscle [Source:MGI Symbol;Acc:MGI:1930780])

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 764/1701 (44.91%), Postives = 1137/1701 (66.84%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD       A  + ++S                T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +L   E EL     + D+E + K    K  R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK NKL   ++  +  ++  E    + A+    L+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL +++  L+Q+LEE     +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L++K+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Mouse
Match: Myh11 (myosin, heavy polypeptide 11, smooth muscle [Source:MGI Symbol;Acc:MGI:102643])

HSP 1 Score: 1211.05 bits (3132), Expect = 0.000e+0
Identity = 767/1680 (45.65%), Postives = 1121/1680 (66.73%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FHIFY LL+  K +MK+ LLL   + Y FL NG   I    + + F ET+EA+ IMG  +EEQ  I +V+SSV+ +GN+ FK++RN+DQA++PDN+ AQK+ HL+G+ VTD T+A L PRIKVGR+ V KAQTKEQA+F++EA++KA YER+F+W+++R+N+ LDK  RQG +F+GILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     G+L+LLDEEC+FPKATDKSFVEKL   Q  HPK  K  + +   +FS+ HYAG+VDY A  WL KNMDPLN+NV  LL  S+  FV  +WKD +  V L   A          S+T+KGM RTV QL+KE L KL++ L NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL    + +GFMDGK A   ++ ALE+D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +I+ FQA  RG+LARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +  KEEE++K+ +  +K   E  E ++   QL EEK  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++  +L+ ++ K+ Q++ DL EQLE EE  RQKLQLEK + E K  +L+D+   +DD+ SKL K++K +++R+++    L+EEE+K K L+KLK++HE++I+ELE +L +E  +RQ+LE+ +R+LE +  +  EQ+ +  + + +LK +LA  E EL     +LDEE+  K    K++R+ EG I DL+EDL++ERAAR++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+T+L+K  + E ++ E+++QE+R+KHT   E+L EQLE+  + K   + SK  LEKE  DL+ E R    A+ EV+ K+K LE QL +L ++  + ++ + E  +K++KL   VE     ++  E    + A+ + SL  + +D +  L +ET  KL +   LR +E+ER ++QDQ DEE   +  LE+H   L  Q+   K K  + +  ++  +E  K+L +E+  L+QQ EE AA  +K+EK+K +LQ EL+D     D+QR    N ++K KK +  L E     +     R+  + + R+KETK + L   +E+  E   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +++E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE R+ + ++  + E EL+D++  RA    AK+KLE +++DL  + D   K +E+ ++QL+K Q+   + QR+L +  A RDE+    K+ EKK K+ + ++ +L E+L  +E+ RK A  E+EE   E  S ++  N  Q+E++R E R   LEEELEE Q       D  +K +LQ E   +EL  ER      E  +   E+  K+ +++LQE+E  +  K K+ ++ L+ ++ Q E Q+E E  EK   ++  ++ DKK+K++LLQ+++ RK  E  K Q +K N +V +LK +L E E+E+  + A +RKL R+L++ATES + +  ++ +LKS+
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|Q99323|MYSN_DROME (Myosin heavy chain, non-muscle OS=Drosophila melanogaster OX=7227 GN=zip PE=1 SV=2)

HSP 1 Score: 1257.66 bits (3253), Expect = 0.000e+0
Identity = 785/1689 (46.48%), Postives = 1142/1689 (67.61%), Query Frame = 1
            I F   GF +GANIETYLLEK+R IRQA +ER+FHIFYQLL+  + E +   +L ++  Y FL NG+  + G+D+   F  T++++ IMG+T E+   IFR++S+V+L G+M+F+Q+RN+DQATLPDN+VAQKIAHLLGL VTDMT+AFL PRIKVGR+ V+KAQTKEQ EF+VEAI+KA YERMFKWLV RINR+LD+ KRQG +FIGILD+AGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W++IDFGLDLQPTIDLI+K  GI++LLDEEC+FPKATDK+FV+KL+     HPK  K +FR   DF++ HYAGRVDY A KWL KNMDPLNEN+V LLQ S  PFV +IWKDAE  V ++  A  +TQFG+RTRKGM RTVS L+KE L KL+  L NTNP+FVRCIIPNHEKR  KI++ LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY++L P  + +GFMDGK A E+++ ALE+D NLY++GQSKIFF+AGV+A LEE+RD +IS LI+ FQA+ RGFLAR+N Q R+QQ+NAIRIIQRN  AYLKLRNW WWRL+TKVKPLL VT+QEE +  KE+ELK++ + L+       E ++  +Q   EK  L+ +LQ E     +AE+ R +L  + +E ++++ ELE +  E++E++  L  ++ KL+  + DL EQLE EE  RQKLQLEK  L+ K  + +++ A  DD+  KL+K+KK +++R  +   TL+EEE+K K L+KLK +HE  ITELE++L ++   RQ+ +R++R++E E+ +  EQL E+   +D+++ +LA  E EL +   ++DEE   KA   K  R+ E  + +++EDLE E+AAR +AEK++RD +EE+EALK+EL D+  T+    E   KRE+E+  L+K+ E E  N E  + ++R KH+ +   + +QLE   K K   E +K  LE E  DL+ E R+  ++R E D++RK  E Q+ EL  +  E ++ + E  EK  KL    E    Q++  E   + A +   +++ +  + +  L +ET  KL + + LR +E E+  +Q+Q +E++  +   E+    +  QMQ  K KA ED++L ++ +E  K+LN++I  L +Q++E  A  ++++KSKKK+Q+ELEDA+   ++QR++ L  ++K K    N ++++ E+ A+     Q R+  +++ R+KETK++ +  ++++  ++  ++E ++  L  EL DL+  Q  A KN+  LE+ K  LE+++ EL+   E+LE++       K RL+V +  +++ F+R+L+ KE+  EE R+ ++K+ +DLE ELD+++  R +   +K+KLE +++++   ++M  K KED L+  KK Q+   +  RD +E  A ++EL    K+ + K KA + E+ +LTE+L  SE+ R+ A  ER+E   E    IA N NK     +E++R E R   LEEELEE Q+      D  +K  LQ+E   +EL NE+      E  +   E+  K+ + +L E+E     K K  ++ L+ ++   E QLENE  E+    + NRK DKK+K+L + +++ R++ +  K Q+DK N ++  LK  L E E+E    K  KRK  R+ ED  ES++ +  +I SLK+  RR   +G
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|P35580|MYH10_HUMAN (Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3)

HSP 1 Score: 1239.17 bits (3205), Expect = 0.000e+0
Identity = 767/1680 (45.65%), Postives = 1138/1680 (67.74%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +LA  E EL     + D+E + K    K +R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK +KL   ++  +  ++  E    + A+   SL+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL ++   L+Q+LEE A   +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L+IK+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|Q9JLT0|MYH10_RAT (Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 PE=1 SV=1)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 763/1680 (45.42%), Postives = 1134/1680 (67.50%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQGT+FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM R V QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++   ++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +L   E EL     + D+E + K    K  R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK NKL   ++  +  ++  E    + A+    L+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL +++  L+Q+LEE     +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L++K+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|Q61879|MYH10_MOUSE (Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 SV=2)

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 764/1680 (45.48%), Postives = 1135/1680 (67.56%), Query Frame = 1
            I F   G+  GANIETYLLEK+R +RQA +ER+FHIFYQLLS   E +K+ LLL   + YRFL NG   I G  +   F ET+EA+ IMG + EE   + +V+SSV+  GN+ FK++RN+DQA++P+N+VAQK+ HLLG+ V + T+A L PRIKVGR+ V KAQTKEQA+F+VEA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FPKATDK+FVEKL++ Q  H K  K  + +   DF + HYAG+VDY A++WL KNMDPLN+NV  LL +S+  FV  +WKD +  V L   T   ET FGS  +T+KGM RTV QL+KESL KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NLY+IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWR+FTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  + DL EQL+ EE  RQKLQLEK + E K  ++++E   ++D+ SK +K+KK ++DR+ E  + L+EEE+K K L+K++ + E +I++LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  + +D+LK +L   E EL     + D+E + K    K  R+ +  I +L+ED E+E+A+R++AEK KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E KN E++IQ++R++H T  E+L EQLE+  + K   E +K  LE +  +L+ E +  Q  + E + KRK L+ Q+ EL  +  E D+ + E  EK NKL   ++  +  ++  E    + A+    L+ + +D +  L +ET  KL + + +R +EEE+ ++Q+Q +EEE  R  LEK    L++Q+   K K  +D   ++  +E  KKL +++  L+Q+LEE     +K+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E   E ERQ   L  ++ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++L++K+ ++LE EL+D++  RA    +K+K+E++++DL  +++   KA+++ ++QL+K Q+   + QR+L+E  A RDE+  Q K+ EKK K+ + EI +L EEL  SE+ R+ A  ER+E   E  +  +  +   +E++R E R   LEEELEE Q+     +D  +K +LQ++T  +EL  ER      +  +   E+  K+ + +LQELE  +  K+K  +S L+ ++ Q E QLE E  E+   ++L R+ +KK+K++ +Q+++ R++ +  K Q++KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. UniProt/SwissProt
Match: sp|Q8VDD5|MYH9_MOUSE (Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=4)

HSP 1 Score: 1231.08 bits (3184), Expect = 0.000e+0
Identity = 769/1713 (44.89%), Postives = 1135/1713 (66.26%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LLS   E +K  LLL   + YRFL NG  +I G  +   F ET+EA++IMGI ++EQ  + RVIS V+ +GN+ FK++RN+DQA++PDN+ AQK++HLLG+ VTD T+  L PRIKVGR+ V KAQTKEQA+F++EA++KA YERMF+WLV RIN+ LDK KRQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIEK  G   IL+LLDEEC+FPKATDKSFVEK+++ Q  HPK  K  + +   DF + HYAG+VDY A++WL KNMDPLN+N+  LL +S+  FV  +WKD +  + L   A   ET      +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K++  LVLDQL+CNGVLEGIRICRQG+PNR++FQEF+QRY+IL P ++ +GFMDGK A   ++ ALE+D NLY+IGQSK+FF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    R QQ+ A++++QRN  AYL+LRNW WWRLFTKVKPLL+  R E+ +  KE EL K+ +         TE + +  QL  EK++L  +LQ E     +AE+ R +L+ K +E + +  +LEA+  E++E+   L+ ++ K++Q + +L EQLE EE  RQKLQLEK + E K  +L+++   ++D+  KL K+KK ++DR+ E    L EEE+K+K L+KLK +HE +IT+LE++L RE   RQ+LE+TRR+LE +  + S+Q+ E  + + +LK +LA  E EL     +++EE   K +  K++R+ E  I +L+EDLE+ERA+R++AEK KRD  EE+EALK+EL DT  ++    E   KRE+E+++L+KT E E K  E++IQE+R+KH+   E+L +QLE+T + K   E +K  LE E  +L+ E +     + + + KRK +E QL EL  +  E ++ + E  +K+ KL   ++     +   ++ +++  +   +L+ + +D +  L +E   KL +   L+ +E+E+ + ++Q +EEE  +  LEK    L  Q+   K K  +    L+  +E  ++L +++  L+Q+LEE  A  +K+EK+K +LQ EL+D     D QR    N ++K KK +  L E     A   + R+  + + R+KETK + L   +E+  E+ AE+ER       E+ DL  ++DD GK++  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE +K ++++ +++E EL+D++  R+    A++KLE++++DL   +D   K +E+ ++QL+K Q+   +  R+L +  A R+E+L Q K+ EKK K+ + E+ +L EEL  +E+ ++ A  ER+E   E  +       A EE++R E R   LEEELEE Q      +D  KK +LQ++   ++L  ER      E  +   E+  K+ + +LQE+E  +  KYK  ++ L+ ++ Q E QL+NET E+   S+  R+ +KK+KD+LLQ+++ R+N E  K+Q DKA+ ++ +LK +L E E+E     A++RKL R+LEDATE+ D +  ++ SLK++     G L F    V  R+ + G  TGD + E+
BLAST of Myosin head vs. TrEMBL
Match: A0A068Y5H6 (Myosin heavy chain non muscle OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000479300 PE=3 SV=1)

HSP 1 Score: 1436.78 bits (3718), Expect = 0.000e+0
Identity = 865/1728 (50.06%), Postives = 1208/1728 (69.91%), Query Frame = 1
            I F   GF AGANIETYLLEKARVIRQASEER+FHIFYQL+++ S ++K  LLL + S + +L +G   + G+DE QAF +T EA+ +MGIT+E+Q+ IF+++S+V+ +GN+EFKQ+RN+DQATLP+ +VA+K+AHLLG+ + ++TKAFLKP++K+GRETVSKAQTKEQ EF+VEAISKA+YER+F+WLVTRIN++LD+ KRQG +FIGILDIAGFEIF+VNSFEQLCINYTNEKLQQLFNHTMFVLEQEEY +EGI W++IDFGLDLQPTIDLIEK +GIL+LLDEECFFPKATDKSFVEKL K QE + KL K EFRS  DF V HYAGRVDY A +WL KNMDPLN+NVV LLQ SN P VQ++WKDAE  V++SATA  ET FG +RT RKGM+RTVSQL+KESL++L+SVL NTNP+FVRCIIPNHEK+  +I+  LVLDQLKCNGVLEGIRICRQG+P+R+ FQEF+QRY+IL P  +++G+MDG+ AAE ++  LE+   LY+IGQSKIFFKAGV+A LEEDRD ++++++I FQA+ R +LA+K  Q R+Q I AIRIIQRN VAYLKLRNWPWWRLFTKV+PLLSVTRQEEIVA KE EL+ + + L KT+   TET+   E+   + + L +ELQ E  +F   ++  +KL    + +   I +LE +ESE K  I +LE  +  L  +V D+S+QLE EEQ RQKLQLEK SLEQ    L +E+A ++D+ +KL K+K++++ RL +    L++EE+++KQL KLK+++E+ I+ELE+KL +E ++RQDLER +RRLE E+ E +EQ  +   ++D+LKQ++A  E +L + Q KLD+E++AK +  KQLR+ E  +Q+LR+DLE E+AARDRAE  KRD  EE+EAL+ EL D+G+ SE   EALRK E E++  RK  E +    E+ + ELRKK+  K EQL EQLE   + K+A E+SK+QLE    DL+ +   +  A+ E +KKR+ +EQ+L      LE S R    IE   +K + +LE  NK     E    ++  L + NN A            +LK  L DET AKL +Q  LR  E ER   +D  DEEE+N+  LEKH Q+L+ QM   K K  ED++ L+  ++I KKL R+   L  + EE AA +EK+EKS++KLQ ELEDA+HA  +QRS+ +N+DR+ KK+E +L + M     +Q+ ++ +DK+ R++ET+++    ++E ++E   E ERQ+ NL  EL +L    DDAGK+ + LE+ K +LEN+++EL+   E+LE++ A L M K R D++I  +K   +RE+  + + FEE R+ ++K+ ++ + EL+D+K  RA+    ++K+E ++ D N R D  ++ +E+  +QLK+ Q    E +RDL      RD+ +  +++LEK+ +  + E A+  ++L  SE++ + A  ER+EA+ E  S + A N   EE+KR E+   + +EELEE Q A  E +D  K+    LE AQ +LG ER     +E Q+   EK +K+ + +L E E +  K+ K Q++ ++ R+   + QLENE  E+   +R  R+ DK++K++ LQL+E +     +K+QL+K      R K  L  +EDE +NL+  KR++ RDLE+ TE ++N+E ++Q L+++ N    S+            +TG   G  TPED  S  D ++S
BLAST of Myosin head vs. TrEMBL
Match: A0A4E0RIV7 (Non-muscle myosin II heavy chain OS=Fasciola hepatica OX=6192 GN=D915_003271 PE=3 SV=1)

HSP 1 Score: 1435.62 bits (3715), Expect = 0.000e+0
Identity = 833/1709 (48.74%), Postives = 1196/1709 (69.98%), Query Frame = 1
            I F   GF AGANIETYLLEKARVIRQA +ER FHIFYQLL+  + +M+  LLL + + YRFL NG   I G DE Q++ ET EA+ IMGI+ E+Q  IFR+IS+V+ +GN++F+Q+RNSDQATLPD S AQK+AHLLG+ + DM K+FLKPRIKVG++ V K QTK Q EF+VEAISKA+YER+F WLV RIN+TLD+ KR G +F+GILDIAGFEIF+VNSFEQLCINYTNEKLQQLFNHTMF+LEQEEY +EGI WE+IDFGLDLQPTIDLIEK +GIL+LLDEECFFPKATDKSFVEKLLKTQE HPK+ K EFR + DF V HYAGRVDY++  WL KNMDPLN+NVV L Q SN   VQ IWKDAE  V+++ATA  +T FG+    RKGM+RTVSQL+KESLV+L+ VL NT+P FVRCIIPNHEKRP +I++ LVLDQLKCNGVLEGIRICRQG+P+R+LFQEF+QRY+IL P  +++GFMDG+ A  ++L  LE++  LY+IG SKIFFKAGV+A LEEDRD+ ++ +II+FQA +RG+L+R+  + RIQ + AI +IQRN VAYLKLRNWPWWRLFTKV+PLL+VTRQEEIVA KE+EL+K+ + LEK TGE  E ++  E+L +EK +L  ELQQE  + Q+ + ER +L +KL+  +   A++E +  EDK K+   E +Q +L++ ++DLS+QLE EEQ RQK+Q+EK+++EQ+ TQL  +   ++DK +KL K KK ++DR+ +  + L+EEE++NKQL KLK +HE+ + +LE++L RE  ARQDL+R +RRLE E  E +EQ  E    +++L+ +++  E EL +LQ +LDEE++A+ I  K++R+SE LIQ+L+ED+E+ER ARD+AE+ KRD  EE+EA++ EL D+GS S    EALRK E E++ LR+  + +  + E+ +QELRK H+   E L EQLE+  K K+A E SK Q +    ++  + ++ Q+++ ++D++R+  EQQL E   +  + +  + +   ++NK  A +E +   I+ LE+   +  R   S   E  +L++ L +ET  KL +Q+ +R +E+ER   +D  D EE+ ++ LEKH   L+ QMQ  K KA ED + ++Q +E+ KKL RE+     + EE  A +EK EKS+KK+QAELED +HA  SQR +  NN+R+ KK+E    E M +   +Q  +E  D++ RD++T+++    +I+ ++E   E E Q+ +L +EL DL   +DDAGK+++ LE+   +L  +++E +  +E+LE+E +T+ M K R +V++  ++   +REL  +++  EE R+  +K+ ++LE ELDD+K  R      ++KLE ++ D N RL+M  + KE+ L+QLKK+Q   G  QR+L+E    R++ +  ++DLEKK++  + E   L EEL  +E+  +   +E +E + E  +L  A N A E+++R E R    E++LEE Q+A +  ++  K+   QLE  Q++   ER   +  E Q+++ EK +K+ +++L E E    ++ K QL+ L+ R+   + QLE E  +K  +++  ++ +K+MK+L++Q++E +++ E +K   +KA   V R+K +L  +E+EN  LK  +R+L RDLE+ATE+R  +E  +Q+L+    +         R  R        RTGD    D+
BLAST of Myosin head vs. TrEMBL
Match: A0A504Y9W6 (Non-muscle myosin II heavy chain OS=Fasciola gigantica OX=46835 GN=FGIG_08997 PE=3 SV=1)

HSP 1 Score: 1435.24 bits (3714), Expect = 0.000e+0
Identity = 833/1709 (48.74%), Postives = 1196/1709 (69.98%), Query Frame = 1
            I F   GF AGANIETYLLEKARVIRQA +ER FHIFYQLL+  + +M+  LLL + + YRFL NG   I G DE Q++ ET EA+ IMGI+ E+Q  IFR+IS+V+ +GN++F+Q+RNSDQATLPD S AQK+AHLLG+ + DM K+FLKPRIKVG++ V K QTK Q EF+VEAISKA+YER+F WLV RIN+TLD+ KR G +F+GILDIAGFEIF+VNSFEQLCINYTNEKLQQLFNHTMF+LEQEEY +EGI WE+IDFGLDLQPTIDLIEK +GIL+LLDEECFFPKATDKSFVEKLLKTQE HPK+ K EFR + DF V HYAGRVDY++  WL KNMDPLN+NVV L Q SN   VQ IWKDAE  V+++ATA  +T FG+    RKGM+RTVSQL+KESLV+L+ VL NT+P FVRCIIPNHEKRP +I++ LVLDQLKCNGVLEGIRICRQG+P+R+LFQEF+QRY+IL P  +++GFMDG+ A  ++L  LE++  LY+IG SKIFFKAGV+A LEEDRD+ ++ +II+FQA +RG+L+R+  + RIQ + AI +IQRN VAYLKLRNWPWWRLFTKV+PLL+VTRQEEIVA KE+EL+K+ + LEK TGE  E ++  E+L +EK +L  ELQQE  + Q+ + ER +L +KL+  +   A++E +  EDK K+   E +Q +L++ ++DLS+QLE EEQ RQK+Q+EK+++EQ+ TQL  +   ++DK +KL K KK ++DR+ +  + L+EEE++NKQL KLK +HE+ + +LE++L RE  ARQDL+R +RRLE E  E +EQ  E    +++L+ +++  E EL +LQ +LDEE++A+ I  K++R+SE LIQ+L+ED+E+ER ARD+AE+ KRD  EE+EA++ EL D+GS S    EALRK E E++ LR+  + +  + E+ +QELRK H+   E L EQLE+  K K+A E SK Q +    ++  + ++ Q+++ ++D++R+  EQQL E   +  + +  + +   ++NK  A +E +   I+ LE+   +  R   S   E  +L++ L +ET  KL +Q+ +R +E+ER   +D  D EE+ ++ LEKH   L+ QMQ  K KA ED + ++Q +E+ KKL RE+     + EE  A +EK EKS+KK+QAELED +HA  SQR +  NN+R+ KK+E    E M +   +Q  +E  D++ RD++T+++    +I+ ++E   E E Q+ +L +EL DL   +DDAGK+++ LE+   +L  +++E +  +E+LE+E +T+ M K R +V++  ++   +REL  +++  EE R+  +K+ ++LE ELDD+K  R      ++KLE ++ D N RL+M  + KE+ L+QLKK+Q   G  QR+L+E    R++ +  ++DLEKK++  + E   L EEL  +E+  +   +E +E + E  +L  A N A E+++R E R    E++LEE Q+A +  ++  K+   QLE  Q++   ER   +  E Q+++ EK +K+ +++L E E    ++ K QL+ L+ R+   + QLE E  +K  +++  ++ +K+MK+L++Q++E +++ E +K   +KA   V R+K +L  +E+EN  LK  +R+L RDLE+ATE+R  +E  +Q+L+    +         R  R        RTGD    D+
BLAST of Myosin head vs. TrEMBL
Match: A0A4S2LML2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006176 PE=3 SV=1)

HSP 1 Score: 1434.47 bits (3712), Expect = 0.000e+0
Identity = 833/1683 (49.49%), Postives = 1188/1683 (70.59%), Query Frame = 1
            I F   GF AGANIETYLLEKARVIRQA +ER FHIFYQLL+T  SEMK  LLL + + YRFL NG   I G DE QA+ ET EA+ IMGIT E+Q  IFRVIS+V+ +GN++F+Q+RNSDQATLPD+SVAQK  HLLG+ + DMTKAFLKPRIKVG++ VSKAQTK Q EF+VEAISK++YER+F WLV RIN+TLD+ KR G +F+GILDIAGFEIF+VNSFEQLCINYTNEKLQQLFNHTMFVLEQ+EY +EGI W++IDFGLDLQPTIDLIEK +GIL+LLDEECFFPKATDKSFVEKLLKTQE HPK+ K +FRS+ DF V HYAGRVDYV+ +WL KNMDPLN+N+V L   S+ P VQ I+KDAE  +++SATA  +T FG+    RKGM+RTV QL+KESLV+L++VL NT+P FVRCIIPNHEKRP +I+  LVLDQLKCNGVLEGIRICRQG+P+R+LFQEF+QRY+IL P  + +GFMDG+ A  ++L ALE++  LY+IG SKIFFKAGV+A LEEDRD+ ++ +II+FQA +RG+LAR+  + RIQ   AI +IQRN VAYLKLRNWPWWRLFTKV+PLL+VTRQEE+VA KE+EL+K+ + LEK T +  E ++  E+L +EK +L  EL+QE  + Q+ + ER +L ++++  ++   E+E K  E+K K+   + +  +LK++V+DLS+QLE+EEQ RQKLQ+EK S+EQ+ TQ+  EN  ++DK +KLVKDKK + DR+ +  + L+EEE+++KQL KLK +HE+ I +LE++L+RE  +RQDL+R++RRLE E  E S+  VE+   L++L   ++  E EL + Q++LDEE+VAK I  K++R+ E LIQ+L+EDLE+ER ARD+AE+ KRD  EE+EA++ EL D+GS +    EAL K E E++ LR+  + ++   E+ I ELRK H    + + EQLE+  K K A E +K+Q +    +L  + ++ Q  + ++DK+R+  EQQL E+  R  + +  + +   ++ K  A +E     ++ LE    + AR   +   E  +++  L DET+AKL +Q+ +R +E+ER   +D  + EE+ +  LEKH   L+ QMQ  K K  ED   ++Q ++  KKL RE+     + EE  A +EK+EKS+KKLQ ELEDA+HA  SQRS+  NN+R+ KK+E    EL  +   +Q  +E  D++ RD++T+++    + E ++E   E ERQ+  L +EL DL   +DDAGK+++ L++   +L+ +++E +  +E+LE+E +T+ M K R +V++  +K   +R+L  +++  EE R+  +K+ +DLE EL+D++  R S    ++KLE ++ +   RL++  + K++ L+QLKKFQS GG  QRD++E    RD+ L  ++D+EKKW+  + E     E+L  SE+  +   +E +EA+ E  S  +  N A EE+KR E R  + E++LEE QN  +  ++  K+   QLE  Q++L  ER   +  + Q+ + EK +K+ +++L E E +  ++ K Q++ L+ R+   + QLE E +EK   ++  R+ +K++K++ LQ++E +++ +  K+  +KA   + R+K E+  +E+EN  LK  +R+L RDLE+A E+R   E  +Q+L+   R NT  G
BLAST of Myosin head vs. TrEMBL
Match: A0A4S2LP74 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006176 PE=3 SV=1)

HSP 1 Score: 1433.7 bits (3710), Expect = 0.000e+0
Identity = 829/1673 (49.55%), Postives = 1184/1673 (70.77%), Query Frame = 1
            I F   GF AGANIETYLLEKARVIRQA +ER FHIFYQLL+T  SEMK  LLL + + YRFL NG   I G DE QA+ ET EA+ IMGIT E+Q  IFRVIS+V+ +GN++F+Q+RNSDQATLPD+SVAQK  HLLG+ + DMTKAFLKPRIKVG++ VSKAQTK Q EF+VEAISK++YER+F WLV RIN+TLD+ KR G +F+GILDIAGFEIF+VNSFEQLCINYTNEKLQQLFNHTMFVLEQ+EY +EGI W++IDFGLDLQPTIDLIEK +GIL+LLDEECFFPKATDKSFVEKLLKTQE HPK+ K +FRS+ DF V HYAGRVDYV+ +WL KNMDPLN+N+V L   S+ P VQ I+KDAE  +++SATA  +T FG+    RKGM+RTV QL+KESLV+L++VL NT+P FVRCIIPNHEKRP +I+  LVLDQLKCNGVLEGIRICRQG+P+R+LFQEF+QRY+IL P  + +GFMDG+ A  ++L ALE++  LY+IG SKIFFKAGV+A LEEDRD+ ++ +II+FQA +RG+LAR+  + RIQ   AI +IQRN VAYLKLRNWPWWRLFTKV+PLL+VTRQEE+VA KE+EL+K+ + LEK T +  E ++  E+L +EK +L  EL+QE  + Q+ + ER +L ++++  ++   E+E K  E+K K+   + +  +LK++V+DLS+QLE+EEQ RQKLQ+EK S+EQ+ TQ+  EN  ++DK +KLVKDKK + DR+ +  + L+EEE+++KQL KLK +HE+ I +LE++L+RE  +RQDL+R++RRLE E  E S+  VE+   L++L   ++  E EL + Q++LDEE+VAK I  K++R+ E LIQ+L+EDLE+ER ARD+AE+ KRD  EE+EA++ EL D+GS +    EAL K E E++ LR+  + ++   E+ I ELRK H    + + EQLE+  K K A E +K+Q +    +L  + ++ Q  + ++DK+R+  EQQL E+  R  + +  + +   ++ K  A +E     ++ LE    + AR   +   E  +++  L DET+AKL +Q+ +R +E+ER   +D  + EE+ +  LEKH   L+ QMQ  K K  ED   ++Q ++  KKL RE+     + EE  A +EK+EKS+KKLQ ELEDA+HA  SQRS+  NN+R+ KK+E    EL  +   +Q  +E  D++ RD++T+++    + E ++E   E ERQ+  L +EL DL   +DDAGK+++ L++   +L+ +++E +  +E+LE+E +T+ M K R +V++  +K   +R+L  +++  EE R+  +K+ +DLE EL+D++  R S    ++KLE ++ +   RL++  + K++ L+QLKKFQS GG  QRD++E    RD+ L  ++D+EKKW+  + E     E+L  SE+  +   +E +EA+ E  S  +  N A EE+KR E R  + E++LEE QN  +  ++  K+   QLE  Q++L  ER   +  + Q+ + EK +K+ +++L E E +  ++ K Q++ L+ R+   + QLE E +EK   ++  R+ +K++K++ LQ++E +++ +  K+  +KA   + R+K E+  +E+EN  LK  +R+L RDLE+A E+R   E  +Q+L+
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 772/1719 (44.91%), Postives = 1145/1719 (66.61%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA  ER+FHIFY +++  K +++  LLL   + YRFL  G   I G  + + + ET+EA+ IMG++DEE+  I +V+S+V+ +GN+EFK++RN +QAT+PDN+ AQK+ HL G+ VTD T+A L PRIKVGRE V KAQTKEQA+F++EA++KA YER+F+W++ R+N+ LDK KRQG +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEKL  T   H K  K  + +   +FSV HYAGRVDY A  WL KNMDPLN+NV  LL  S+  FVQ +WKD +  V L   A           +T+KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL   ++ +GFMDGK A   ++  L++D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+R+IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +++KE+EL K  +   K   E  +      Q+ EE+  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++ + ++ D+ K++Q++ +L E LE EE  RQKLQLEK + E K  +L+D+   ++D+ +KL+K++K +++R+ +    L+EEE+K+K L+KLK +HE++I+ELE +L +E   RQ+L++ +R+LE E  +  EQ+ +  + + +LK +LA  E EL     +L++E+  K    K++R+ EG+I DL+EDLE+ERAAR++AEK KRD  EE+EALKSEL DT  T+    E   KRE+E+TLL++  E E++  E+++QE+R+KHT   E+L EQLE++ + K   E +K  LEKE ++L+VE R+   A+ +V+ KRK +E QL +L  R  +++K K E  ++++K+T  +E     ++  E  N +  + + SL  + +D +  L++ET  KL+    LR +E+ER ++Q+Q +EE   +  +E+H   L  Q+  FK K  E +  ++  +E  K+L R++     Q EE AA  +K+EK+K +LQ ELED     D+QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+ ++   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L+ +++  EE RK + K+ ++LE EL+D++  RA++  +K+K+E +++DL  ++D   K +++ ++QL+K Q+   + QR+L E    R+E++   K+ E+K K  + E+ +L E+L  +E+ +K A AER+E   E  S  +  +   +E++R E +   LEEELEE Q      +D  +K + Q++   +EL  ER      E  +   E+  KD +++LQE+E  +  K+K+ ++ L+ +V Q E QLE E  +K   ++  R+ +KK+KDL++Q+++ RK  E  K+Q DKAN +V +LK +L E E+E+  + A +RKL R+L++ATE+ D +  ++ SLKS  RR         NE +  S   +TG R    T DA  +D
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1229.54 bits (3180), Expect = 0.000e+0
Identity = 760/1680 (45.24%), Postives = 1131/1680 (67.32%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA  ER+FHIFY +++  K +++  LLL   + YRFL  G   I G  + + + ET+EA+ IMG++DEE+  I +V+S+V+ +GN+EFK++RN +QAT+PDN+ AQK+ HL G+ VTD T+A L PRIKVGRE V KAQTKEQA+F++EA++KA YER+F+W++ R+N+ LDK KRQG +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEKL  T   H K  K  + +   +FSV HYAGRVDY A  WL KNMDPLN+NV  LL  S+  FVQ +WKD +  V L   A           +T+KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL   ++ +GFMDGK A   ++  L++D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+R+IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +++KE+EL K  +   K   E  +      Q+ EE+  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++ + ++ D+ K++Q++ +L E LE EE  RQKLQLEK + E K  +L+D+   ++D+ +KL+K++K +++R+ +    L+EEE+K+K L+KLK +HE++I+ELE +L +E   RQ+L++ +R+LE E  +  EQ+ +  + + +LK +LA  E EL     +L++E+  K    K++R+ EG+I DL+EDLE+ERAAR++AEK KRD  EE+EALKSEL DT  T+    E   KRE+E+TLL++  E E++  E+++QE+R+KHT   E+L EQLE++ + K   E +K  LEKE ++L+VE R+   A+ +V+ KRK +E QL +L  R  +++K K E  ++++K+T  +E     ++  E  N +  + + SL  + +D +  L++ET  KL+    LR +E+ER ++Q+Q +EE   +  +E+H   L  Q+  FK K  E +  ++  +E  K+L R++     Q EE AA  +K+EK+K +LQ ELED     D+QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+ ++   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L+ +++  EE RK + K+ ++LE EL+D++  RA++  +K+K+E +++DL  ++D   K +++ ++QL+K Q+   + QR+L E    R+E++   K+ E+K K  + E+ +L E+L  +E+ +K A AER+E   E  S  +  +   +E++R E +   LEEELEE Q      +D  +K + Q++   +EL  ER      E  +   E+  KD +++LQE+E  +  K+K+ ++ L+ +V Q E QLE E  +K   ++  R+ +KK+KDL++Q+++ RK  E  K+Q DKAN +V +LK +L E E+E+  + A +RKL R+L++ATE+ D +  ++ SLKS+
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1228.77 bits (3178), Expect = 0.000e+0
Identity = 760/1680 (45.24%), Postives = 1131/1680 (67.32%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA  ER+FHIFY +++  K +++  LLL   + YRFL  G   I G  + + + ET+EA+ IMG++DEE+  I +V+S+V+ +GN+EFK++RN +QAT+PDN+ AQK+ HL G+ VTD T+A L PRIKVGRE V KAQTKEQA+F++EA++KA YER+F+W++ R+N+ LDK KRQG +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEKL  T   H K  K  + +   +FSV HYAGRVDY A  WL KNMDPLN+NV  LL  S+  FVQ +WKD +  V L   A           +T+KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL   ++ +GFMDGK A   ++  L++D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+R+IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +++KE+EL K  +   K   E  +      Q+ EE+  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++ + ++ D+ K++Q++ +L E LE EE  RQKLQLEK + E K  +L+D+   ++D+ +KL+K++K +++R+ +    L+EEE+K+K L+KLK +HE++I+ELE +L +E   RQ+L++ +R+LE E  +  EQ+ +  + + +LK +LA  E EL     +L++E+  K    K++R+ EG+I DL+EDLE+ERAAR++AEK KRD  EE+EALKSEL DT  T+    E   KRE+E+TLL++  E E++  E+++QE+R+KHT   E+L EQLE++ + K   E +K  LEKE ++L+VE R+   A+ +V+ KRK +E QL +L  R  +++K K E  ++++K+T  +E     ++  E  N +  + + SL  + +D +  L++ET  KL+    LR +E+ER ++Q+Q +EE   +  +E+H   L  Q+  FK K  E +  ++  +E  K+L R++     Q EE AA  +K+EK+K +LQ ELED     D+QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+ ++   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L+ +++  EE RK + K+ ++LE EL+D++  RA++  +K+K+E +++DL  ++D   K +++ ++QL+K Q+   + QR+L E    R+E++   K+ E+K K  + E+ +L E+L  +E+ +K A AER+E   E  S  +  +   +E++R E +   LEEELEE Q      +D  +K + Q++   +EL  ER      E  +   E+  KD +++LQE+E  +  K+K+ ++ L+ +V Q E QLE E  +K   ++  R+ +KK+KDL++Q+++ RK  E  K+Q DKAN +V +LK +L E E+E+  + A +RKL R+L++ATE+ D +  ++ SLKS+
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh11a (myosin-11-like [Source:NCBI gene;Acc:103025732])

HSP 1 Score: 1163.29 bits (3008), Expect = 0.000e+0
Identity = 691/1487 (46.47%), Postives = 1011/1487 (67.99%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA  ER+FHIFY +++  K +++  LLL   + YRFL  G   I G  + + + ET+EA+ IMG++DEE+  I +V+S+V+ +GN+EFK++RN +QAT+PDN+ AQK+ HL G+ VTD T+A L PRIKVGRE V KAQTKEQA+F++EA++KA YER+F+W++ R+N+ LDK KRQG +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEKL  T   H K  K  + +   +FSV HYAGRVDY A  WL KNMDPLN+NV  LL  S+  FVQ +WKD +  V L   A           +T+KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL   ++ +GFMDGK A   ++  L++D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+R+IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +++KE+EL K  +   K   E  +      Q+ EE+  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++++ + ++ D+ K++Q++ +L E LE EE  RQKLQLEK + E K  +L+D+   ++D+ +KL+K++K +++R+ +    L+EEE+K+K L+KLK +HE++I+ELE +L +E   RQ+L++ +R+LE E  +  EQ+ +  + + +LK +LA  E EL     +L++E+  K    K++R+ EG+I DL+EDLE+ERAAR++AEK KRD  EE+EALKSEL DT  T+    E   KRE+E+TLL++  E E++  E+++QE+R+KHT   E+L EQLE++ + K   E +K  LEKE ++L+VE R+   A+ +V+ KRK +E QL +L  R  +++K K E  ++++K+T  +E     ++  E  N +  + + SL  + +D +  L++ET  KL+    LR +E+ER ++Q+Q +EE   +  +E+H   L  Q+  FK K  E +  ++  +E  K+L R++     Q EE AA  +K+EK+K +LQ ELED     D+QR    N ++K KK +  L E     A     R+  + + R+KETK + L   +E+ ++   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L+ +++  EE RK + K+ ++LE EL+D++  RA++  +K+K+E +++DL  ++D   K +++ ++QL+K Q+   + QR+L E    R+E++   K+ E+K K  + E+ +L E+L  +E+ +K A AER+E   E  S  +  N A   R RF
BLAST of Myosin head vs. Ensembl Cavefish
Match: myh11b (myosin, heavy chain 11b, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-101124-2])

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 725/1682 (43.10%), Postives = 1106/1682 (65.76%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA  ERSFHIFY +++  K +MK+ LLL    GYRFL  G   + G  + + F+ET+EA++++G  +EE+  + +V S+V+ +GN+EFK+++N +QA++PD + AQK+ HL G+ +TD TKA L PRIKVGRE V KAQTKEQA+F+VEA++KAMY+R+F+W++ R+N+ LDK KRQG +FIGILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFV+KL  T   H K +K +  +    FSV+HYAG+VDY A  WL KNMDPLN+N+  LL  S  PFVQ +WKDAE  V   T++  A  +T   S T+  KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+F EF+QRY+IL    + +GFMDGK A   ++  L++D NLY+IGQSK+FF+ GV+A LEE+RDL+++ +II FQA  RGFLARK    R QQ+ A+++IQRN  AYLKL+NW WWRLFTKVKPLL VTRQEE ++ KEEEL+K  +V +K   +  E  +   QL EE+  L  +LQ E   + +AE+ R +L  K +E + ++ ++EA+  E++E+   L+E++  +++++ D+  +L   E +R KL  EK + + K  +++DE   ++D+ +KL K+K+ +++RL +  + L+EEE+K+K L+KLK +HE++I+ELE ++ +E   RQD+E+ +R+LE E  +  +QL    + + +LK +LA  E EL  L  +L++E   K    K++R+ EGLI +L++DL+ ER  R + EK + +   E+EAL++EL D+   +    E   KRE+E+ +L+K+ E   ++ E+++Q+LR+KHT   E+L EQLE++ + K   E +K  LEKE   L+ E  +  +++ EV+ KRK +E QL ++  R  + ++ + E  +K++KLT  ++     ++  E  N + ++ + +L  +  D +  L++ET  KL +   LR V+EER  + +Q +EE   R  +E+H   L  Q+   K K  E S  ++  +E  K++ RE+  +  + EE A+  +K+EKSK +LQ ELED     D+QR    N ++K +K +  L E         + R+  + + R+KE++ + L   +E+M+    E+E+    L  E+ DL  ++DD GKN+  LE+ K  LE  VQE++  ME+LE+E  +    K RL+V    +K  F REL  +++  EE R+ ++K+ +D+E EL+D++  R S+  +K+KLE +V+D+ +++D   +++++ ++QL+K Q+   + QR+L++      E L   ++ +++ K  + +I  L EEL  +E+ RK A  ER+E + E  S  +  + + EE++R E R  +LEEELEE Q      ++  ++   Q++    EL  ER      E  +   E+  K+ + +LQE E     K KT +++L+ +++Q E QLE E+ E+    +  R+ DKK+KDL +Q+++ RK  E  K+Q +KAN ++ +LK +  E E+E+    A +RKL R+L++A+E+ D L  ++ SLKS+
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 847.04 bits (2187), Expect = 0.000e+0
Identity = 453/793 (57.12%), Postives = 595/793 (75.03%), Query Frame = 1
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 679.478 bits (1752), Expect = 0.000e+0
Identity = 580/1701 (34.10%), Postives = 935/1701 (54.97%), Query Frame = 1
            EK+RV  Q   ER++HIFYQ+LS  K E+   LL+      Y F+  G  +++G+D+      T  A  I+G T EE+  ++++  ++M  GNM FKQ +  +QA       A K ++L+GL   D+ K    PR+KVG E V+K Q  +Q  +S+ A++K++YE+MF W+V RIN++L+ K  RQ  +FIG+LDIAGFEIF+ NSFEQ+CIN+TNEKLQQ FNH MFVLEQEEY+KEGI W +IDFG+DLQ  I+LIEK MGI+S+L+EEC FPKA+D+SF  KL           + P++ KG  R    F++ HYAG VDY    WL KN DPLNE VV L QKS++  +  ++ +       +A      + GS       +TVS LH+E+L KL++ L +T+PHFVRCIIPN EK+P  +++ LV+ QL+CNGVLEGIRICR+G+PNRIL+ +FKQR Y+IL P  V +G FMD + +AE+LL+ L++D   YK G +K+FFKAG++  LEE RD ++S +I   Q+  RGFL+RK     I++ +A+ +IQ N  A++ ++NWPW +LF K+KPLL S   ++E+  MKE+ L KL +   K+     E ++    L +EK  L+ ++Q E+ N  DAE+      + K+SQ+ K         E + + AE+ AK+ + +++ S+L++D D L+               T  K++ EK++ E K   L +E A +DD ++KL K+KK + +   +T++ L  EE K   L+K K + E  + +LE  L +E   R DLER +R+LE +LK   E ++    +K  + +  K R   T T    L +++++E    A + K++++ +  I++L E+LE ERAAR + EK + D A E+E +   L + G  +   +E  +KRE E   LR+  E      E+    LRKKH     +L EQL+   + K   E  K++L+ E +D+     SV        R   D  R +   + L LS + + +D T +K +L+  N   +        I+++   +          ++  R +K    +E +AK  +  +++A   +   +++Q +EE+  +  L++       ++  ++TK   D+ +  ++ +E  KKL + +    + +E + A    +EK+K++LQ ELED     +   +     D+K +  +  L+E  ++    Q   E   K+ R   T++ +L    E+  +    M+R+  NL    +E+ DL+    +  K +  LE+ + +LE E  +LQ  +E+    LE E + +     R  +E+  +K   +R+L +K++  E+ ++   +  + L+  L+ +   R      K+K+E ++ ++  +L    ++  +  +QLK  QS   E Q  L +     DE   Q    E++      E+ +L   L Q+E+ RK+A  E  EA    Q L + N     ++K+ E      QN  E  E +Q   N  +  +K ++     A+ EL  E++    +E  K N E+T+KD Q++L E E    K  K QL  L+ RV + E +LE E     +  +  RK +++ K+L  Q +E +KN   +++ +DK   +V   K    E E++ N NL +  RKL  +LE+A E  D  E+Q   L+++
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005582.1 (pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 gene:ENSPMAG00000004862.1 transcript:ENSPMAT00000005582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 570/1712 (33.29%), Postives = 936/1712 (54.67%), Query Frame = 1
            I F   G  A A+IET  LEK+RV  Q   ER++HIFYQ+LS  K E+ + LL+      Y F+  G  +++G+D+      T  A  I+G T EE+  ++++  ++M  GNM FKQ +  +QA       A K ++L+GL   D+ K    PR+KVG E V+K Q  +Q  +S+ A++K++YE+MF W+V RIN    K  RQ  +FIG+LDIAGFEIF+ NSFEQLCIN+TNEKLQQ FNH MFVLEQEEY+KEGI W +IDFG+DLQ  I+LIEK MGI+S+L+EEC FPKA+D+SF  KL           + P++ KG+  +  DF++ HYAG VDY    WL KN DPLNE VV L QKS+   ++ +     N+  + A   ++      +     +TVS LH+E+L KL++ L +T+PHFVRCIIPN EK+P  +++ LV+ QL+CNGVLEGIRICR+G+PNRIL+ +FKQR Y+IL P  V +G FMD + +AE+LL+ L++D   YK G +K+FFKAG++  LEE RD ++S +I   QA  RG L+RK     I++ +A+ +IQ N  A++ ++NWPW +LF K+KPLL S   ++E+  MKE+ L KL +   K+     E ++    L +EK  L+ ++Q E+ N  DAE+      + K+SQ+ K         E + + AE+ AK+ + +++ S+L++D D L+               T  K++ EK++ E K   L +E A +DD ++KL K+KK + +   +T++ L  EE K   L+K K + E  + +LE  L +E   R DLER +R+LE +LK   E +++  +    L+++    + E+  L +++++E    A + K++++ +  I++L E+LE ERAAR + EK + D A E+E +   L + G  +   +E  +KRE E   LR+  E      E+    LRKKH     +L EQL+   + K   E  K++L+ E +D+ V    S     E+ +KR + L+  ++E     IE+    +E ++  N++   ++ +N     +  +T     +++Q   ++N +  A L    + +     A   AV+  R +   +++Q +EE+  +  L++       ++  ++TK   D+ +  ++ +E  KKL + + +  + +E + A    +EK+K++LQ ELED     +   +     D+K +  +  L E  ++    Q   E   K+ R   T++ +L    E+  +    M+R+  NL    +E+ DL+    +  K +  LE+ + +LE E  +LQ  +E+    LE E + +     R  +E+  +K    R+L +K++  E+ ++  ++  + L+  L+ +   R      K+K+E ++ ++  +L    ++  +  +QLK  Q+    + R    +    D++++ + + +K       E+A L+     S ++  I    +   I   + L       Q E +     C+N               ++  KK          EL  E++    +E  K N E+T+KD Q++L E E    K  K QL  L+ RV + E +LE E     +  +  RK +++ K+L  Q +E +KN   +++ +DK   +V   K +  E E++ N NL +  RKL  +LE+A E  D  E+Q   L+++
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003821.1 (pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 gene:ENSPMAG00000003267.1 transcript:ENSPMAT00000003821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 563/1731 (32.52%), Postives = 929/1731 (53.67%), Query Frame = 1
            I F   G  + A+IETYLLEK+RV  Q   ER++HIFYQ+ S K    ++  L+      Y F+  G  ++  ID+      T    A+ I+G T++E+  I++V  ++M  GNM+FKQ +  +QA    N  A K A+L+GL   D+ K    PR+KVG E V+K QT +Q   SV A++++++E+MF W+V RIN TL  K  RQ  +FIG+LDIAGFEIF+ N+FEQLCIN+TNEKLQQ FNH MFVLEQEEY+KEGI W +IDFG+DLQ  IDLIEK MGI+S+L+E+C FPKA D++F EKL    ++H         PK +KG+  ++  FS+ HYAG VDY    WLEKN DPLN++VVQL QKS++  + +++          A ++  ++ G + +    +TVS LH+E+L KL++ L  T+PHFVRCIIPN  K P  +++ LV+ QL+CNGVLEGIRICR+G+PNRI++ +FKQRY++L P  + +G FMD K A E+L+ +LE+D   YK G +K+FF+AG++  LEE RD ++S L+ + QA +RG+L+R   +  +++  ++ IIQ N  A++ ++NWPW  L+ K+KPLL     E+ +A  +EE  K  + LEK+     E ++ +  + ++K  L  ++Q  +    DAE+        + +L  K+K       E + + AE+ AK+ + +++ S+L++D D L+               T  K++ EK++ E K   L +E A +D+ +SKL K+KK + +   +T++ L  EE K   L+K K + E  + +LE  L +E   R D+ERT+R++E +LK   E L++    L++ KQ              +LDE+L    +++        L+  + E LE                            + G  +  H+E  +KRE E   LR+  E      E+    LRKK      +L EQ++   + K   E  K++ + E +DLS        A++ ++K  + +E QL E+        KTK +EQ+  IN +       + E   L  +++  E    Q +R   S   +  DLK  L +E +AK  +  ++++   +   +++Q DEE+  +  L++       ++  ++TK    A++ +E L   +E  KKL   +    +Q+E S +    +EK+K++L  E+ED     +   S     D+K K     L+E  ++    Q   E   K+ R   T++ +L    E+  +    ++R+  NL +E+ DL+    ++GK L  +E+ + +LE E  E+Q  +E+    LE E   +     R+ +E+  +K    R++ +K++  ++L++   +  + ++  LD +   R      K+K+E ++ ++  +L+   +   +  + L+  Q   G+ ++ L+          V+ + L        N +       G +   LR + +                I+  +N SLI    K + +  + +  C+      E +Q + N  +  +K ++     A+ EL  E++    +E  K N E+T+KD QN+L E E    K  K Q+  L+TRV + E++L++E     +  +  RK ++++K+L  Q +E RKN   +++ +DK   +V   K +  E E++ NTNL +  RKL  +LE+A E  D  E+Q+  L++R
BLAST of Myosin head vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004078.1 (pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 gene:ENSPMAG00000003722.1 transcript:ENSPMAT00000004078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 351/822 (42.70%), Postives = 517/822 (62.90%), Query Frame = 1
            + FG T   A A+IET  LEK+RV  Q   ER++HIFYQ+LS  K E+   LL+      Y F+  G  +++G+D+      T  A  I+G   EE+  ++++  ++M  GNM FKQ +  +QA       A K ++L+GL   D+ K    PR+KVG E V+K Q  +Q  +S+ A++K++YE+MF W+V RIN++L+ K  RQ  +FIG+LDIAGFEIF+ NSFEQLCIN+TNEKLQQ FNH MFVLEQEEY+KEGI W +IDFG+DLQ  I+LIEK MGI+S+L+EEC FPKA+D+SF  KL           + P++ KG  +    F++ HYAG VDY    WL KN DPLNE VV L QKS++  + S++    N+    + A+   + G++ +    +TVS LH+E+L KL++ L +T+PHFVRCIIPN EK+P  +++ LV+ QL+CNGVLEGIRICR+G+P+RIL+ +F  RY+IL P  V +G FMD + +AE+LL+ L++D   YK G +K+FFKAG++  LEE RD ++S +I   QA  RG L+RK     I++ +A+ +IQ N  A++ ++NWPW +LF K+KPLL S   ++E+  MKE+ L KL +   K+     E ++    L +EK  L+ ++Q E+ N  DAE+      + K+SQ+ K         E + + AE+ AK+ + +++ S+L++D D L+               T  K++ EK++ E K   L +E A +DD ++KL K+KK + +   +T++ L  EE K   L+K K + E  + +LE  L +E   R D
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 512.301 bits (1318), Expect = 2.065e-151
Identity = 277/611 (45.34%), Postives = 395/611 (64.65%), Query Frame = 1
            I F + G   GA+IE YLLEK+R++ Q S+ER++HIFYQLLS    SE+KN  L    +  Y+ L N    I  GI++V+ F E + AL I+G + ++   IF+V++ ++L+GN+EF  DR ++QA+  ++  A  I   LG+   D   A L+PR K G+E VS+++  +QA+F + A+S+ +YER+F ++V  IN+ LD       N+IG+LDIAGFEIFE NSFEQLCINYTNEKLQQ FN+ MFVLEQ EY KE I W+YID+G DLQ TIDLIE      G+L LLDEE   PK+TD+SF  KL+ T +++  K  +   ++   F ++HYAG V+Y  E WL KN DPLN+N++ LL  S    +  +++  E   + SA      +NQE +  +RT     +T S  H+E  + LL+ L +T+PHFVRCIIPN+ K+      +L+LDQL+CNGVLEGIR+ R+GYPNRI FQEF QRY+IL P+         K  A      E LL +L++D  +YKIG +K+FFKAGV+A LE+ +D+++++++IK  A  RG+  RK     +Q++   R+I      Y +L +  PW+ LF ++KPLL+
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 355.525 bits (911), Expect = 2.077e-100
Identity = 218/562 (38.79%), Postives = 327/562 (58.19%), Query Frame = 1
            GA I TYLLE++R++ Q   ER++HIFYQL++   ++ K  L L + S Y ++  G  + I+GID+ + +  T++AL ++GIT E Q  IF+++++++ +GN+E K+ RN   A+L  +    K+A  LLG+   +  K   K +I    E +       QA  + ++++K +Y  +F WLV  IN  L       Q ++FIG+LDI GFE FE NSFEQ CINY NEKLQQ FN  +F LEQEEY KE I W +I+F  D QP IDLIE  +GILSLLDEE   P  +D+S+ +KL +T +K P     +K  F     F V HYA  V Y  E ++EKN D +++  +++L+ S    + +I +  E     L      E +     + G +RTV++      + K+SL++L++ +N+TN H++RCI PN +K   + ++ +VL QL+  GVLE IRI   G+P+R  F+EF  RY IL P          K   E+        +L+A   DK+ Y+IG +KIFFKAG++A LE+ R  ++ + I+  Q   R    RK
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 342.428 bits (877), Expect = 1.760e-96
Identity = 218/564 (38.65%), Postives = 315/564 (55.85%), Query Frame = 1
            G+ I TYLLEK+R++ Q   ER++HIFYQ+L    E +K  L L     Y +   G   +I+GIDE + +  T +AL ++GI  E Q  IF++++ ++ +GN+E K  RN D +   +    Q    LLG+   +  K  +K +I    E +       QA  + ++++K +Y  +F WLV  IN+TL D +  Q  +   FIGILDI GFE FE NSFEQ CINY NEKLQQ FN  +F LEQEEY KE I W +I+F  D QP IDLIE  +GILSLLDEE   P  +D+S+  KL     K P     +K  F     F V HYA  V+Y  E ++EKN D ++   + + + +  P  + I  + E    L +    E Q    T K +M          T+  + K+SL +L++++N+TN H++RCI PN EK+P + ++ +VL QL+  GVLE IRI   G+P+R  F EF QRY +L   ++  G +      K A     + +L+A   D   Y+IG +KIFFKAG++A LE+ R  +++ + I  Q   R    R
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 251.521 bits (641), Expect = 3.047e-68
Identity = 177/559 (31.66%), Postives = 288/559 (51.52%), Query Frame = 1
              NI  YLLEK RV+ Q   ER+FHIFYQ     S+  + T  + +   Y +    G  S   ID++Q + ET++A++++G+  EEQ+ IFR++++++ +GN+ F ++   + A + D SV   +A+LL +    + K+ ++ RI      + +           QA+   +A++KA+Y  +F W+V+R+N++L          IGILDI GFEIFE NSFEQ+CINY NEKLQQ+F       EQE Y +E I W  I +  D +   DLIE  +  GI + +++          A D++F ++L L T   H      + RSN  F ++HYAG V Y  +   +KN D L +++V+L+  +   F+ +I+ D         T ++E+       K    T      +S   L+  L+   P ++R I PN  K P   + + VL Q+K  G+ E +RI R G+  R +F++F +R+ +L P     G      D   A + +L    + +  Y++G + +F K    +  LE  RD    ++  + Q   R FL R+
BLAST of Myosin head vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 237.269 bits (604), Expect = 1.234e-63
Identity = 175/562 (31.14%), Postives = 281/562 (50.00%), Query Frame = 1
              NI  YLLEK RV+ Q   ER+FHIFYQ     S+    +   +M   Y +    G  +   ID+V+ +  T+EA++ +G+  EEQ+ IFR++++++ +GN+ F ++   + A + D SV   +A+LL +  + + K  ++ RI      + +           QA    +A++KA+Y  +F W+V R+N +L      DK      IGILDI GFEIFE NSFEQ+CINY NEKLQQ+F       EQE Y +E I W  I +  D +   DLIE     GIL+ +++          A D++F ++ L     +P     E R+N  F ++HYAG V Y      +KN D L +++++L+  +   F+ +I+ D             +    S+ R     T      +S  +L+  L+   P ++R I PN  K P   +   VL Q+K  G+ E +RI R G+  R  F++F +R+ +L P     G    DG    A + +L    + +  +++G + +F K    +  LE+ RD    ++  + Q   R FL R+
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 358.221 bits (918), Expect = 1.764e-102
Identity = 209/554 (37.73%), Postives = 311/554 (56.14%), Query Frame = 1
            I F +     GA++ TYLLEK+RV+ QA+EER++H+FYQ+ +     EMK+   L     + +L  G A  +  ID+   F E  EAL ++GI D+EQ  +FR++S+++ +GN+E  Q    D+ T+ +N    +  A LLG+    + K     +I    E + K  +  +A +  EAISK +Y ++FKW+V  IN TL    +  + FIG+LDI GFE FE+NSFEQ CINY NEKLQQ F   +F LEQ+EY +E I W +I+F  D QP IDLIE  +GIL LLDEEC  PK +D  + +KL K   +  K       SN+ F + H+A  V+Y    ++EKN D +N+  + LL+ S    V  ++ + +        A             M ++V      SL KL+  LN+T PH+VRCI PN  K P +   K  + QL+  GVLE IRI   GYP+R  ++EF  RY +L P + +N+     +   + +L     D++++++G++KIFF+AG VA LE+ R  ++    +  Q   R +   K
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO44785 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ0])

HSP 1 Score: 328.176 bits (840), Expect = 6.192e-91
Identity = 196/558 (35.13%), Postives = 311/558 (55.73%), Query Frame = 1
            Y HL  F   G   G  I+ YLLEK RV+RQ   ER++HIFY LL+  + E  N L L  +  Y +L  +G  S   I++ + FN  + ALK+M   ++E   + +VI+ ++ +GN+ F     +  A + D +V + +A+LL +   D+  A     + +  E +    T +QAE S ++++  +Y   FKW++ +INR +       +  IGILDI GFE FEVN FEQ  INY NEKLQQ FN  +F LEQ EY +EG++W  ID+ +D    +DLIE+ +G+L+L+DEE  FPK TD S ++KL  + +++    K    +N  F ++HYAG V Y    +L+KN D   ++++  L++S   FV  + +  +  +  + T + + +           TVS   KESL  L++ L  ++P+FVRC+ PNH+K P   + +LV++QL+ +G+LE +RI R G+P R+ F++F  RY+ L    P + N      K     LL   + D   +KIG +K F K  +   +E  R+ ++  + +  +    G+L RK
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO31924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWK4])

HSP 1 Score: 289.656 bits (740), Expect = 4.013e-84
Identity = 172/470 (36.60%), Postives = 262/470 (55.74%), Query Frame = 1
            G   GA I  YLLE++R++ Q  +ER++HIFY++L+    E K  L L     + +L  G   I    ++ AF++ I A++I+ I++ E++ IF  +++V+ +G+  F +   S  D A L D   A+  AHLLGL    + KA +  + +   E +   +  EQA  + +AI+K +Y R+F WLV R+N  +   K++ +  I ILDI GFE F +NSFEQLCINY NE LQ  FN  +F +EQ+EY  EGI W  + +  D Q  +DL+ K   GIL LL +E  FPKATD SF+EK  +  +      K +     +F+V H+AG V Y    +L+KN D L +++  LL K+N   +  I              N++    +        TV     +SL++L+  +   NP FVRCI PN +K P +   KLVLDQ++  G+LE ++I + G+P RI++  F +R
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO35007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMP8])

HSP 1 Score: 290.041 bits (741), Expect = 2.418e-83
Identity = 191/567 (33.69%), Postives = 305/567 (53.79%), Query Frame = 1
            I + + G   G  I T+LLEK+RV+ Q   ER++HIFYQLLS  T  EM    + LG    Y++L   G  +I G D+V  +  TI A++++GI    +  + +++++V+ +GN++F ++ N  QA   D S+    + LL +     +  +T   ++ R     E   K   K+QA  + +A++KA++ ++F++LV  +N T+    R    +IG+LDI GFE F+VN FEQ  INY NEKLQ LF      +EQEEY +EGISW  ID+  +    + LIE  +  GI+ +LD+ C       + +  + ++KL   + +     K  + + R    F++ HYAG+V Y +E + EKN D L+ ++V L+Q S  PFV+ ++ D+       A+A      G   RK    T S   +     L+S +    PH+VRC+ P   K P   + K VL Q++  G+ E I++ R G+  R  F    +RY +L P TV +   D  AA + +L A  +D   Y++G++K+F K   ++  LEE R+  I+   +  Q   RG+ ARK
BLAST of Myosin head vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 286.189 bits (731), Expect = 2.378e-81
Identity = 181/538 (33.64%), Postives = 290/538 (53.90%), Query Frame = 1
            GA I+ YLLE++R++ Q   ER++HIFY++L+  S + K +L L     Y +L  G   +  G+D+   ++   +A+  +  T+EE + IFR I++V+ +GN+ F  K + N +   + +       A LL +    M +AF +       E +    + E+A    +A  K +Y ++F W+V +IN ++     KD   G   IG+LDI GFE F++NSFEQLCINY NE LQQ F   +F  EQEEY +EGI W ++ F +D Q  +D++ EK M  ++L+DEE  FP+ TD+SF++KL    + +    + + R    F V H+AG V Y    +L+KN +  + ++V L+  S   F  +++              +E   G+ TRK    T+    + SL  L+  L +    FVRC+ PN+ K+P + + +L   QL+ +G+LE +RI + GY  R  F+EF  RY +L   ++    M  + A+  +  +L   +N +K+G  +IF K      LEE R   +SS II  Q
BLAST of Myosin head vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 1246.11 bits (3223), Expect = 0.000e+0
Identity = 774/1709 (45.29%), Postives = 1138/1709 (66.59%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LL+   + ++  LLL   + YRFL NG  +I G  +   FNET++A KIM I +EEQ  + +V++SV+ +GNM FK++R++DQA++PDN+ AQK++HL+G+ VTD T+A L PRIKVGR+ V KAQT+EQAEF+VEA++KA YERMF+WLV RIN+ LDK KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIEK     GIL+LLDEEC+FPKATDKSFVEK+ + Q  HPK  K +   +  DFS+ HYAG+VDY A++WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   +      G+ +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K+E  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A   ++ +LE+D NLY+IGQSK+FF+AGV+A LEE+RD++I+ +II FQA+ RG +ARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL V+RQEE +  K+EEL K+ +       +  E ++  +QL  EK+ L  +LQ E     +AE+ R +L+ K +E + ++ +LEA+  E++E+ S+L  ++ K++Q ++DL +QL+ EE  RQKLQLEK +LE K  ++++E   +DD+ +KL+K+KK +++R++E    L+EEE+K+K L KLKT+HE +IT+LED+L RE   RQ+LE+ RR+LE +  E  +Q+ E  + + +L+ +LA  E EL     +++EE   K +  K++R+ E  + +L+EDLE E+ AR +AEK +RD  EE+EALK+EL DT  T+    E   KRE E+  L+KT E E K  E ++ ELR+KH    ++L EQLE+  + K++ E +K  LE E N+LS+E +     + E + +RK  E Q+ EL  +  E+++ + E  +K+ K+ A +E     +   E  + + ++   S++ + +D++  L +ET  KL +   LR +EEE+ N+++Q +EEE  +  +EK  Q ++ Q+   K K  +DS  L+  +E  KKL R++    Q+ +E  A  +K++K+K +LQ EL+D     D  R    N ++K KK +  L E     A   + R+  + + R+KET+ + L  ++E + +   E++R    L  E+ DL  ++DD GKN+  LE+ K  +E +++E++  +E+LE+E       K RL+V +  +K   +R+L  +++  EE ++ +IK+ +++E+EL+D++  R++   A++KLEL++++L + +DM  K+++D L+QLKK Q    +  R+L E    R+E+L   K+ EKK KA + E+ ++ EEL  +E+L++ A  ER+E   E  +    +  A EER+R E R   LEEELEE Q      +D  KK  LQ +    EL  ER     VEG +   E+  K+ + +LQ+LE  +  KYK  ++ L+ +V Q E QLE E+ E+   ++L R+ +KK+K+++LQ+D+ R++ E  K+Q DK N ++ +LK +L E EDE    KAT+RKL R+L+DATES +++  ++ SLK++     G L F  R   SR N       +  P
BLAST of Myosin head vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 1245.72 bits (3222), Expect = 0.000e+0
Identity = 774/1709 (45.29%), Postives = 1138/1709 (66.59%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA EER+FHIFY LL+   + ++  LLL   + YRFL NG  +I G  +   FNET++A KIM I +EEQ  + +V++SV+ +GNM FK++R++DQA++PDN+ AQK++HL+G+ VTD T+A L PRIKVGR+ V KAQT+EQAEF+VEA++KA YERMF+WLV RIN+ LDK KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIEK     GIL+LLDEEC+FPKATDKSFVEK+ + Q  HPK  K +   +  DFS+ HYAG+VDY A++WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   +      G+ +TRKGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEK+  K+E  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A   ++ +LE+D NLY+IGQSK+FF+AGV+A LEE+RD++I+ +II FQA+ RG +ARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL V+RQEE +  K+EEL K+ +       +  E ++  +QL  EK+ L  +LQ E     +AE+ R +L+ K +E + ++ +LEA+  E++E+ S+L  ++ K++Q ++DL +QL+ EE  RQKLQLEK +LE K  ++++E   +DD+ +KL+K+KK +++R++E    L+EEE+K+K L KLKT+HE +IT+LED+L RE   RQ+LE+ RR+LE +  E  +Q+ E  + + +L+ +LA  E EL     +++EE   K +  K++R+ E  + +L+EDLE E+ AR +AEK +RD  EE+EALK+EL DT  T+    E   KRE E+  L+KT E E K  E ++ ELR+KH    ++L EQLE+  + K++ E +K  LE E N+LS+E +     + E + +RK  E Q+ EL  +  E+++ + E  +K+ K+ A +E     +   E  + + ++   S++ + +D++  L +ET  KL +   LR +EEE+ N+++Q +EEE  +  +EK  Q ++ Q+   K K  +DS  L+  +E  KKL R++    Q+ +E  A  +K++K+K +LQ EL+D     D  R    N ++K KK +  L E     A   + R+  + + R+KET+ + L  ++E + +   E++R    L  E+ DL  ++DD GKN+  LE+ K  +E +++E++  +E+LE+E       K RL+V +  +K   +R+L  +++  EE ++ +IK+ +++E+EL+D++  R++   A++KLEL++++L + +DM  K+++D L+QLKK Q    +  R+L E    R+E+L   K+ EKK KA + E+ ++ EEL  +E+L++ A  ER+E   E  +    +  A EER+R E R   LEEELEE Q      +D  KK  LQ +    EL  ER     VEG +   E+  K+ + +LQ+LE  +  KYK  ++ L+ +V Q E QLE E+ E+   ++L R+ +KK+K+++LQ+D+ R++ E  K+Q DK N ++ +LK +L E EDE    KAT+RKL R+L+DATES +++  ++ SLK++     G L F  R   SR N       +  P
BLAST of Myosin head vs. Ensembl Medaka
Match: myh11a (myosin heavy chain 11 [Source:NCBI gene;Acc:101164959])

HSP 1 Score: 1159.44 bits (2998), Expect = 0.000e+0
Identity = 739/1629 (45.37%), Postives = 1093/1629 (67.10%), Query Frame = 1
            LLL   S YRFL  G   I G  + + F ET+EA++IMG+TDEE+  I +V S+VM +GN+ FK++RN +QAT+PDN+ AQK+ HL G+ VTD T+A L PRIKVGRE V KAQTKEQA+F++EA++KA+YERMF+W++ R+N+ LDK KRQG +F+GILDIAGFEIFE NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP I+LIE+     GIL+LLDEEC+FPKATD SFVEKL+ TQ  H K  K  + +   +FS+ HYAG+VDY A  WL KNMDPLN+NV  LL  S+  FVQ +WKDA+  V L   A   +      S+T+KGM RTV QL+KESL KL++ L+NT P+FVRCIIPNHEKR  K+++ LVL+QL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL    + +GFMDGK A   ++  L++D NLY+IGQSKIFF+ GV+A LEE+RDL+I+ +II FQA +RGFLARK    R QQ+ A+++IQRN  AYLKLRNW WWRLFTKVKPLL VTRQEE +++KEEEL+K  DV  K   E  E      Q+ EE+  L  +LQ E   + +AE+ R +L+ K +E + ++ E+EA+  E++E+   L  D+ K++Q++ +L E LE EE  RQKLQLEK + E K  +L+D+   ++D+ +KLVK++K +++R+ +   +L+EEE+K+K L+KLK +HE++I+ELE +L +E  +RQ+L++ +R+LE E  +  EQL +  + + +LK +LA  E EL     +L++E   K    K++R+ EG I DL+EDL++ER AR++AEKIKRD  EE+EALKSEL DT  T+    E   KRE+E+TLL++  E EN+  E++IQE+R+KHT   E+L EQLE++ + K   E +K  LEKE ++L++E R+   AR E + KRK LE Q+ +L +R  +++K K E L  ++     +E     ++  E+ N + ++ + SL  + +D +  L++ET  KL++   LR  E++R ++ +Q +EE   +  +E+H   L  Q+   K K  E S  ++  +E  K+L R++     Q EE A+  +K+EK+K +LQ ELED     D+QR    N ++K KK +  L E     +   + R+  + + R+KETK + L   +E+ ++   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +V+E++  +E+LE+E       K RL+V +  +K  F+R+L  +++  EE ++ +IK+ ++LE EL+D++  +A    AK+KLE +++DL  +++   K +++ ++QL+K Q+   + QR+L++  A R+E+L   K+ EKK K+ + E+ +L EEL  +E+ +K A AER+E   E  S  +  +   +E++R E +   LEEELEE Q+     +D  +K + Q++   +EL  ER      E  +   E+  K+ + +L E+E  +  K+K+ ++ L+ +V Q E QLE E  +K    +  R+ DKK+KDL++Q+++ RK  E  K+Q +KA  ++ +LK +L E E+E+    A +RKL R+L++ATE+ D +  ++ SLKS+
BLAST of Myosin head vs. Ensembl Medaka
Match: ENSORLT00000000809.2 (myosin-10 [Source:NCBI gene;Acc:101154782])

HSP 1 Score: 1115.91 bits (2885), Expect = 0.000e+0
Identity = 706/1598 (44.18%), Postives = 1070/1598 (66.96%), Query Frame = 1
            ++A+ IMG + +E  C+ RV+S+V+  GN+ FK++RN+DQA++P+N+ AQK+ HLLG+ + + T+A L PRIKVGR+ V KAQTKEQA+F+ EA++KA YER+F+WLV RIN+ LD+ KRQG +FIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     GIL+LLDEEC+FPKATDK+FV+K+L+ Q  H K  K  + +   DF + HYAGRVDY A++WL KNMDPLN+NV  LL +S   FV  +WKD +  V L   A   ET FG+  +T+KGM RTV QL+KE L KL++ L NTNP+FVRCIIPNHEKR  K++  LVLDQL+CNGVLEGIRICRQG+PNRI+FQEF+QRY+IL P  + +GFMDGK A E+++ ALE+D NL++IGQSKIFF+AGV+A LEE+RDL+I+ +II FQA  RG+LARK    + QQ++A++++QRN  AYLKLR+W WWRLFTKVKPLL VTRQEE +  K+EEL K+ +   K  GE  E ++  +QL EEK  L+ +LQ E   F +AE+ R +L+ K +E + ++ +LE++  E++E+   L+ ++ K++  V DL EQL+ EE  RQKLQLEK + E K  + +++   ++D+ SK  K+KK ++DR+ E    L+EEE+K K L K+K + E ++ +LE++L +E   RQ+LE+ +R+L+ E  +  +Q+ E  S +++LK +LA  E E   +Q++ +EE   K  V KQ+R+ +  + +L+EDLE+ER AR++AEK+KRD +EE+EALK+EL DT  T+    E   KRE+E+  L+K  E E+KN E++IQE+R++H T  E+L EQLE+  + K   E +K   +    +LS E +  Q A+ E + KRK LE QL E   R  E ++ K E  E+ NKL   ++  +  ++  E    + A+ +  L+ + +D +  L +ET  KL + + +R +EEE+  +Q+Q +E+E  R  LEK    L+ Q+   K K  +D   ++  +E  KKL +++    Q+LEE     EK+EK+K +LQ EL+D +   D QR    N ++K KK +  L E     A   + R+  + + R+KETK + +   +++  E   E+ER    L  E+ DL  ++DD GKN+  LE+ K  LE +++E++  +E+LE+E       K RL+V +  +K  ++R+L  ++D  +E ++ ++K+ +++E EL+D++  +A    AK+KLE++++D+   ++   KA+++ ++QL+K Q+   + QR+L++  A RD++    K+ EKK K+ + EI +L E+L  SE+ R+ A  ER+E   E  +  +      +E++R E R   LEEELEE Q      +D  +K ++Q++   +EL  ER      E  +  AE+  K+ + +L ELE ++  ++K  ++ L+ ++ Q E QLE E  E+   +++ R+ +KK+K++ +Q+++ R++ +  K QL+KAN ++ +LK +L E E+E T   A++RKL R+L+DATE+ + L  ++ +LK+R
BLAST of Myosin head vs. Ensembl Medaka
Match: myh14 (myosin-10 [Source:NCBI gene;Acc:101160019])

HSP 1 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 717/1693 (42.35%), Postives = 1112/1693 (65.68%), Query Frame = 1
            I F   G+  GANIETYLLEK+R IRQA +ER+FHIFYQ+L   +E  +  LLLG    YRFL  G+  + G  + + F +T++++ IMG T EE   + +VIS+V+  GN+ F +++N DQA++PDN+ AQK+ HLLG+ V + T+A L PRIKVGRE V KAQTKEQA+F++EA++KA YER+F+WLV RINR LD+ +RQG +FIGILDIAGFEIF++NSFEQLCINYTNEKLQQLFNHTMF+LEQEEY++EGI W +IDFGLDLQP IDLIE+     G+L+LLDEEC+FP+ATD++FVEKL   Q  HPK  +  + R   DFS+ HYAG+VDY A  WL KNMDPLN+NV  LL +S+  FV  +WK+ +  V L   ++ E+     FG+   +T+KGM RTV QL+KESL KL++ L NTNP+F+RCIIPNHEKR  K+   LVLDQL+CNGVLEGIRICRQG+PNRI FQEF+QRY+IL P  + + FMDGK A+E +++ALE+D NL+++GQSK+FF+AGV+  LEE+RDL+I+  II+FQ+ +RGFLARK    + QQ++A+R++QRN  AYLKLRNW WWRLFTKVKPLL VTRQ+E + ++E EL+K  D L +   +++E  K   QL EEK  L+++LQ E   F +AE+ R +L+ + +E + +++ELE++  E++E+  +L  ++ +++Q + DL EQLE EE  RQ+L LEK +LE K   L  +     ++  +L K+KK +++ L+E  + L+EEE+K K L+KLK + E +I +LE++L RE   R + E+ +RR+E+E  E  EQL E   +  +L+  LA  E E+  LQ +L+EE   +A   + LR++   + +L+E++E ER  R+RAEK KRD  EE+EAL++EL DT  T+    E   +RE E+  L++  E E +  E ++ EL+ KH+T  + LQEQL+ + +       +K  LE+E N+L+ E ++ Q  R E ++ RK  E Q+ ELS R  +AD+ ++++ E+I+KL   +E  +  + S ++ + + A+++ +L+ +  D K  L DET  K+ + +  RA+E+E+  + ++ +E+E     + +  Q L  Q+   + ++ E +  ++  +E  +KL RE+ +  Q+  +     E+VE+ +++L+ E+ED + A   +R   +  +++ KK +  L+E     A + + R+  + D R+KET+ + L   +++++++  ++ER    L  E+  L   QDD GKN+  LER +  LE E Q L++  ++LEEE A     + RL+V +  +K  F+RE+   E+  EE R+ +    K LEI+L++++  R+    +K++LE E+++    ++ + ++K++ ++QL++ Q    E  R+L +    R+E++ Q KD EKK +  + ++  LTEEL  SE+ R+ A  ER++   E  +  +  N   EE++R E R   LEEELEE Q+ +    + ++K +LQ+ET   +L  ER      E  +   E+  K+ + +L ELE  +  K+K  ++ L+ ++   E QLE E  E+   +++ RK +KK+K++++Q ++ R++ +  + QLDK+  ++ +LK +L E+E+E++   A KRKL R+LE+ T+S   +  +I SL+++ R  + G+L
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 3154.77 bits (8178), Expect = 0.000e+0
Identity = 1715/1720 (99.71%), Postives = 1715/1720 (99.71%), Query Frame = 1

HSP 2 Score: 56.225 bits (134), Expect = 2.764e-7
Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 3
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 3147.84 bits (8160), Expect = 0.000e+0
Identity = 1715/1726 (99.36%), Postives = 1715/1726 (99.36%), Query Frame = 1

HSP 2 Score: 56.225 bits (134), Expect = 2.908e-7
Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 3
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 3132.04 bits (8119), Expect = 0.000e+0
Identity = 1707/1720 (99.24%), Postives = 1707/1720 (99.24%), Query Frame = 1

HSP 2 Score: 56.225 bits (134), Expect = 2.809e-7
Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 3
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 3131.66 bits (8118), Expect = 0.000e+0
Identity = 1707/1720 (99.24%), Postives = 1708/1720 (99.30%), Query Frame = 1

HSP 2 Score: 56.225 bits (134), Expect = 2.907e-7
Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 3
BLAST of Myosin head vs. Planmine SMEST
Match: SMESG000062420.1 (SMESG000062420.1)

HSP 1 Score: 1434.47 bits (3712), Expect = 0.000e+0
Identity = 861/1713 (50.26%), Postives = 1232/1713 (71.92%), Query Frame = 1
            I F   GF + ANIETYLLEKARVIRQA+ ER FH+FYQLL      +K  L+L  +S Y+ L NG  ++   DE Q F +T+EAL IMGI+ +EQE IFRVI++V+ MGN+EFKQ+R+SDQA LPDN+VAQK+AHLLGL VT+MTKA LKP++K+GRE V+KAQTKEQAEFSVEAISK+ YERMF+WLV RINR++D++ RQ TNFIGILDIAGFEIFE+NSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKE I WE+IDFGLDLQPTI+LIEK MGILSLLDEECFFPKAT K+FVEKL+K Q  HPKL   +FR+  DF V HYAG+VDYVA+ WL KNMDPLNENVV LLQ+SN  FVQ+IWKDAEN + LS T  QE+ FG    TRKGM RTV QL+KESL KL+ VLNNTNP+FVRCIIPNHEK+  KI+SKLV+DQLKCNGVLEGIRICRQG+PNRILFQEFKQRY IL P  + +GFMDG+ A E +L  L++D + Y+IGQSKIFFKAGV+A LEEDRD++++ +I+KFQ+Y+RG+LARKN Q R Q +NAI+IIQRN  AYLKLRNW WW+LFT+VKPLLSVTRQEE+VA+KEEELKK  + LEK T +F  TKK  E L EEK ++  +L++E+F  QD E ER+ L ++LK+ ++   E E++E E K+K +KLE +++KL+ E+S LS+ LESEEQ  QK Q +K S +++  +L+ + AE++DKL+KL K+KK++++RL + M+TL+EEE+K+KQL+KLK+RHET ITELE++LSRE +ARQDLE+T+RRLE EL E S+ L  ++   ++++  L   ET+++++Q KLDEE  AK++  +Q+RD+E +I +++EDLE E+ +++RAEK KRD AEEIE+LK EL DTG+TSEE    LRK+E E+   +K+ E E K  E ++QE+RKK     E L  Q+E  NK KL  E +K QL++E ND + E  N ++++ + +K +KN E QL E+S+R  E+++ K +   K+ K T + ++ A+ ++ +E+  +Q  +   S++ +  DL+    +ET  KL  Q +LR +E + A ++DQ +EE++++  LE H Q L++QMQ  K K  ED++ L + DE  KK+ RE   L  +LEE+    E+ EK+K+ +QAEL+DA HA +SQ+++   +DRK KK+E+ +NE +         ++ ++K+ R+KETKI+QL  ++   +++ +E+E  K+ L ++L++L  ++DD GKN+ SLE+ K +LE +++  ++T+E+LEEENATL M K+R+++++   K    REL  K++  +E  + + KK +D E  L++++  + ++ + K+K+E E  DL N+L  +EK KE+  RQ+KK+Q      QR++QE+ A +++ L Q+K+LEK+ +A ++ + +L+E+L QSE+ ++   +ER+EA+ E  ++  A + A  ++KR E+    L  + EELQ   +E +D  KK+  QLE  Q+EL  ER+ +  +E QK+ AE+  K+  ++++ELEM   KKYK  ++  Q+++   ++QL+ +  E NQ +R N+K ++K+K+++  + +  K  +    Q++KA  +  + +  L+  ++ N+ L    R+L RDLE+  E+++  + +I+ LK++ + L       E+  R+     G R   GD   +D LS
The following BLAST results are available for this feature:
BLAST of Myosin head vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH100.000e+045.65myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH100.000e+045.65myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH90.000e+045.30myosin heavy chain 9 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH100.000e+045.09myosin heavy chain 10 [Source:HGNC Symbol;Acc:HGNC... [more]
MYH110.000e+045.36myosin heavy chain 11 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Myosin head vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmy-10.000e+041.72Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
nmy-20.000e+037.95Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:G5... [more]
myo-50.000e+032.36MYOsin heavy chain structural genes [Source:UniPr... [more]
unc-540.000e+032.57Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+032.57Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
back to top
BLAST of Myosin head vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zip0.000e+046.48gene:FBgn0265434 transcript:FBtr0306576[more]
zip0.000e+046.48gene:FBgn0265434 transcript:FBtr0302572[more]
zip0.000e+046.48gene:FBgn0265434 transcript:FBtr0302574[more]
zip0.000e+046.48gene:FBgn0265434 transcript:FBtr0100466[more]
zip0.000e+046.48gene:FBgn0265434 transcript:FBtr0302573[more]
back to top
BLAST of Myosin head vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh11a0.000e+045.12myosin, heavy chain 11a, smooth muscle [Source:ZFI... [more]
myh100.000e+044.76myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh100.000e+044.76myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh100.000e+044.76myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myh9a0.000e+044.76myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
back to top
BLAST of Myosin head vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH90.000e+044.82myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH90.000e+044.82myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH90.000e+044.48myosin, heavy chain 9, non-muscle [Source:NCBI gen... [more]
MYH110.000e+044.29myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
MYH110.000e+044.43myosin heavy chain 11 [Source:NCBI gene;Acc:100490... [more]
back to top
BLAST of Myosin head vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh100.000e+045.48myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh100.000e+045.48myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh90.000e+044.89myosin, heavy polypeptide 9, non-muscle [Source:MG... [more]
Myh100.000e+044.91myosin, heavy polypeptide 10, non-muscle [Source:M... [more]
Myh110.000e+045.65myosin, heavy polypeptide 11, smooth muscle [Sourc... [more]
back to top
BLAST of Myosin head vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99323|MYSN_DROME0.000e+046.48Myosin heavy chain, non-muscle OS=Drosophila melan... [more]
sp|P35580|MYH10_HUMAN0.000e+045.65Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV... [more]
sp|Q9JLT0|MYH10_RAT0.000e+045.42Myosin-10 OS=Rattus norvegicus OX=10116 GN=Myh10 P... [more]
sp|Q61879|MYH10_MOUSE0.000e+045.48Myosin-10 OS=Mus musculus OX=10090 GN=Myh10 PE=1 S... [more]
sp|Q8VDD5|MYH9_MOUSE0.000e+044.89Myosin-9 OS=Mus musculus OX=10090 GN=Myh9 PE=1 SV=... [more]
back to top
BLAST of Myosin head vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y5H60.000e+050.06Myosin heavy chain non muscle OS=Echinococcus mult... [more]
A0A4E0RIV70.000e+048.74Non-muscle myosin II heavy chain OS=Fasciola hepat... [more]
A0A504Y9W60.000e+048.74Non-muscle myosin II heavy chain OS=Fasciola gigan... [more]
A0A4S2LML20.000e+049.49Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LP740.000e+049.55Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Myosin head vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh11a0.000e+044.91myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a0.000e+045.24myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a0.000e+045.24myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11a0.000e+046.47myosin-11-like [Source:NCBI gene;Acc:103025732][more]
myh11b0.000e+043.10myosin, heavy chain 11b, smooth muscle [Source:ZFI... [more]
back to top
BLAST of Myosin head vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh100.000e+057.12myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
ENSPMAT00000002731.10.000e+034.10pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
ENSPMAT00000005582.10.000e+033.29pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 ... [more]
ENSPMAT00000003821.10.000e+032.52pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 g... [more]
ENSPMAT00000004078.10.000e+042.70pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 g... [more]
back to top
BLAST of Myosin head vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO12.065e-15145.34Type II myosin heavy chain; required for wild-type... [more]
MYO22.077e-10038.79Type V myosin motor involved in actin-based transp... [more]
MYO41.760e-9638.65Type V myosin motor involved in actin-based transp... [more]
MYO53.047e-6831.66One of two type I myosin motors; contains proline-... [more]
MYO31.234e-6331.14One of two type I myosins; localizes to actin cort... [more]
back to top
BLAST of Myosin head vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418191.764e-10237.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447856.192e-9135.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319244.013e-8436.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350072.418e-8333.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455632.378e-8133.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin head vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh9b0.000e+045.29myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh9b0.000e+045.29myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh11a0.000e+045.37myosin heavy chain 11 [Source:NCBI gene;Acc:101164... [more]
ENSORLT00000000809.20.000e+044.18myosin-10 [Source:NCBI gene;Acc:101154782][more]
myh140.000e+042.35myosin-10 [Source:NCBI gene;Acc:101160019][more]
back to top
BLAST of Myosin head vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30034967 ID=SMED30034967|Name=Myosin head|organism=Schmidtea mediterranea sexual|type=transcript|length=5512bp
back to top

protein sequence of SMED30034967-orf-1

>SMED30034967-orf-1 ID=SMED30034967-orf-1|Name=SMED30034967-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1728bp
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
GO:0051015actin filament binding
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
Vocabulary: cellular component
GO:0016459myosin complex
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1139..1320
NoneNo IPR availableCOILSCoilCoilcoord: 865..906
NoneNo IPR availableCOILSCoilCoilcoord: 1364..1405
NoneNo IPR availableCOILSCoilCoilcoord: 1083..1124
NoneNo IPR availableCOILSCoilCoilcoord: 1603..1686
NoneNo IPR availableCOILSCoilCoilcoord: 760..850
NoneNo IPR availableCOILSCoilCoilcoord: 1413..1447
NoneNo IPR availableCOILSCoilCoilcoord: 918..1026
NoneNo IPR availableCOILSCoilCoilcoord: 1325..1345
NoneNo IPR availableCOILSCoilCoilcoord: 1041..1075
NoneNo IPR availableCOILSCoilCoilcoord: 1462..1595
NoneNo IPR availableCOILSCoilCoilcoord: 599..752
NoneNo IPR availableGENE3DG3DSA: 98..224
e-value: 7.0E-42
score: 144.4
NoneNo IPR availableGENE3DG3DSA: 595..720
e-value: 3.0E-7
score: 32.5
NoneNo IPR availableGENE3DG3DSA: 225..374
e-value: 1.5E-57
score: 195.8
NoneNo IPR availableGENE3DG3DSA: 467..536
e-value: 1.2E-24
score: 88.2
NoneNo IPR availableGENE3DG3DSA: 39..93
e-value: 5.8E-17
score: 63.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1694..1713
NoneNo IPR availablePANTHERPTHR45615FAMILY NOT NAMEDcoord: 13..1680
NoneNo IPR availablePANTHERPTHR45615:SF16MYOSIN-9coord: 13..1680
NoneNo IPR availableCDDcd01377MYSc_class_IIcoord: 12..523
e-value: 0.0
score: 882.956
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 1273..1386
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 1510..1697
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 595..720
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 993..1110
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 710..826
IPR001609Myosin head, motor domainPRINTSPR00193MYOSINHEAVYcoord: 267..295
score: 45.03
coord: 213..241
score: 79.83
IPR001609Myosin head, motor domainSMARTSM00242MYSc_2acoord: 1..536
e-value: 1.3E-201
score: 685.7
IPR001609Myosin head, motor domainPFAMPF00063Myosin_headcoord: 12..523
e-value: 1.2E-205
score: 684.7
IPR001609Myosin head, motor domainPROSITEPS51456MYOSIN_MOTORcoord: 1..535
score: 187.934
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 537..559
e-value: 0.005
score: 26.1
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 538..567
score: 8.334
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 394..466
e-value: 4.1E-15
score: 57.6
IPR027401Myosin IQ motif-containing domain superfamilyGENE3DG3DSA: 537..594
e-value: 2.1E-24
score: 87.4
IPR002928Myosin tailPFAMPF01576Myosin_tail_1coord: 600..1679
e-value: 1.3E-216
score: 721.9
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 12..597