Dual specificity protein phosphatase 10

Overview
NameDual specificity protein phosphatase 10
Smed IDSMED30034946
Length (bp)1494
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity protein phosphatase 10 (SMED30034946) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 10 (SMED30034946) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity protein phosphatase 10 (SMED30034946) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 10 (SMED30034946) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034946

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30034946SMESG000035381.1 SmedASXL_019457SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30034946SMESG000035381.1 dd_Smed_v4_4619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30034946SMESG000035381.1 dd_Smed_v4_4619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034946SMESG000035381.1 dd_Smed_v4_4619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034946SMESG000035381.1 dd_Smed_v4_4619_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034946SMESG000035381.1 dd_Smed_v4_4619_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30034946SMESG000035381.1 dd_Smed_v4_4619_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP10 (dual specificity phosphatase 10 [Source:HGNC Symbol;Acc:HGNC:3065])

HSP 1 Score: 149.828 bits (377), Expect = 3.870e-39
Identity = 106/298 (35.57%), Postives = 156/298 (52.35%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTE-FGLPFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE-----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK--FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NC+ K+  RR  Q    +L              I    I++Y E    P +     P+ ++++ L       L L      F+  + NLC+            G ++     +P+ +P   DI   + + ILPFL+LGNE DA +   +    I +V+NVT         K  F  KR+  TD+N Q+L Q+F +AF+FIE A +    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE DL NG   R
Sbjct:  173 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR 469          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP1 (dual specificity phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:3064])

HSP 1 Score: 140.969 bits (354), Expect = 8.851e-37
Identity = 98/311 (31.51%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  446 KIDKIESAELEKLISTDCS-VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDL---------HRIVLYTEFGLPF---KQDDPITVLIQFLI--GRSINCLYLTDSFKKFETTYPNLCESGSSNV-LCLHIPKSVPDF---------TDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            ++  +++  L  L+    +  ++LD RS + F+  HI  +     S+ ++ R    +  E +  + +L         H +VL  E        K+D  + +    L    R+    +L   ++ F  + P LC   S+ + L L +  SVPD          T +Y     + ILPFLYLG+   A     L    IT ++NV+       E  ++ K I   DN+  D+  +F +A  FI+  + + GR+ VHCQAGISRSATI +AYLM   + + L+ A ++VK+RR+IISPNF+FMGQL+QFE+ ++
Sbjct:    4 EVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLM-RTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVL 313          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP16 (dual specificity phosphatase 16 [Source:HGNC Symbol;Acc:HGNC:17909])

HSP 1 Score: 138.658 bits (348), Expect = 2.068e-34
Identity = 98/285 (34.39%), Postives = 150/285 (52.63%), Query Frame = 2
Query:  503 VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRA------IQIVNEILKTSIDL---HRIVLYTEFG---LPFKQDDPITVLIQFLIGRSINCLYL-TDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGT 1309
            V+++D R    ++  HI  A   NCS  MK R         +++    K  +D+    ++V+Y +          D  +TVL+  L  +S N ++L    F +F   +P LCE G S ++   I +      +I  T+   ILP LYLG + D LN   +  N I +VLN +    K  F+ E  F   R+   D+  + ++ +   +  FIE A+ SNG +LVHC AGISRSATI IAY+M    ++ L+ A+++VK +R  ISPNFNF+GQL+ +E  + N T
Sbjct:   26 VLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKL-EKSFNSVHLLAGGFAEFSRCFPGLCE-GKSTLVPTCISQPCLPVANIGPTR---ILPNLYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHFL--RVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRM-DMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKNQT 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP16 (dual specificity phosphatase 16 [Source:HGNC Symbol;Acc:HGNC:17909])

HSP 1 Score: 138.658 bits (348), Expect = 2.068e-34
Identity = 98/285 (34.39%), Postives = 150/285 (52.63%), Query Frame = 2
Query:  503 VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRA------IQIVNEILKTSIDL---HRIVLYTEFG---LPFKQDDPITVLIQFLIGRSINCLYL-TDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGT 1309
            V+++D R    ++  HI  A   NCS  MK R         +++    K  +D+    ++V+Y +          D  +TVL+  L  +S N ++L    F +F   +P LCE G S ++   I +      +I  T+   ILP LYLG + D LN   +  N I +VLN +    K  F+ E  F   R+   D+  + ++ +   +  FIE A+ SNG +LVHC AGISRSATI IAY+M    ++ L+ A+++VK +R  ISPNFNF+GQL+ +E  + N T
Sbjct:   26 VLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKL-EKSFNSVHLLAGGFAEFSRCFPGLCE-GKSTLVPTCISQPCLPVANIGPTR---ILPNLYLGCQRDVLNKELMQQNGIGYVLNASNTCPKPDFIPESHFL--RVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLVHCLAGISRSATIAIAYIMKRM-DMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKNQT 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Match: DUSP2 (dual specificity phosphatase 2 [Source:HGNC Symbol;Acc:HGNC:3068])

HSP 1 Score: 131.724 bits (330), Expect = 5.500e-34
Identity = 92/291 (31.62%), Postives = 142/291 (48.80%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRR--------AIQIVNEILKTSI---DLHRIVLYTEFGL---PFKQDDPITVLIQFLI----GRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASL--------ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            ++LD R    F + H+  A+    ++ ++ R         A  + +  L+T +   +L R V+  E        + D P  VL+  L+           +L   F  F+   P+LC    +  L         D T    ++A +        ILP+L+LG+   + +   L    IT VLNV+       E  F+ K I   DN + ++  +F +A  FI+  + S GR+LVHCQAGISRSATI +AYLM     + L+ A  +VK+RR +ISPNF+FMGQL+QFE  ++
Sbjct:   28 LLLDCRPFLAFCRRHVRAARPVPWNALLRRRARGPPAAVLACLLPDRALRTRLVRGELARAVVLDEGSASVAELRPDSPAHVLLAALLHETRAGPTAVYFLRGGFDGFQGCCPDLCSEAPAPAL-----PPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQS-RRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVL 312          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 128.257 bits (321), Expect = 1.441e-31
Identity = 72/190 (37.89%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  746 LYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSV--PDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTI---KASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            + L   FK+F   YP LCES         +P+S+  P  +       +LI P +YLG+++D+L+ T L    I+ V+N+++   K+  + E K    RI   D+  + L  +FP A++F+E  R++  + L+HC AGISRS T+ I+Y+M +   +  ++A+++VK RR  ISPNFNFMGQL+++EN LI
Sbjct:   62 MVLEGGFKQFAQQYPQLCESSEGMT---RLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDK-NFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYM-KMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLI 246          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 128.257 bits (321), Expect = 1.441e-31
Identity = 72/190 (37.89%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  746 LYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSV--PDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTI---KASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            + L   FK+F   YP LCES         +P+S+  P  +       +LI P +YLG+++D+L+ T L    I+ V+N+++   K+  + E K    RI   D+  + L  +FP A++F+E  R++  + L+HC AGISRS T+ I+Y+M +   +  ++A+++VK RR  ISPNFNFMGQL+++EN LI
Sbjct:   62 MVLEGGFKQFAQQYPQLCESSEGMT---RLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDK-NFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYM-KMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLI 246          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 127.872 bits (320), Expect = 2.871e-31
Identity = 72/190 (37.89%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  746 LYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSV--PDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTI---KASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            + L   FK+F   YP LCES         +P+S+  P  +       +LI P +YLG+++D+L+ T L    I+ V+N+++   K+  + E K    RI   D+  + L  +FP A++F+E  R++  + L+HC AGISRS T+ I+Y+M +   +  ++A+++VK RR  ISPNFNFMGQL+++EN LI
Sbjct:  137 MVLEGGFKQFAQQYPQLCESSEGMT---RLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDK-NFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYM-KMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLI 321          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 127.872 bits (320), Expect = 2.871e-31
Identity = 72/190 (37.89%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  746 LYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSV--PDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTI---KASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            + L   FK+F   YP LCES         +P+S+  P  +       +LI P +YLG+++D+L+ T L    I+ V+N+++   K+  + E K    RI   D+  + L  +FP A++F+E  R++  + L+HC AGISRS T+ I+Y+M +   +  ++A+++VK RR  ISPNFNFMGQL+++EN LI
Sbjct:  137 MVLEGGFKQFAQQYPQLCESSEGMT---RLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDK-NFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYM-KMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLI 321          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 127.872 bits (320), Expect = 2.989e-31
Identity = 72/190 (37.89%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  746 LYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSV--PDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTI---KASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            + L   FK+F   YP LCES         +P+S+  P  +       +LI P +YLG+++D+L+ T L    I+ V+N+++   K+  + E K    RI   D+  + L  +FP A++F+E  R++  + L+HC AGISRS T+ I+Y+M +   +  ++A+++VK RR  ISPNFNFMGQL+++EN LI
Sbjct:  133 MVLEGGFKQFAQQYPQLCESSEGMT---RLPQSLSQPCLSQPTGDGITLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDK-NFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYM-KMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLI 317          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0339722)

HSP 1 Score: 119.013 bits (297), Expect = 3.173e-29
Identity = 67/152 (44.08%), Postives = 93/152 (61.18%), Query Frame = 2
Query:  842 SVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            S P   DI    AS + P L LGN  DA + + +  N + +V   +   S L  +K+   +I  +D   Q++ Q+F +A+ FIE ARK+  R+L+HC AGISRSATI IAY+M + S L L  A++ VK  R IISPN NFMGQL++ E +L
Sbjct:   15 SSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQSPNESHLQGLKYM--QIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKS-LSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 163          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0081792)

HSP 1 Score: 118.242 bits (295), Expect = 2.453e-28
Identity = 67/152 (44.08%), Postives = 93/152 (61.18%), Query Frame = 2
Query:  842 SVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            S P   DI    AS + P L LGN  DA + + +  N + +V   +   S L  +K+   +I  +D   Q++ Q+F +A+ FIE ARK+  R+L+HC AGISRSATI IAY+M + S L L  A++ VK  R IISPN NFMGQL++ E +L
Sbjct:  122 SSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQSPNESHLQGLKYM--QIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKS-LSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL 270          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075036)

HSP 1 Score: 109.768 bits (273), Expect = 4.466e-27
Identity = 62/140 (44.29%), Postives = 85/140 (60.71%), Query Frame = 2
Query:  884 LILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +I   L+LGN   + +S  L    I +VLNVT  +   F +    K  +I  TD+  QDL   FPDA +FIE AR ++  +LVHC AG+SRS T+ +AYLM H   L LN+A   V+ R+  +SPNF+FM QL+ FE+ L
Sbjct:   48 IIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLM-HTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 186          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0333220)

HSP 1 Score: 108.997 bits (271), Expect = 1.415e-25
Identity = 62/140 (44.29%), Postives = 85/140 (60.71%), Query Frame = 2
Query:  884 LILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +I   L+LGN   + +S  L    I +VLNVT  +   F +    K  +I  TD+  QDL   FPDA +FIE AR ++  +LVHC AG+SRS T+ +AYLM H   L LN+A   V+ R+  +SPNF+FM QL+ FE+ L
Sbjct:  218 IIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLM-HTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 356          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Match: Mkp3 (gene:FBgn0036844 transcript:FBtr0075035)

HSP 1 Score: 108.997 bits (271), Expect = 1.415e-25
Identity = 62/140 (44.29%), Postives = 85/140 (60.71%), Query Frame = 2
Query:  884 LILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +I   L+LGN   + +S  L    I +VLNVT  +   F +    K  +I  TD+  QDL   FPDA +FIE AR ++  +LVHC AG+SRS T+ +AYLM H   L LN+A   V+ R+  +SPNF+FM QL+ FE+ L
Sbjct:  218 IIPGLLFLGNATHSCDSEALKKYNIKYVLNVTPDLPNKFKESGDIKYLQIPITDHYSQDLAIHFPDAIQFIEEARSASSVVLVHCLAGVSRSVTVTLAYLM-HTRGLSLNDAFAMVRDRKPDVSPNFHFMQQLLSFESQL 356          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 162.155 bits (409), Expect = 5.843e-44
Identity = 126/344 (36.63%), Postives = 180/344 (52.33%), Query Frame = 2
Query:  389 KSSSLHTISTSIPDSELNNKIDKIESAELEKLISTDCSV--------IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEIL-----KTSIDLHR------IVLYTEFGL-PFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE---------SGSSNV-LCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFL--DEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +  S+H  + S+  S     +  I   EL K + T C +        +I+D R    F+K HI  A   NCS K+  RR  Q    +L     + S D  +      +V+Y E  + P +     P+ V+++ L     + + L      F  T+ +LCE          GS  + L   +P S+P   DI   + + +LPFLYLGNE DA +   L    I  VLNVT        D  +F  KR+  TD+N Q+L Q+F +AF+FIE A ++   +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK RR IISPN NFMGQL++FE DL NG   R
Sbjct:  105 QQGSVHGSAPSLTSSLTRGGMRVIHPNELAKKL-THCPLGHPIGPVPVIIDCRPFLEFNKSHIRGAMHINCSDKISRRRLQQGKITVLDLISCRQSKDSFKGIFSKELVVYDESTVDPGRLTPSQPLHVVLESLRREGKDPIVLKGGLSGFRQTHADLCEHSLHLDEGQDGSGAMGLSGALPHSLPSTPDIENAELTAVLPFLYLGNERDAQDLELLQRLDIGFVLNVTTHLPLYHYDIARFCYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAYLMKH-TWMTMTDAYKFVKSRRPIISPNLNFMGQLLEFEEDLNNGITPR 446          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp2 (dual specificity phosphatase 2 [Source:ZFIN;Acc:ZDB-GENE-040801-188])

HSP 1 Score: 140.584 bits (353), Expect = 3.240e-37
Identity = 106/313 (33.87%), Postives = 157/313 (50.16%), Query Frame = 2
Query:  455 KIESAELEKLISTDCSV------IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVN-EILKT---------SIDLHRIVLYTEFGLP---FKQDDPITVLIQFLIGR----SINCLYLTDSFKKFETTYPNLCESGSSNVLC-----LHIPKSVPDF--TDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            +I  +EL +++ T   +      I+LD R    FS+ HI  ++  N +S ++ R    +V+ E L           + D   +V+  E        K +   ++LI  L       S +  +L   F  F   YP LC +  + VLC     L  P+ V     T +Y     + ILPFL+LG+   +     L  N IT VLNV+     L E + + K +   D+   D+   FP+A  FI+  ++  GR+LVHCQAGISRSATI +AYL+ H   + L+ A  +VKRRR +ISPN  FMGQL+QFE D++
Sbjct:    8 EISGSELVQILRTPSELFASGGCIVLDCRPFLGFSRAHILESRNVNWNSMLRRRSKSSVVSLEWLVADKSLLAQLRNGDFSPVVVLDENSRSVRDLKSESLASLLISALQSEVQSASTHICFLQGGFDGFFALYPELCFTAPA-VLCSNHSTLSEPEPVMSGRKTPLYDQGGPVEILPFLFLGSAHHSSRRETLERNGITAVLNVSSSCPNLFEEELQYKTLKVEDSLAADIRVLFPEAIHFIDSIKEGGGRVLVHCQAGISRSATICLAYLI-HAQRVRLDEAFDFVKRRRQVISPNLAFMGQLLQFETDVL 318          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp8a (dual specificity phosphatase 8a [Source:ZFIN;Acc:ZDB-GENE-040426-1842])

HSP 1 Score: 142.51 bits (358), Expect = 4.904e-36
Identity = 102/283 (36.04%), Postives = 149/283 (52.65%), Query Frame = 2
Query:  503 VIILDLR--SAYNFSKMHITTAKLANCSSKMKSRRAIQ---IVNEIL----KTSIDLHR---IVLY---TEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            ++++D R  S YN S +H     +  C SK+  RR  Q    V E+L    K  +DL R   +V+Y   T+      +D  + +L+  L         LT  F  F + +P LCE      L + + +      ++  T+   ILP LYLG++ D LN   +  N IT+VLN +    K  F+ E  F   RI   DN  + L+ +     +FI+ A+ SN R++VHC AGISRSATI IAY+M     L  ++A+++VK RR  ISPNFNF+GQL++FE  L
Sbjct:   27 LLVIDSRTFSEYNASHVH---GAINVCCSKLVKRRLQQDKVSVTELLQPNGKVKVDLGRRQEVVVYDQSTKDTGQLSKDSFVHILLSKLDSTFHRVSLLTGGFAAFSSCFPGLCEGKPVATLPMSLSQPCLPVANVGPTR---ILPHLYLGSQKDVLNKDLMAQNGITYVLNASNTCPKPEFISESHFM--RIPVNDNYCEKLLPWLDKTNEFIDKAKVSNCRVIVHCLAGISRSATIAIAYIMK-TMGLSSDDAYRFVKDRRPSISPNFNFLGQLLEFEKGL 300          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 136.346 bits (342), Expect = 2.454e-35
Identity = 110/328 (33.54%), Postives = 154/328 (46.95%), Query Frame = 2
Query:  461 ESAEL--EKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSR--RAIQIVNEILKTSIDLHRIV---------LYTEFGLPFKQDDP----ITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESG----------SSNVLCLHIPKSVPDFTDIYFTKAS--------------------LILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +SAE   E L +   S+++LD R    F   HI +A        M  R  +    +  I+  + D  + V         LY E    + +       + +L+Q L        YL   F KF+T YP  CE+            S+VL L   +   D +D    +                       ILP+LYLG   D+ N   L    I ++LNVT  +   F  + +FK K+I  +D+  Q+L QFFP+A  FI+ AR     ILVHC AGISRS T+ +AYLM    NL LN+A+ +VKR+++ ISPNFNFMGQL+ FE  L
Sbjct:    4 KSAEWLQEDLQAGGGSLLLLDCRPHELFESSHIESAINLAIPGLMLRRLKKGNLPIRSIIPNNEDKEKFVKRCKTDTVLLYDEATAAWPESGSAGSVLGLLMQKLRDDGCKAFYLEGGFNKFQTEYPEHCETNLDCSCPSSSPPSSVLGLGGLRISSDCSDGESDREPGSATESEGSPLPNNQPAFPVQILPYLYLGCAKDSTNLDVLGKYNIKYILNVTPNLPNMFEHDGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSQKCGILVHCLAGISRSVTVTVAYLMQKL-NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL 330          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 136.346 bits (342), Expect = 2.665e-35
Identity = 110/328 (33.54%), Postives = 154/328 (46.95%), Query Frame = 2
Query:  461 ESAEL--EKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSR--RAIQIVNEILKTSIDLHRIV---------LYTEFGLPFKQDDP----ITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESG----------SSNVLCLHIPKSVPDFTDIYFTKAS--------------------LILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +SAE   E L +   S+++LD R    F   HI +A        M  R  +    +  I+  + D  + V         LY E    + +       + +L+Q L        YL   F KF+T YP  CE+            S+VL L   +   D +D    +                       ILP+LYLG   D+ N   L    I ++LNVT  +   F  + +FK K+I  +D+  Q+L QFFP+A  FI+ AR     ILVHC AGISRS T+ +AYLM    NL LN+A+ +VKR+++ ISPNFNFMGQL+ FE  L
Sbjct:   14 KSAEWLQEDLQAGGGSLLLLDCRPHELFESSHIESAINLAIPGLMLRRLKKGNLPIRSIIPNNEDKEKFVKRCKTDTVLLYDEATAAWPESGSAGSVLGLLMQKLRDDGCKAFYLEGGFNKFQTEYPEHCETNLDCSCPSSSPPSSVLGLGGLRISSDCSDGESDREPGSATESEGSPLPNNQPAFPVQILPYLYLGCAKDSTNLDVLGKYNIKYILNVTPNLPNMFEHDGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSQKCGILVHCLAGISRSVTVTVAYLMQKL-NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL 340          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: npc1l1 (NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011])

HSP 1 Score: 161.384 bits (407), Expect = 1.484e-43
Identity = 86/219 (39.27%), Postives = 130/219 (59.36%), Query Frame = 2
Query:  698 PITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK--FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            P+  +++ L       L L      F+  + +LC+           G ++ + + +P+S+P   DI   + + ILPFLYLGNE DA +   +    I++++NVT         K  F  KR+  TD+N Q+L Q+F +AF+FI+ A +    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE DL NG   R
Sbjct:  234 PLHTVLESLKREGKEPLVLKGGLSSFKQNHESLCDNSLQLQDCSDGGGASAVSITLPQSIPTTPDIENAELTPILPFLYLGNEHDAQDLETMQTRNISYIVNVTTHLPLYHYEKGVFNYKRLPATDSNKQNLRQYFEEAFEFIDEAHQCGKALLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGITPR 451          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: dusp8 (dual specificity phosphatase 8 [Source:NCBI gene;Acc:100036671])

HSP 1 Score: 146.362 bits (368), Expect = 8.958e-38
Identity = 92/288 (31.94%), Postives = 158/288 (54.86%), Query Frame = 2
Query:  458 IESAELEKLISTDC-SVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEIL----KTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +++ +L  ++  D   V+++D RS   ++ +H+    +  C SK+  +R   ++ E+L       ID  ++V+Y +          +++++  L  +  +   L   F +F + +P LCE  +SN+L   I +     + +  T+   ILP LYLG++ D +N   +  N ITHVLNV+    +  F+ +  F   RI   D+  + ++ +   A +FIE     NG++LVHC AGISRSA + IAY+M     L L++A+++VK +R  ISPNFNF+GQL++FE  L
Sbjct:   11 MQAQKLAGILREDSEGVLVIDCRSFTEYNNLHVV-GSVNLCGSKLARKR---LLKEMLVLPQHPKIDEKQVVVYDQGNQESSAGHFVSLVLGKLEKKYSSVSLLEGGFAEFSSQFPTLCEGRTSNILHTSISQPCLSTSSVSVTR---ILPHLYLGSQNDVMNQEVINQNGITHVLNVSHSCPQPVFIPDNHFL--RIPINDSYCEKILPWLTAAVEFIEKVELVNGKVLVHCLAGISRSAAVAIAYIM-RSMGLSLDDAYRFVKEKRPSISPNFNFLGQLLEFEKSL 288          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: eci1 (enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB-GENE-999272])

HSP 1 Score: 140.969 bits (354), Expect = 6.298e-37
Identity = 106/315 (33.65%), Postives = 148/315 (46.98%), Query Frame = 2
Query:  500 SVIILDLRSAYNFSKMHITTAKLANCSSKM--KSRRAIQIVNEILKTSIDLHR---------IVLYTEFGLPFKQDDPITVLIQFLIG--RSINC--LYLTDSFKKFETTYPNLCESGSSNVLCLHIP--------------------------------KSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            SV++LD R    +   HI  A        M  + R+    +  I+    D  R         ++LY E    ++++     ++  L+   R   C   YL   + KF+  YP  CE+G  NV C + P                                +  P  T    T    ILP+LYLG   D+ N   L    I ++LNVT  +   F    +FK K+I  +D+  Q+L QFFP+A  FI+ AR  N  ILVHC AGISRS T+ +AYLM    NL LN+A+ +VKR+++ ISPNFNFMGQL+ FE  L
Sbjct:   22 SVLLLDCRPHDRYQSSHIEAAISLTIPGLMLRRLRKGNLSIRSIIPNDRDKERFAGRCNADTVLLYDEATQDWQENGSPGSVLPLLLNKLREEGCRAYYLKGGYTKFQREYPEHCETGLDNV-CPNEPAPEKVLGLGSLRINSECSDGESDREPSSATESEGSPTLTS-QSTFPVQILPYLYLGCAKDSANLDILAKYNIKYILNVTPNLPNMFEHNGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSKNCGILVHCLAGISRSVTVTVAYLMQKL-NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL 333          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: pnpt1 (polyribonucleotide nucleotidyltransferase 1 [Source:Xenbase;Acc:XB-GENE-967251])

HSP 1 Score: 143.28 bits (360), Expect = 3.609e-36
Identity = 102/304 (33.55%), Postives = 158/304 (51.97%), Query Frame = 2
Query:  503 VIILDLRSAYNFSKMHITTAKLANCSSKMKSR------RAIQIVNEILKTSIDL----HRIVLYTEFGLPFKQDDPITVLIQFLIGRSI----NCLYLTDSFKKFETTYPNLCESGSSNV-LCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR---CNV-LNLDLIT 1348
            V+++D R    F+  HI  A   NCS  MK R      + ++++    K +++L     ++V+Y +  +      P    +  L+G+      N   L+  F +F   +P LCE  +S V  C+  P  +P    +     + ILP LYLG + D LN   +  N+I +VLN +    K  F+ +  F   RI   D+  + ++ +   +  FIE A+ SN R+LVHC AGISRSATI IAY+M    ++ L+ A+++VK +R  ISPNFNF+GQL+ FE  +   T +    C + L LDL T
Sbjct:   27 VLLIDSRPFVEFNTAHILEAININCSKLMKRRLQQDKVQIVELIQHSAKQTVELDCQAQQVVVYDQSSVDVSAL-PAECFLSVLLGKLDKLFHNVQLLSGGFSEFSACFPGLCEGKASMVPTCISQP-CLP----VSSVGPTRILPHLYLGCQRDVLNKELMQQNEIGYVLNASNTCPKPDFISDSHFL--RIPVNDSFCEKILPWLDKSVDFIEKAKASNDRVLVHCLAGISRSATIAIAYIMKRM-DMSLDEAYRFVKEKRPTISPNFNFLGQLLDFEKKIKAQTGQAAPPCKLKLQLDLST 321          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Match: ENSXETT00000037206.1 (dual specificity phosphatase 10, gene 2 [Source:NCBI gene;Acc:100493077])

HSP 1 Score: 132.494 bits (332), Expect = 1.969e-33
Identity = 80/167 (47.90%), Postives = 110/167 (65.87%), Query Frame = 2
Query:  842 SVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASF--LDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNL 1336
            + P   D+   + S ILPFL+LGNE DA +   + N  I HVLNVT       ++    + KR+  TDN+ QDL Q+F +AF+FIE A++    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE+DL  G   R  V  L
Sbjct:  247 AAPLSPDLEKAELSSILPFLFLGNEKDAQDLNRMVNLNIGHVLNVTTHLPLYHVESGALRYKRLPATDNSKQDLRQYFEEAFEFIEEAQQEGKGVLIHCQAGVSRSATIVIAYLMKH-TLMTVGDAYKFVKGKRPIISPNLNFMGQLLEFESDLNAGVTPRILVPKL 412          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp10 (dual specificity phosphatase 10 [Source:MGI Symbol;Acc:MGI:1927070])

HSP 1 Score: 152.525 bits (384), Expect = 2.710e-40
Identity = 108/298 (36.24%), Postives = 157/298 (52.68%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTE-FGLPFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE-----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK--FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NC+ K+  RR  Q    +L              I    I++Y E    P +     P+ ++++ L       L L      F+  + NLC+            G ++     +P+SVP   DI   + + ILPFL+LGNE DA +   +    I +V+NVT         K  F  KR+  TD+N Q+L Q+F +AF+FIE A +    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE DL NG   R
Sbjct:  174 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHGNLCDNSLQLQECREVGGGASAASSMLPQSVPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR 470          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp1 (dual specificity phosphatase 1 [Source:MGI Symbol;Acc:MGI:105120])

HSP 1 Score: 136.346 bits (342), Expect = 2.464e-35
Identity = 98/311 (31.51%), Postives = 156/311 (50.16%), Query Frame = 2
Query:  446 KIDKIESAELEKLISTDCS-VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDL---------HRIVLYTEFGLPF---KQDDPITVLIQFLI--GRSINCLYLTDSFKKFETTYPNLCESGSSNV-LCLHIPKSVPDF---------TDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            ++  +++  L  L+    +  ++LD RS + F+  HI  +     S+ ++ R    +  E +  + +L         H +VL  E        K+D  + +    L    RS    +L   ++ F  + P LC   S+   L L +  SVPD          T +Y     + IL FLYLG+   A     L    IT ++NV+       E  ++ K I   DN+  D+  +F +A  FI+  + + GR+ VHCQAGISRSATI +AYLM   + + L+ A ++VK+RR+IISPNF+FMGQL+QFE+ ++
Sbjct:    4 EVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFFLQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLM-RTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVL 313          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp16 (dual specificity phosphatase 16 [Source:MGI Symbol;Acc:MGI:1917936])

HSP 1 Score: 140.198 bits (352), Expect = 4.199e-35
Identity = 102/300 (34.00%), Postives = 156/300 (52.00%), Query Frame = 2
Query:  503 VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRA------IQIVNEILKTSIDL---HRIVLYTEFGL---PFKQDDPITVLIQFLIGRSINCLYL-TDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLIN-----GTFKRCNVLNLD 1339
            V+++D R    ++  HI  A   NCS  MK R         +++    K  +D+    ++V+Y +          D  +TVL+  L  RS N ++L    F +F   +P LCE G S ++   I +      +I  T+   ILP LYLG + D LN   +  N I +VLN +    K  F+ E  F   R+   D+  + ++ +   +  FIE A+ SNG +L+HC AGISRSATI IAY+M    ++ L+ A+++VK +R  ISPNFNFMGQL+ +E  + N     G   +  +L+LD
Sbjct:   26 VLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHKVDIDCNQKVVVYDQSSQDVGSLSSDCFLTVLLGKL-ERSFNSVHLLAGGFAEFSRCFPGLCE-GKSTLVPTCISQPCLPVANIGPTR---ILPNLYLGCQRDVLNKDLMQQNGIGYVLNASNTCPKPDFIPESHFL--RVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLIHCLAGISRSATIAIAYIMKRM-DMSLDEAYRFVKEKRPTISPNFNFMGQLMDYEKTINNQTGMSGPKSKLKLLHLD 317          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp7 (dual specificity phosphatase 7 [Source:MGI Symbol;Acc:MGI:2387100])

HSP 1 Score: 133.65 bits (335), Expect = 6.237e-34
Identity = 105/318 (33.02%), Postives = 152/318 (47.80%), Query Frame = 2
Query:  497 CSVIILDLRSAYNFSKMHITTAKLANCSSKM--KSRRAIQIVNEILKTSIDLHR---------IVLYTEFGLPFKQDDP------ITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESG-----------SSNVLCL----------------HIPKSV--PDFTDIYFTKASL---ILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
             S+++LD R    F   HI TA        M  + R+    +  I+    D  R         ++LY E    + Q +P      + +L+Q L        YL   F KF+T Y   CE+             ++VL L                 +P S    D + +  ++ +    ILP+LYLG   D+ N   L    I ++LNVT  +  +F    +F  K+I  +D+  Q+L QFFP+A  FI+ AR     +LVHC AGISRS T+ +AYLM    NL LN+A+ +VKR+++ ISPNFNFMGQL+ FE  L
Sbjct:   73 ASLLLLDCRPHELFESSHIETAINLAIPGLMLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEATAEW-QPEPGAPASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSGSPPTSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKM-NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL 388          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Match: Dusp8 (dual specificity phosphatase 8 [Source:MGI Symbol;Acc:MGI:106626])

HSP 1 Score: 135.961 bits (341), Expect = 1.097e-33
Identity = 89/280 (31.79%), Postives = 150/280 (53.57%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQ-------IVNEILKTSIDL---HRIVLY---TEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +++D RS   ++  H+ ++ +  C SK+  RR  Q       ++    ++ +D      +V+Y   T        D  +++L+  L G   +   LT  F  F + +P LCE   + +  + + +       +  T+   ILP LYLG++ D LN   +T N I++VLN +    K  F+ E +F   RI   DN  + L+ +   + +FI+ A+ S+ +++VHC AGISRSATI IAY+M     +  ++A+++VK RR  ISPNFNF+GQL+++E  L
Sbjct:   28 LVIDSRSFVEYNSCHVLSS-VNICCSKLVKRRLQQGKVTIAELIQPATRSQVDATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVAILTGGFATFSSCFPGLCEGKPATLPSMSLSQPCLPVPSVGLTR---ILPHLYLGSQKDVLNKDLMTQNGISYVLNASNSCPKPDFICESRFM--RIPINDNYCEKLLPWLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIAIAYIM-KTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL 300          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q0IID7|DUS10_BOVIN (Dual specificity protein phosphatase 10 OS=Bos taurus OX=9913 GN=DUSP10 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.688e-39
Identity = 107/298 (35.91%), Postives = 157/298 (52.68%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTE-FGLPFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE-----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK--FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NC+ K+  RR  Q    +L              I    I++Y E    P +     P+ ++++ L       L L      F+  + NLC+            G ++     +P+S+P   DI   + + ILPFL+LGNE DA +   +    I +V+NVT         K  F  KR+  TD+N Q+L Q+F +AF+FIE A +    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE DL NG   R
Sbjct:  173 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVVPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGASAASSMLPQSIPSTPDIENAELTPILPFLFLGNEQDAQDLETMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR 469          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q9ESS0|DUS10_MOUSE (Dual specificity protein phosphatase 10 OS=Mus musculus OX=10090 GN=Dusp10 PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 1.896e-39
Identity = 108/298 (36.24%), Postives = 157/298 (52.68%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTE-FGLPFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE-----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK--FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NC+ K+  RR  Q    +L              I    I++Y E    P +     P+ ++++ L       L L      F+  + NLC+            G ++     +P+SVP   DI   + + ILPFL+LGNE DA +   +    I +V+NVT         K  F  KR+  TD+N Q+L Q+F +AF+FIE A +    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE DL NG   R
Sbjct:  174 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHGNLCDNSLQLQECREVGGGASAASSMLPQSVPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR 470          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q9Y6W6|DUS10_HUMAN (Dual specificity protein phosphatase 10 OS=Homo sapiens OX=9606 GN=DUSP10 PE=1 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.858e-38
Identity = 106/298 (35.57%), Postives = 156/298 (52.35%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTE-FGLPFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE-----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIK--FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NC+ K+  RR  Q    +L              I    I++Y E    P +     P+ ++++ L       L L      F+  + NLC+            G ++     +P+ +P   DI   + + ILPFL+LGNE DA +   +    I +V+NVT         K  F  KR+  TD+N Q+L Q+F +AF+FIE A +    +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL++FE DL NG   R
Sbjct:  173 VIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPR 469          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|P28562|DUS1_HUMAN (Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3)

HSP 1 Score: 140.969 bits (354), Expect = 4.250e-36
Identity = 98/311 (31.51%), Postives = 158/311 (50.80%), Query Frame = 2
Query:  446 KIDKIESAELEKLISTDCS-VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDL---------HRIVLYTEFGLPF---KQDDPITVLIQFLI--GRSINCLYLTDSFKKFETTYPNLCESGSSNV-LCLHIPKSVPDF---------TDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            ++  +++  L  L+    +  ++LD RS + F+  HI  +     S+ ++ R    +  E +  + +L         H +VL  E        K+D  + +    L    R+    +L   ++ F  + P LC   S+ + L L +  SVPD          T +Y     + ILPFLYLG+   A     L    IT ++NV+       E  ++ K I   DN+  D+  +F +A  FI+  + + GR+ VHCQAGISRSATI +AYLM   + + L+ A ++VK+RR+IISPNF+FMGQL+QFE+ ++
Sbjct:    4 EVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLM-RTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVL 313          
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Match: sp|P28563|DUS1_MOUSE (Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.723e-34
Identity = 98/311 (31.51%), Postives = 156/311 (50.16%), Query Frame = 2
Query:  446 KIDKIESAELEKLISTDCS-VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDL---------HRIVLYTEFGLPF---KQDDPITVLIQFLI--GRSINCLYLTDSFKKFETTYPNLCESGSSNV-LCLHIPKSVPDF---------TDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            ++  +++  L  L+    +  ++LD RS + F+  HI  +     S+ ++ R    +  E +  + +L         H +VL  E        K+D  + +    L    RS    +L   ++ F  + P LC   S+   L L +  SVPD          T +Y     + IL FLYLG+   A     L    IT ++NV+       E  ++ K I   DN+  D+  +F +A  FI+  + + GR+ VHCQAGISRSATI +AYLM   + + L+ A ++VK+RR+IISPNF+FMGQL+QFE+ ++
Sbjct:    4 EVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFFLQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLM-RTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVL 313          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: F8WLE5 (Mitogen-activated protein kinase phosphatase OS=Dugesia japonica OX=6161 GN=DjmkpA PE=2 SV=1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 344/389 (88.43%), Postives = 374/389 (96.14%), Query Frame = 2
Query:  218 MIKSSTSMPTEFIREIFIPLDSNLLSEEPSPTKFLRTYDNLRCPTSILDESMDLLCHKSSSLHTISTSIPDSELNNKIDKIESAELEKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTLFTGTSINY 1384
            MIKS +S+PTEF+REIF+PLDSN++SE+PSP KFLR++D+ RCPTSI DES+DLLCHKSSS+H +S+S+PDSELNNKI+KIESA LEKLI+TDCS+IILDLRSAYNFSKMHITTA+LANCSSKMKSRRAIQIV EILKTS+DLH IVLYTEFGLPFKQDDP+T+LIQFL+GRSINCLYLTDSFKKFET YP LCESGSSNVLC HIPKSVPDFTDIYFTKASL+LPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELAR+SNG+ILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI+GTFKR +VLN DLITSS +F GTSIN+
Sbjct:    1 MIKSPSSVPTEFMREIFVPLDSNVISEDPSPNKFLRSFDSSRCPTSISDESVDLLCHKSSSIHALSSSVPDSELNNKIEKIESAVLEKLIATDCSLIILDLRSAYNFSKMHITTARLANCSSKMKSRRAIQIVIEILKTSLDLHHIVLYTEFGLPFKQDDPLTILIQFLLGRSINCLYLTDSFKKFETAYPQLCESGSSNVLCQHIPKSVPDFTDIYFTKASLVLPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARQSNGKILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLISGTFKRNSVLNFDLITSS-MFMGTSINF 388          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A4E0RXD5 (Dual specificity protein phosphatase 10 OS=Fasciola hepatica OX=6192 GN=D915_001236 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.366e-45
Identity = 84/153 (54.90%), Postives = 108/153 (70.59%), Query Frame = 2
Query:  860 DIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            D+Y  KAS ILPFLYLGNE+D  +  FL++ +I  VLNVT K  FLDE +F+  R+   D   QDL   F  AF+FIE +RK+   +LVHCQAGISRS  +VIAYLM+H S L L +A++WVK +R++ISPNF F+GQL  FE DL++G   R
Sbjct:  346 DVYRVKASRILPFLYLGNEIDCSSEQFLSSCRIRSVLNVTNKVPFLDEKRFRCCRLPAIDMQTQDLRPLFTSAFEFIEQSRKAGDSVLVHCQAGISRSPALVIAYLMAH-SGLSLRDAYRWVKSKRSVISPNFAFLGQLCDFEADLVSGRVPR 497          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: Q4RQY7 (Chromosome 14 SCAF15003, whole genome shotgun sequence OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00030399001 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.621e-44
Identity = 116/304 (38.16%), Postives = 162/304 (53.29%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTEFG-----LPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFL--DEIKFKSKRINCTDNNVQDLIQFFPDAFKFI-----ELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NCS K+  RR  Q    +L              I    IV+Y E       L F Q  P+ V+++ L     + + L      F  ++ NLCE          +G++  L   +P S+P   DI   + + ILPFLYLGNE DA + + L    I ++LNVT        D   F  KR+  TD+N Q+L Q+F +AF+FI     E A ++   +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK RR IISPN NFMGQL++FE DL NG   R
Sbjct:  175 VIIDCRPFMEYNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCHEGKDSYKGIFSKEIVVYDESTADPNRLTFSQ--PLYVVLESLRREGKDPIVLKGGLSCFRQSHENLCEHSLHLHEGLDTGAAAGLTGALPHSLPSTPDIENAELTPILPFLYLGNEHDAQDISLLQRFHIGYILNVTTHLPLYHYDSGLFVYKRLPVTDSNKQNLRQYFEEAFEFIGMVLIEEAHQAGIGLLIHCQAGVSRSATIVIAYLMKH-TWMTMTDAYKFVKTRRPIISPNLNFMGQLLEFEEDLNNGITPR 475          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A210QWH4 (Dual specificity protein phosphatase 10 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09553 PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 4.970e-44
Identity = 111/293 (37.88%), Postives = 162/293 (55.29%), Query Frame = 2
Query:  500 SVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRA-------IQIVNEILKTSIDLHR------IVLYTEFGLPFKQ---DDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNV--LCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            S ++LD RS  +++  HI  A   NC  +   +R        I +VN   K + D  +      ++LY +      Q   D  + +++  L+      L L    + F   Y +LC SG   V    L+ P +      I   +A+ ILPFLYLGNE DA N   LT+  IT+VLN T  +   F D+     KRI  +D+  Q+L Q+F +A +FIE AR+   R+L+HC AG+SRSATI IAYL++  S+L L +A+++VK RR+IISPNFNFMGQL+++E  L +G+  R
Sbjct:   93 SCLLLDCRSFISYNVTHIQGAVNVNCCDRFNRKRLQQGKVTLIDLVNS--KEAKDQFKRRGSKEVILYDDGTKDLHQLPTDSSLYLVVSSLLREGKEVLVLQGGLQAFRCQYTDLCHSGVKIVDSRPLYSPTTGIIEPQIEAAEATQILPFLYLGNERDAANYKKLTDLDITYVLNTTSTVPKHFEDQ-GITYKRIPASDSGAQNLQQYFEEAIQFIEEARQKEARVLIHCHAGVSRSATITIAYLLTR-SSLSLMDAYRFVKGRRSIISPNFNFMGQLMEYEQSLNSGSCSR 381          
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Match: A0A5A9NGM7 (Dual specificity protein phosphatase 10 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti019393 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 5.418e-44
Identity = 110/301 (36.54%), Postives = 161/301 (53.49%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTEFGL-PFK--QDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE--------------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASF--LDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R   +F+K HI  A   NCS K+  RR  Q    +L              I    +V+Y +  + P +     P+ V+++ L     + + L      F  ++ +LCE              +G S VL    P S+P   DI   + + +LPFL+LGNE DA +   +    I ++LNVT        D   F  KR+  TD+N Q+L Q+F +AF++IE A ++   +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK RR IISPN NFMGQL++FE DL NG   R
Sbjct:  167 VIIDCRPFMDFNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCRQSKESFKGIFSKELVVYDDSTVDPGRLTPSQPLHVVLESLRREGKDPIVLKGGLAGFRQSHEDLCEHSLQPSEGQDGRTAAGLSGVL----PHSLPSTPDIENAELTAVLPFLFLGNERDAQDREQMQRLNIGYILNVTTHLPLYHFDLGLFNYKRLPATDSNKQNLRQYFEEAFEYIEEAHQAGQGLLIHCQAGVSRSATIVIAYLMKH-TWMTMTDAYKFVKSRRPIISPNLNFMGQLLEFEEDLNNGVTPR 462          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: taf1a (TATA-box binding protein associated factor, RNA polymerase I subunit A [Source:NCBI gene;Acc:103041075])

HSP 1 Score: 159.073 bits (401), Expect = 8.533e-43
Identity = 125/350 (35.71%), Postives = 182/350 (52.00%), Query Frame = 2
Query:  413 STSIPDSELNNKIDKIESAELEKLISTDCSV--------IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEIL-----KTSIDLHR------IVLYTEFGLPFKQ---DDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDE--IKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTL 1360
            + S+  S+ N  +  I   EL + + T C +        +I+D R   +F+K HI  A   NCS K+  RR  Q    +L     + S D  R      IV+Y E  +   +     P+ V+++ L     + + L      F   +  LCE           G+S  L   +P S+P   DI   + + ILPFL+LGNE DA +   +    I ++LNVT            FK KR+  TD+N Q+L Q+F +AF+FIE A ++   +L+HCQAG+SRSATIVIAYLM H + + + +++++VK RR IISPN NFMGQL++FE DL NG   R  +L   LI   T+
Sbjct:  132 APSLTASQPNGSVRVIHPNELAQKM-THCPLGHPVGPVPVIIDCRPFTDFNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCRQSKDSFRGIFSKEIVVYDESTVDPGRLSLSQPLHVVLESLRREGKDPVVLRGGLSSFRQGHEELCEHSLHLQEGQDPGASVGLSGALPHSLPSTPDIENAEITPILPFLFLGNEQDAQDHDLMQRLNIGYILNVTTHLPLYHYSLGLFKYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAYLMKH-TWMTMTDSYKFVKTRRPIISPNLNFMGQLLEFEEDLNNGITPR--ILTPKLIGVETI 477          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp4 (dual specificity phosphatase 4 [Source:NCBI gene;Acc:103029669])

HSP 1 Score: 145.976 bits (367), Expect = 6.532e-39
Identity = 102/304 (33.55%), Postives = 163/304 (53.62%), Query Frame = 2
Query:  455 KIESAELEKLISTD--CSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHR----------IVLY---TEFGLPFKQDDPITVLIQFLIGRSI---NCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPD---FTDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            +++   L++L+  D  C +++LD RS   FS  HI  A  A  ++ ++ R    +  E + +  D  R          ++LY   T+     K+D  +T+++  L GR     +   L   + +F + YP+ C    +    L +P +V      T  +     + ILPFL+LG+ L A     L    I+ +LNV+       E  ++ K I   DN+ +D+  +F +A +FI+  + SNGR+LVHCQAGISRSATI +AYLM     + L  A ++VK+RR+IISPNF+FMGQL+QFE+ ++
Sbjct:   10 EMDCGSLKRLLKEDGGCKLLLLDCRSFLAFSAGHIRGAVNARANTIVRRRAKGSVSLEQILSGDDEARSRLLAGLYSAVILYDERTQDARAVKEDSTLTLVLNAL-GRDTFRTDVYLLKGGYDRFCSQYPDYCLKSRT----LPVPSTVSSTSCGTPHHDQGGPVEILPFLFLGSALHASKKDMLDGMGISALLNVSSNCPNHFEGAYQYKCIPVEDNHKEDISSWFIEAIEFIDSIKDSNGRVLVHCQAGISRSATICLAYLMKK-KRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVL 307          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp8a (dual specificity protein phosphatase 8 [Source:NCBI gene;Acc:103028645])

HSP 1 Score: 148.673 bits (374), Expect = 3.323e-38
Identity = 104/283 (36.75%), Postives = 151/283 (53.36%), Query Frame = 2
Query:  503 VIILDLR--SAYNFSKMHITTAKLANCSSKMKSRRAIQ---IVNEIL----KTSIDLHR---IVLY---TEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            ++++D R  S YN S +H     +  C SK+  RR  Q    V E+L    K  +DL R   +V+Y   T+      +D  + +L+  L G       LT  F  F + +P LCE      L + + +      ++  T+   ILP LYLG++ D LN   +T N IT+VLN +    K  F+ E  F   RI   DN  + L+ +     +FI+ A+ SN R++VHC AGISRSATI IAY+M     L  ++A+++VK RR  ISPNFNF+GQL++FE  L
Sbjct:   27 LLVIDSRTFSEYNASHVH---GAVNVCCSKLVKRRLQQDKVSVTELLQPNGKVKVDLGRRQEVVVYDQSTKDAGQLSKDGFVHILLSKLDGTFHKVSLLTGGFAAFSSCFPGLCEGKPVATLPMSLSQPCLPVANVGPTR---ILPHLYLGSQKDVLNKDLMTQNGITYVLNASNTCPKPEFISESHFM--RIPVNDNYCEKLLPWLEKTNEFIDKAKVSNSRVIVHCLAGISRSATIAIAYIM-KTMGLSSDDAYRFVKDRRPSISPNFNFLGQLLEFEKGL 300          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp2 (dual specificity protein phosphatase 2 [Source:NCBI gene;Acc:103038175])

HSP 1 Score: 139.428 bits (350), Expect = 6.991e-37
Identity = 106/338 (31.36%), Postives = 163/338 (48.22%), Query Frame = 2
Query:  455 KIESAELEKLISTDCSV-IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCL-------------------------YLTDSFKKFETTYPNLC-----ESGSSNVLC----LHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTLF 1363
            +I S EL +++ T C++ ++LD R    F    +  +   N +S +  R   ++    L ++  L R+V         +  +   V++     RS+  L                         +L   F++F + YP LC     + GS + L     L+  KS+P +          ILPFL+LG+   +     L    IT VLNV+     L E + +   +   D+   D+  FFP+A +FI+  ++S GR+LVHCQAGISRSATI +AYL+ H   + L+ A  +VKRRR +ISPN  FMGQL+QFE D++      C    LD   SS++F
Sbjct:    4 EITSCELAQMVRTHCALPLLLDCRPFLAFCGARLAFSHSVNWNSVLMRRERARMG---LASARPLERLVADRALLRQLRAGECARVVVLDEASRSVRELRRESVAGLLLRALQEELREEGTEVCFLQGGFEEFVSLYPELCLNTPLKCGSPSTLSDPETLNSTKSMPLYDQ---GDPVEILPFLFLGSAHHSSQRDTLERCGITAVLNVSSSCPNLFEQELQYMTLKVEDSLAADIRVFFPEAIRFIDSVKESGGRVLVHCQAGISRSATICLAYLI-HARRVRLDEAFDFVKRRRQVISPNLAFMGQLLQFETDVL------CPYTVLDSKNSSSVF 328          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Match: dusp2 (dual specificity protein phosphatase 2 [Source:NCBI gene;Acc:103038175])

HSP 1 Score: 139.428 bits (350), Expect = 7.415e-37
Identity = 106/338 (31.36%), Postives = 163/338 (48.22%), Query Frame = 2
Query:  455 KIESAELEKLISTDCSV-IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCL-------------------------YLTDSFKKFETTYPNLC-----ESGSSNVLC----LHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTLF 1363
            +I S EL +++ T C++ ++LD R    F    +  +   N +S +  R   ++    L ++  L R+V         +  +   V++     RS+  L                         +L   F++F + YP LC     + GS + L     L+  KS+P +          ILPFL+LG+   +     L    IT VLNV+     L E + +   +   D+   D+  FFP+A +FI+  ++S GR+LVHCQAGISRSATI +AYL+ H   + L+ A  +VKRRR +ISPN  FMGQL+QFE D++      C    LD   SS++F
Sbjct:    9 EITSCELAQMVRTHCALPLLLDCRPFLAFCGARLAFSHSVNWNSVLMRRERARMG---LASARPLERLVADRALLRQLRAGECARVVVLDEASRSVRELRRESVAGLLLRALQEELREEGTEVCFLQGGFEEFVSLYPELCLNTPLKCGSPSTLSDPETLNSTKSMPLYDQ---GDPVEILPFLFLGSAHHSSQRDTLERCGITAVLNVSSSCPNLFEQELQYMTLKVEDSLAADIRVFFPEAIRFIDSVKESGGRVLVHCQAGISRSATICLAYLI-HARRVRLDEAFDFVKRRRQVISPNLAFMGQLLQFETDVL------CPYTVLDSKNSSSVF 333          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004127.1 (pep scaffold:Pmarinus_7.0:GL482725:7128:13243:-1 gene:ENSPMAG00000003769.1 transcript:ENSPMAT00000004127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 1.282e-38
Identity = 96/287 (33.45%), Postives = 149/287 (51.92%), Query Frame = 2
Query:  500 SVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLP-----FKQDDPITV------LIQFLIG---RSINCLYLTDS-FKKFETTYPNLCESGS---SNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTI---KASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +++++D R+   F+  H+ +A L  C SK+  RR  Q    +L+            E G P     + Q  P          +  L+G   R+ + +YL D  F  F+  +P LCE+ S   +    L +P S P    +  T  + ILP+LYLG++ D LN      + ITHVLN ++   +  F+ E  F   R+   D+  + ++ +      FIE  R    R+LVHC AGISRSAT+ IAY+M  C  L  ++A+++VK +R  ISPNFNF+GQL+++E +L
Sbjct:   28 TLLVIDGRTFAEFNSCHVRSA-LNVCCSKLVQRRLQQDKVSVLELVQHAATSGSQVEAGGPVVVVVYDQRSPSAASLPPHGFVSVLLGKLRRTFSDVYLLDGGFAAFQLLFPQLCENASRVDTRTPPLALPVSSPSL-HLRDTGPTCILPYLYLGSQRDVLNKAIRVQSGITHVLNASVGCPRPDFIPEGNFL--RVPVHDSYCEKILPWLDCTANFIEGVRARGSRVLVHCLAGISRSATVAIAYVM-RCKRLSSDDAYRFVKEKRPSISPNFNFLGQLLEYEREL 309          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 122.094 bits (305), Expect = 1.520e-32
Identity = 75/161 (46.58%), Postives = 105/161 (65.22%), Query Frame = 2
Query:  842 SVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            S PD  +   T    +LPFL+LGNE DA +   L    I +++NVT  +     +    + KR+  TD+  Q+L Q+F +AF+FIE A +S   +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK +R IISPN NFMGQL+QFE DL +G   R
Sbjct:   38 STPDVENAEMTA---VLPFLFLGNEQDAQDLAQLQRLNIGYIINVTSHLPLYHYERGALRYKRLPATDSCKQNLRQYFEEAFEFIEEAYQSGKGLLIHCQAGVSRSATIVIAYLMKH-TRMTMTDAYKFVKGKRPIISPNLNFMGQLLQFEEDLNSGVSPR 194          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp6 (dual specificity phosphatase 6 [Source:ZFIN;Acc:ZDB-GENE-030613-1])

HSP 1 Score: 124.79 bits (312), Expect = 9.510e-32
Identity = 86/245 (35.10%), Postives = 113/245 (46.12%), Query Frame = 2
Query:  746 LYLTDSFKKFETTYPNLCE------SGSSNVLCLHIP-KSVPDFTDIYFTKASL---------------------------------ILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSS 1354
             YL   F  F   YP  CE      +GS   LC   P  +VP          S+                                 ILP+LYLG   D+ N   L  + I ++LNVT  +  +F     F  K+I   D+  Q+L QFFP+A  FI+ AR+    +LVHC AGISRS T+ +AYLM    NL LN+A+  V+ ++  ISPNFNFMGQL+ FE+ L      R    NL   T +
Sbjct:  136 FYLQGGFSGFRARYPEHCETCVDAGAGSPGGLCTSPPTAAVPILGLGALRIGSISTRNLDKSMKRSTNSGEGPGGCPSGGSPSFPVEILPYLYLGCARDSTNLAALAEHGIRYILNVTPNVPNAFESRRDFVYKQIPVPDHWSQNLSQFFPEAIAFIDEARQKKCGVLVHCLAGISRSVTVTVAYLM-QTLNLSLNDAYDLVRNKKANISPNFNFMGQLLDFEHTLGPPCDNRPGATNLFFTTPT 379          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 122.479 bits (306), Expect = 2.382e-31
Identity = 74/211 (35.07%), Postives = 104/211 (49.29%), Query Frame = 2
Query:  695 DPITVLIQFLIGRSIN---CLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASL----------ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFE 1288
            D    ++   +GR        +L   ++KF   +  LC   +    C   P ++     I    A            ILPFLYLG+   A     L    IT +LNV+       E  F  K I   DN+  D+  +F +A  FI+  R+  GR+ VHC AG+SRSATI +AYLM     L L+ A ++V++RR++ISPNFNF+GQL  FE
Sbjct:  121 DSTLAMVALALGRETRGTPVYFLRGGYEKFHRDFSELCLDAALTSPCKTTPPALLPPVPIRLHTAGTPTYDQGGPVEILPFLYLGSAYHASRRELLDAIGITALLNVSADLPNHFEGLFTYKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMK-TRRLRLDEAFEFVRQRRSVISPNFNFLGQLQSFE 330          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 119.783 bits (299), Expect = 2.486e-31
Identity = 67/139 (48.20%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  887 ILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            ILP L+LG   D+ N   L  + I ++LNVT  +  +F     FK K+I  +D+  Q+L QFFP+A  FI+ AR     +LVHC AGISRS T+ +AYLM   S L LN+A+ +VK +++ ISPNFNFMGQL+ FE  L
Sbjct:  100 ILPHLFLGCAQDSSNMEALAQHGIRYILNVTPNLPNTFERIADFKYKQIPISDHWNQNLSQFFPEAIAFIDEARNKQCGVLVHCLAGISRSVTVTVAYLMQKLS-LPLNDAYDFVKHKKSNISPNFNFMGQLLDFERRL 237          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 73.559 bits (179), Expect = 1.171e-14
Identity = 58/194 (29.90%), Postives = 92/194 (47.42%), Query Frame = 2
Query:  887 ILPFLYLGNELDALNSTFLTNN-KITHVLNV---TIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIEL-----------------ARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFEN------DLINGTFKRCNV---LNLD-----LITSSTLF 1363
            IL  +YLG     ++   L     ITH+L+V    +   +L    +  K I   D++V D++Q+F +  +FI+                   +   G +  HCQAG+SRS T ++AYLM +   L L+ A   VKR++  + PN NFM QL  FE       D  N  +K+  +   + LD     L+++S +F
Sbjct:   15 ILGGIYLGGIRPIIDHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLM-YRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEKMGGDFVDFDNPAYKQWKLKQSIKLDPSGSELVSNSGMF 207          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 63.1586 bits (152), Expect = 4.177e-11
Identity = 45/146 (30.82%), Postives = 73/146 (50.00%), Query Frame = 2
Query:  863 IYFTKASLILP---FLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQF 1285
            +Y     L+LP   +LY   +L+ + S  L  N    + N+   I      +IK+       T   V+DL +      + I  A     +ILVHCQ G+SRSA++++AY+M +   L LN+A+  +K     ISPN   + QL+++
Sbjct:  229 VYLDGPLLVLPPNLYLYSEPKLEDILSFDLVINVAKEIPNLEFLIPPEMAHKIKYYHIEWTHTSKIVKDLSRLT----RIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYY-GLSLNDAYNKLKGVAKDISPNMGLIFQLMEW 369          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Match: SDP1 (Stress-inducible dual-specificity MAP kinase phosphatase; negatively regulates Slt2p MAP kinase by direct dephosphorylation, diffuse localization under normal conditions shifts to punctate localization after heat shock; SDP1 has a paralog, MSG5, that arose from the whole genome duplication [Source:SGD;Acc:S000001375])

HSP 1 Score: 57.7658 bits (138), Expect = 4.510e-10
Identity = 28/74 (37.84%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 1067 FPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFE 1288
             P     I  A     +IL+HCQ G+SRSAT++IAY+M +  NL L +++  +K R   I+P+   + QL+++E
Sbjct:  119 LPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKY-HNLSLRHSYDLLKSRADKINPSIGLIFQLMEWE 191          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Match: PPS1 (Protein phosphatase; has specificity for serine, threonine, and tyrosine residues; has a role in the DNA synthesis phase of the cell cycle [Source:SGD;Acc:S000000480])

HSP 1 Score: 54.6842 bits (130), Expect = 2.438e-8
Identity = 32/88 (36.36%), Postives = 47/88 (53.41%), Query Frame = 2
Query: 1028 NCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRR--TIISPNFNFMGQLVQF 1285
            N  DN    L         FI  +  + G++LVHC  G+SRSAT+ IA  M +    DL +A+ +V+ RR   II PN  F+ +L ++
Sbjct:  691 NLDDNGKDPLFHQIDKVLDFISNSEATGGKVLVHCMVGVSRSATVCIAECMRYLQ-CDLASAYLFVRVRRLNVIIQPNLFFVYELFKW 777          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO45432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA2])

HSP 1 Score: 142.51 bits (358), Expect = 1.967e-38
Identity = 84/207 (40.58%), Postives = 115/207 (55.56%), Query Frame = 2
Query:  752 LTDSFKKFETTYPNLCESGS-----------------------SNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKA--SFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            L   F KFE  +P+ CE G                        S +L  ++  S P+  ++   + + ILP LYLG+E DA N   L  +KI++VLNVT     +F     FK K +   DN + +L + FP+AF FI+  R+ +  +LVHC AGISRS TI IAYLMS   +L LN A+ +VK R++ +SPNFNFMGQL+ FE  L
Sbjct:  121 LEGGFSKFEERFPSFCEPGEESGRPLLSLSGLTIREASEQAVPSRILLPNVQPSTPENRNVSNCELAEILPRLYLGSEKDASNIELLRKHKISYVLNVTHDRPNTFAHIEGFKYKNLPVEDNLMANLTELFPEAFAFIDEGRQKSSNVLVHCLAGISRSVTITIAYLMS-SQHLSLNEAYDFVKARKSNVSPNFNFMGQLLDFERSL 326          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 121.324 bits (303), Expect = 5.963e-31
Identity = 94/300 (31.33%), Postives = 151/300 (50.33%), Query Frame = 2
Query:  509 ILDLRSAYNFSKMHITTAKLANCSSKMKSR--RAIQIVNEIL---KTSIDLHR---IVLYTEFGLPFKQ---DDPITVLIQFLIG--RSINCLYLTDSFKKFETTYPNLCE------SGSSNVLCLHI-----------PKSVPDFTDIYFTKASL--------ILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFE 1288
            ++D RS   F+  HI  A   +C   +K R  R    ++ ++   ++ + L     I+ Y +    +K    D  + ++ + L    R     Y+   F++F   +  +CE      S  ++ L L +           P+   D  D    +A          +LP LYLG+EL A     L    I+ ++NV+  I  +F D   +K+  ++ T N   D+  +F +A  FI+  + S GR+LVHCQAGISRSATI +AYL+S   N  L+ A+++VK+RR++ISPNFNFMGQL+ +E
Sbjct:   11 LVDCRSFMAFNVAHIRGAVNIHCPPILKRRLLRGSATLSALVSCPESKVILEEADTIIFYDDRTCDWKDLENDSTMKIVAKLLRWEKRKATLFYIKGGFERFSALFSTMCEFIKPCNSSLTSPLKLKLMTSADGRKPFSPRWDTDNKDDQLPRAHSNSVNEPVELLPHLYLGSELHASRRDVLKRLGISAIVNVSRNIPNTFEDSFTYKTIPVDDTYN--ADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRL-NFRLDEAYEYVKKRRSVISPNFNFMGQLLHYE 307          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 114.775 bits (286), Expect = 2.202e-30
Identity = 62/145 (42.76%), Postives = 88/145 (60.69%), Query Frame = 2
Query:  887 ILPFLYLGNELDALNSTFLTNNKITHVLNVT-IKASFLDEIK-FKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFK 1315
            ILPFL+LG+E  A +   +    I  +LN+T +  +F  E +    KRI   D+  +D+ Q F +A  FI+ AR     +LVHC AG+SRSAT+ +AY+M H   L LN A+Q+VK +R  ISPN NFMG L+++E +  N   K
Sbjct:    1 ILPFLFLGSEEGAADEDLIDRLAIKFILNLTPVCPNFFSEREDIIYKRIQINDSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLG-LSLNEAYQFVKEKRPTISPNLNFMGHLLKYEKNKKNEELK 144          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO43689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV7])

HSP 1 Score: 108.997 bits (271), Expect = 6.625e-27
Identity = 81/260 (31.15%), Postives = 135/260 (51.92%), Query Frame = 2
Query:  476 EKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQ---IVNEILKTSID-----LHRIVLY---TEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSK--RINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAH 1216
            E L+++  S++I+D RS   ++  H+  +    CS K+  RR I     + E+LKT  +     L ++++Y   T+      +D+ ++V+   L     +  +L   F  F   +P LCES S+   C    ++V     +     + ILPFLYLG +  +L+  FL    I +VLN++     L  ++   +  RI   D   ++++ +FP AF FI+  R+ +GR+L+HC AG SRSATI I Y+M H   L L+ A+
Sbjct:   11 ECLVNSVQSLLIIDSRSFLEYNDAHVINSINIGCS-KLIKRRLITNKISIQELLKTGENVQPNQLGKVIVYDQDTQDMEGLSKDNFMSVVFSKLTSSYKDVCFLKGGFSFFAREFPKLCESRSNPGRCG--VRAVLSQPCLSTEAPTHILPFLYLGTQEHSLDEEFLNATGINYVLNISCSCPALPGLENTGRYLRIPVKDTINENILDWFPTAFDFIDKVREVHGRVLLHCYAGKSRSATIAIGYIMKHL-RLSLDEAY 266          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Match: EDO47156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT6])

HSP 1 Score: 93.5893 bits (231), Expect = 2.496e-22
Identity = 55/145 (37.93%), Postives = 79/145 (54.48%), Query Frame = 2
Query:  869 FTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLIN 1303
             T  + I  +L+L +   A +   L    IT V+N TI+A   D  K K  RI   DN    +  FF      IE  R+  G++LVHC AG+SRSA++VIAYLM +   L+L +AH+ V+ +R +I PN  F  +L+ +E  L  
Sbjct:   16 LTAMARITEWLFLSSCQVARDEKLLLEKGITLVINATIEAPEQDYKKVKHIRIKVNDNPGNKIGIFFDMVSDKIESVRRVGGKVLVHCIAGVSRSASLVIAYLMKY-QRLNLRDAHKLVQDKRPLIRPNTGFWKELIDYEKKLFG 159          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp10 (dual specificity phosphatase 10 [Source:NCBI gene;Acc:101167166])

HSP 1 Score: 160.229 bits (404), Expect = 3.081e-43
Identity = 112/297 (37.71%), Postives = 159/297 (53.54%), Query Frame = 2
Query:  506 IILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILK-----------TSIDLHRIVLYTEFGLP---FKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCE----------SGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFL--DEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            +I+D R    ++K HI  A   NCS K+  RR  Q    +L              I    IV+Y E  +       + P+  +++ L     + + L      F  ++ NLCE           G++  L   +P S+P   DI   + + ILPFLYLGNE DA ++  L    I ++LNVT        D   F  KR+  TD+N Q+L Q+F +AF+FIE A ++   +L+HCQAG+SRSATIVIAYLM H + + + +A+++VK RR IISPN NFMGQL++FE DL NG   R
Sbjct:  164 VIIDCRPFLEYNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKGIFSKEIVVYDESTVDPNRLTSNQPLHAVLESLRREGKDPIILKGGLSYFRQSHENLCEHSLHLHEGLDPGAAAGLTGPLPHSLPSTPDIENAELTPILPFLYLGNEQDAQDANLLQRLNIGYILNVTTHLPLYHYDTGLFIYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGMGLLIHCQAGVSRSATIVIAYLMKH-TWMTMTDAYKFVKTRRPIISPNLNFMGQLLEFEEDLNNGITPR 459          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: ENSORLT00000014597.2 (dual specificity protein phosphatase 7 [Source:NCBI gene;Acc:101175078])

HSP 1 Score: 140.969 bits (354), Expect = 3.607e-37
Identity = 110/322 (34.16%), Postives = 149/322 (46.27%), Query Frame = 2
Query:  479 KLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHR-------------IVLYTEFGLPFKQDDP----ITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCES----------------GSSNVLCLH--------------IPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +L S   S+++LD RS   +   HI +A   N +      R  +  N  ++T I  H              +VLY E    +         + VL+Q L        YL   F KF T YP  CE+                G  N+                   P + PDF          ILP+LYLG   D+ N   L    IT++LNVT  +   F  +  F+ K+I  +D+  Q+L QFFP+A  FI+ AR     ILVHC AGISRS T+ +AYLM    NL LN+A+ +VKR+++ ISPNFNFMGQL+ FE  L
Sbjct:   16 ELESGGSSLLLLDCRSHELYESSHIESA--INLAMTGLMLRRFKKGNIPIQTVIPKHEEKEKFIGRCKTDTVVLYDECSAEWPASGAPASVLFVLLQKLWEDGCKAFYLEGGFVKFNTEYPEHCETFLDSSCPSSSPPVSALGFGNLRISSDCSDGESTEPEESPFPSNQPDF-------PVQILPYLYLGCAKDSANLDVLGQYNITYILNVTPNLPNMFEHDGHFRYKQIPISDHWSQNLSQFFPEAISFIDEARSKRCGILVHCLAGISRSVTVTVAYLMQRL-NLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL 327          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp2 (dual specificity protein phosphatase 2 [Source:NCBI gene;Acc:101157459])

HSP 1 Score: 139.813 bits (351), Expect = 3.790e-37
Identity = 79/190 (41.58%), Postives = 108/190 (56.84%), Query Frame = 2
Query:  749 YLTDSFKKFETTYPNLCESGSSNVLCLHIP------KSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            +L   F+ F   +P LC   +S+ L L  P      +S P +      +   +LPFL+LG+ + +     LT   IT VLNV+     L E +FK  R+   D    D+   F  A  FI+  ++S GR+LVHCQAGISRSATI +AYLM H   + LN A  +VK+RR +ISPN  FMGQL+QFE D++
Sbjct:  127 FLQGGFEGFSEAFPELCHCSASSQLSLMEPEPAVTGRSTPAYDQDGPVE---LLPFLFLGSAVHSSRREMLTAAGITAVLNVSSTCPNLYEGEFKYLRLTVEDTLAADIRACFNTAIAFIDSVKQSGGRVLVHCQAGISRSATICLAYLM-HTQRVRLNEAFDFVKQRRNVISPNLAFMGQLLQFETDIL 312          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp8a (dual specificity phosphatase 8 [Source:NCBI gene;Acc:101161296])

HSP 1 Score: 145.591 bits (366), Expect = 4.192e-37
Identity = 102/282 (36.17%), Postives = 150/282 (53.19%), Query Frame = 2
Query:  503 VIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQ---IVNEIL----KTSIDLHR---IVLY----TEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT---IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            ++++D R+   F+  H+  A +  C SK+  RR  Q    V E+L    K  ++L R   +V+Y     E G    +D  + +L+  L G       LT  F  F + +P LCE   +  L + + +      ++  T+   ILP LYLG++ D LN   +  N IT VLN +    K  F+ E  F   RI   DN  + L+ +     +FIE A+ SN R++VHC AGISRSATI IAY+M     L  ++A+++VK RR  ISPNFNF+GQL++FE  L
Sbjct:   29 LLVIDSRTFSEFNASHVQGA-VNVCCSKLVKRRLQQDKVSVTELLQPNGKVKVELGRKQEVVVYDQSSKEAGH-LSKDGFLHILMGKLEGTFHKVSLLTGGFAAFSSCFPGLCEGKPAPALPMSLSQPCLPVANVGPTR---ILPHLYLGSQKDVLNKDLMAQNGITFVLNASNTCPKPDFISESHFM--RIPVNDNYCEKLLPWLDKTNEFIEKAKVSNCRVIVHCLAGISRSATIAIAYIMK-TMGLSSDDAYRFVKDRRPSISPNFNFLGQLLEFEKGL 302          
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Match: dusp1 (dual specificity phosphatase 1 [Source:NCBI gene;Acc:101173794])

HSP 1 Score: 140.584 bits (353), Expect = 4.986e-37
Identity = 105/305 (34.43%), Postives = 154/305 (50.49%), Query Frame = 2
Query:  458 IESAELEKLISTDC-SVIILDLRSAYNFSKMHITTAKLANCSS--KMKSRRAIQ----IVNEILKT---SIDLHRIVLYTEFGLPFKQ--DDPITVLIQFLIGR---SINCLYLTDSFKKFETTYPNLC-ESGSSNVLCLHIPKSVPDF-------TDIYFTKASL-ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLI 1300
            ++SA L  L+  D    ++LD RS  +F+  HI+ +     S+  + ++R  +     + NE  +    S D   +VL  +  L   Q   D   +L    + R     N   L   F  F T YP++C +S     L L +    PD        T +Y     + ILPFLYLG+   A     L    IT ++NV+       E  F  K I   DN   D+  +F +A +FI+  R   GR+ VHCQAGISRSATI +AYLM   + + L+ A ++VK+RR+IISPNF+FMGQL+QFE+ ++
Sbjct:    9 VDSASLRALLDRDVPDCLVLDCRSFLSFNSSHISGSSNVRFSTIVRRRARGGLGLEHIVPNEDTRNRLLSGDYKSVVLLDDRSLDLGQVKKDGTLMLAVTALCRDPCGANVYILKGGFDAFSTEYPDMCTKSSPPQGLSLPLSSRNPDSASYSPCNTPLYDQGGPVEILPFLYLGSAYHASRKDMLEMLGITALINVSANCPNHFEDSFLYKSIPVEDNYKADISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLM-RTNRVKLDEAFEFVKKRRSIISPNFSFMGQLLQFESQVL 312          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000035381.1 (SMESG000035381.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 381/382 (99.74%), Postives = 381/382 (99.74%), Query Frame = 2
Query:  239 MPTEFIREIFIPLDSNLLSEEPSPTKFLRTYDNLRCPTSILDESMDLLCHKSSSLHTISTSIPDSELNNKIDKIESAELEKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTLFTGTSINY 1384
            MPTEFIREIFIPLDSNLLSEEPSPTKFLRTYDNLRCPTSILDESMDLLCHKSSSLHTISTSIPDSELNNKIDKIESAELEKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINC DNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTLFTGTSINY
Sbjct:    1 MPTEFIREIFIPLDSNLLSEEPSPTKFLRTYDNLRCPTSILDESMDLLCHKSSSLHTISTSIPDSELNNKIDKIESAELEKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCNDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRCNVLNLDLITSSTLFTGTSINY 382          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000078269.1 (SMESG000078269.1)

HSP 1 Score: 155.606 bits (392), Expect = 4.824e-42
Identity = 100/303 (33.00%), Postives = 153/303 (50.50%), Query Frame = 2
Query:  452 DKIESAELEKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFL--IGRSINCLYLTDSFKKFETTYPNLCESGSSNVLCLHIPKSVPD------------FTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 1318
            D+I   EL+  +    ++ ++D R    F   HI  A+L NC+++    +A +  ++  +   D   IVLY + G      +    LI F+  + +  + +Y           Y    +  S   +   IP+   D             TD+     S ILPFL+LGNE+D+ +   L   KITH+LNVT    F  E  F  KR++ TD N QD+  ++ +A +FI+ A   NG++LVHC AG+SRSATIV AYL+ H + L +     +++ +R I+ PNFNF+GQL +F  DL  G   R
Sbjct:   81 DEISVTELDSKLRAKNTICLIDTRDVRTFKNGHIIGAELFNCTTRTMMMKAKKNWDKFSQRRCDFETIVLYNQRG------EKTVHLIDFIDNLKKDFDSVYFVTG------GYEEYIKYFSKGFIESSIPEEKIDQYHYSPTNESNRSTDVLNATISEILPFLFLGNEMDSNDIEVLQEKKITHILNVTTNVPFYREDLFVYKRLSATDCNRQDMRAYYDEAIQFIDEAYSKNGKVLVHCWAGVSRSATIVAAYLLKH-TKLSVLQTIMFLQSKRPIVEPNFNFLGQLERFYCDLEKGVESR 370          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000063504.1 (SMESG000063504.1)

HSP 1 Score: 153.68 bits (387), Expect = 6.614e-42
Identity = 116/327 (35.47%), Postives = 176/327 (53.82%), Query Frame = 2
Query:  380 LCHKSSSLHTISTSIPDSELNNKIDKIESAELEK-LISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLT---DSFKK------FETTYP-NLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFL--DEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKRC 1321
            L  KS ++ T     P   LN     I S  L + L + D    ILDLR + +F   HI  AK ANC++K+ S++ +         + D H I+   +  LP   + P  VLI +L+  +    YL    D FKK       ET+ P    +S + +   +HI  S     D+    AS I PF+++GNE D+ +   L   +ITH+LNVT  + F   +   F+ +R+   D+++Q+L   + +AF FI+ AR SNGR+LVHC AG+SRS +IVIAYL+ H +N  L    ++V+ +R+I++PN +F+GQL ++  DL     KRC
Sbjct:   42 LLRKSLAVSTFGVGCP--SLNENFHTITSILLNRCLENNDFKGFILDLRDSRHFQNGHIKGAKTANCTTKLMSKKTLMDWKRSDYDNED-HYILYDQQSDLP-AANSPQIVLIDYLLLNNKQITYLQGGYDEFKKVCKESLIETSLPKEKLQSYNYSPTNVHINNS----EDVLNATASQIFPFIFIGNERDSSDLELLKELEITHILNVTSTSPFYFKNLNIFQYQRLPACDSHMQNLRVLYNEAFNFIDAARFSNGRVLVHCWAGVSRSPSIVIAYLLKHSNNSVL-EILKFVQGKRSIVAPNIHFLGQLEKYNLDLNQNLEKRC 359          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000030100.1 (SMESG000030100.1)

HSP 1 Score: 134.806 bits (338), Expect = 3.103e-35
Identity = 106/284 (37.32%), Postives = 144/284 (50.70%), Query Frame = 2
Query:  449 IDKIESAELEKLI--STDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYTEFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFET-TYPNLCESGSSNVLCLHIPKSVPDFT----DIYFTKASLILP-FLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQL 1276
            I  I   EL +LI   TD  +II D+R    F   HI  A   +CS+K+ SRR+ Q+      ++     IV+Y E  +   +D     LI  +         L+  F +F+T       E   S+   L    S         D+  T  S I+P FLYLGNELDA +   L   KIT ++NVT    F  E  FK  RI  +D++ Q+L Q+F +AF  IE  RK NGRI +HC AG+SRS+TIV+ YLM     LD+    ++V+  R I  PN NF+GQL
Sbjct:   47 ISHISCMELIELIDNKTDMDLII-DVRGNRFFQMQHIRHAMNFSCSTKLMSRRS-QVKWMKFHSNKLFSSIVIYDEKDILKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKTYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENIFKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMK-TKGLDVLETLKYVQEHRPIADPNLNFLGQL 327          
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Match: SMESG000016231.1 (SMESG000016231.1)

HSP 1 Score: 111.694 bits (278), Expect = 7.117e-26
Identity = 59/138 (42.75%), Postives = 84/138 (60.87%), Query Frame = 2
Query:  887 ILPFLYLGNELDALNSTFLTNNKITHVLNVTIKASFLDEIKFKS-KRINCTDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDL 1297
            +L  L LG++ DA+N + +  +KITHV+NV+        I  ++  RI   DN    +  +FP AF F++  R  NGR LVHC AGISRS T+ I YLM    N+ + +A+  VK  R+ +SPNFNF+GQL  +E +L
Sbjct:  251 VLKHLLLGSQRDAMNLSCIQQHKITHVINVSTDGLVCPFIPIQNFLRIPVLDNFTDRITNYFPKAFDFLDNVRAVNGRALVHCSAGISRSPTLAIGYLMK-AQNISVTDAYNIVKLSRSSVSPNFNFLGQLTDYEEEL 387          
The following BLAST results are available for this feature:
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP103.870e-3935.57dual specificity phosphatase 10 [Source:HGNC Symbo... [more]
DUSP18.851e-3731.51dual specificity phosphatase 1 [Source:HGNC Symbol... [more]
DUSP162.068e-3434.39dual specificity phosphatase 16 [Source:HGNC Symbo... [more]
DUSP162.068e-3434.39dual specificity phosphatase 16 [Source:HGNC Symbo... [more]
DUSP25.500e-3431.62dual specificity phosphatase 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vhp-11.441e-3137.89Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-11.441e-3137.89Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-12.871e-3137.89Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-12.871e-3137.89Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-12.989e-3137.89Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
puc3.173e-2944.08gene:FBgn0243512 transcript:FBtr0339722[more]
puc2.453e-2844.08gene:FBgn0243512 transcript:FBtr0081792[more]
Mkp34.466e-2744.29gene:FBgn0036844 transcript:FBtr0075036[more]
Mkp31.415e-2544.29gene:FBgn0036844 transcript:FBtr0333220[more]
Mkp31.415e-2544.29gene:FBgn0036844 transcript:FBtr0075035[more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp105.843e-4436.63dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
dusp23.240e-3733.87dual specificity phosphatase 2 [Source:ZFIN;Acc:ZD... [more]
dusp8a4.904e-3636.04dual specificity phosphatase 8a [Source:ZFIN;Acc:Z... [more]
dusp72.454e-3533.54dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
dusp72.665e-3533.54dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npc1l11.484e-4339.27NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011][more]
dusp88.958e-3831.94dual specificity phosphatase 8 [Source:NCBI gene;A... [more]
eci16.298e-3733.65enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB... [more]
pnpt13.609e-3633.55polyribonucleotide nucleotidyltransferase 1 [Sourc... [more]
ENSXETT00000037206.11.969e-3347.90dual specificity phosphatase 10, gene 2 [Source:NC... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp102.710e-4036.24dual specificity phosphatase 10 [Source:MGI Symbol... [more]
Dusp12.464e-3531.51dual specificity phosphatase 1 [Source:MGI Symbol;... [more]
Dusp164.199e-3534.00dual specificity phosphatase 16 [Source:MGI Symbol... [more]
Dusp76.237e-3433.02dual specificity phosphatase 7 [Source:MGI Symbol;... [more]
Dusp81.097e-3331.79dual specificity phosphatase 8 [Source:MGI Symbol;... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IID7|DUS10_BOVIN1.688e-3935.91Dual specificity protein phosphatase 10 OS=Bos tau... [more]
sp|Q9ESS0|DUS10_MOUSE1.896e-3936.24Dual specificity protein phosphatase 10 OS=Mus mus... [more]
sp|Q9Y6W6|DUS10_HUMAN1.858e-3835.57Dual specificity protein phosphatase 10 OS=Homo sa... [more]
sp|P28562|DUS1_HUMAN4.250e-3631.51Dual specificity protein phosphatase 1 OS=Homo sap... [more]
sp|P28563|DUS1_MOUSE1.723e-3431.51Dual specificity protein phosphatase 1 OS=Mus musc... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F8WLE50.000e+088.43Mitogen-activated protein kinase phosphatase OS=Du... [more]
A0A4E0RXD53.366e-4554.90Dual specificity protein phosphatase 10 OS=Fasciol... [more]
Q4RQY71.621e-4438.16Chromosome 14 SCAF15003, whole genome shotgun sequ... [more]
A0A210QWH44.970e-4437.88Dual specificity protein phosphatase 10 OS=Mizuhop... [more]
A0A5A9NGM75.418e-4436.54Dual specificity protein phosphatase 10 OS=Triplop... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf1a8.533e-4335.71TATA-box binding protein associated factor, RNA po... [more]
dusp46.532e-3933.55dual specificity phosphatase 4 [Source:NCBI gene;A... [more]
dusp8a3.323e-3836.75dual specificity protein phosphatase 8 [Source:NCB... [more]
dusp26.991e-3731.36dual specificity protein phosphatase 2 [Source:NCB... [more]
dusp27.415e-3731.36dual specificity protein phosphatase 2 [Source:NCB... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004127.11.282e-3833.45pep scaffold:Pmarinus_7.0:GL482725:7128:13243:-1 g... [more]
dusp101.520e-3246.58dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
dusp69.510e-3235.10dual specificity phosphatase 6 [Source:ZFIN;Acc:ZD... [more]
dusp42.382e-3135.07dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp72.486e-3148.20dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
YVH11.171e-1429.90Dual specificity protein phosphatase; regulates gr... [more]
MSG54.177e-1130.82Dual-specificity protein phosphatase; exists in 2 ... [more]
SDP14.510e-1037.84Stress-inducible dual-specificity MAP kinase phosp... [more]
PPS12.438e-836.36Protein phosphatase; has specificity for serine, t... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454321.967e-3840.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492505.963e-3131.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370002.202e-3042.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436896.625e-2731.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471562.496e-2237.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp103.081e-4337.71dual specificity phosphatase 10 [Source:NCBI gene;... [more]
ENSORLT00000014597.23.607e-3734.16dual specificity protein phosphatase 7 [Source:NCB... [more]
dusp23.790e-3741.58dual specificity protein phosphatase 2 [Source:NCB... [more]
dusp8a4.192e-3736.17dual specificity phosphatase 8 [Source:NCBI gene;A... [more]
dusp14.986e-3734.43dual specificity phosphatase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Dual specificity protein phosphatase 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035381.10.000e+099.74SMESG000035381.1[more]
SMESG000078269.14.824e-4233.00SMESG000078269.1[more]
SMESG000063504.16.614e-4235.47SMESG000063504.1[more]
SMESG000030100.13.103e-3537.32SMESG000030100.1[more]
SMESG000016231.17.117e-2642.75SMESG000016231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034946 ID=SMED30034946|Name=Dual specificity protein phosphatase 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1494bp
AATTATTACCAATTAAAATCCAAATTGGGATTGTACATGAGTAAAAGTTA
TTAATTTGGCCTCACCTGATTTATGCATTGCATAATGTTCCTAAAAATAG
CAACCAATAGAATTAATTTATGATGTAGAATAAAATGCTTAGTCATTTGA
CCTGAATACATTTAAAAATCAAAAATTTTAATCAAATTTCAAATTTATCT
CAGGAAATTTTCATTCCATGATTAAATCATCCACTTCGATGCCAACAGAA
TTCATTAGAGAAATCTTCATTCCTCTAGACTCCAATCTATTATCCGAAGA
GCCGTCCCCGACAAAATTTTTAAGAACTTATGACAATTTACGTTGTCCAA
CATCTATTCTCGATGAATCTATGGATTTACTCTGCCACAAAAGCTCTTCG
CTTCACACAATTTCAACTTCAATTCCCGATTCTGAACTCAACAATAAAAT
TGATAAAATCGAATCGGCAGAATTAGAAAAACTTATTTCTACAGATTGCT
CAGTAATTATTCTTGATCTCAGGTCGGCTTATAATTTTTCCAAAATGCAT
ATCACAACAGCAAAATTGGCTAACTGTTCATCTAAAATGAAAAGTAGACG
TGCAATTCAAATCGTCAACGAAATACTCAAAACATCTATAGATCTCCATC
GAATTGTTTTATACACAGAATTTGGGCTGCCTTTCAAACAAGACGACCCA
ATTACTGTATTAATTCAATTTCTTATCGGTCGTTCTATCAATTGTCTTTA
TTTGACAGACAGTTTCAAGAAATTTGAAACGACATATCCAAATTTATGTG
AAAGTGGGTCCTCAAATGTTCTTTGTCTTCATATTCCAAAATCTGTTCCA
GACTTTACTGATATATATTTTACGAAAGCTAGTCTCATTTTGCCGTTTCT
TTACTTAGGTAATGAATTAGATGCCTTAAATTCAACATTTCTCACAAATA
ATAAAATCACCCATGTTCTCAATGTTACAATCAAAGCCTCATTTCTCGAC
GAAATCAAATTTAAAAGCAAAAGAATCAATTGTACTGATAACAATGTACA
AGACCTTATTCAGTTTTTTCCTGATGCATTTAAATTTATCGAATTAGCTC
GAAAATCAAATGGTAGGATTCTTGTCCATTGTCAGGCGGGAATTAGTAGA
TCTGCTACGATAGTTATTGCCTATCTCATGTCTCACTGCAGTAATCTTGA
TCTAAATAATGCTCATCAGTGGGTCAAACGGCGCCGGACTATAATTTCAC
CGAATTTTAATTTTATGGGCCAACTCGTTCAATTTGAAAATGACTTAATC
AACGGCACTTTCAAACGCTGTAACGTACTTAATTTGGATCTGATAACATC
TTCGACATTGTTTACGGGAACTTCAATAAACTATTGAATATGTTTATGTT
TATTTTCAGAAATTATTCTCTACAATTCTTTTGCTTTGTACTTGTTTTGT
TTATTTCTAAATGTATAGATCAATTCTTTTCTGTTGGTCTTGTA
back to top

protein sequence of SMED30034946-orf-1

>SMED30034946-orf-1 ID=SMED30034946-orf-1|Name=SMED30034946-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MIKSSTSMPTEFIREIFIPLDSNLLSEEPSPTKFLRTYDNLRCPTSILDE
SMDLLCHKSSSLHTISTSIPDSELNNKIDKIESAELEKLISTDCSVIILD
LRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDLHRIVLYT
EFGLPFKQDDPITVLIQFLIGRSINCLYLTDSFKKFETTYPNLCESGSSN
VLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHV
LNVTIKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARKSNGR
ILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFM
GQLVQFENDLINGTFKRCNVLNLDLITSSTLFTGTSINY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002056medial muscle cell
PLANA:0002063non-ciliated epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR001763Rhodanese-like_dom
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR029021Prot-tyrosine_phosphatase-like
IPR000340Dual-sp_phosphatase_cat-dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0000188inactivation of MAPK activity
GO:0002819regulation of adaptive immune response
GO:0032496response to lipopolysaccharide
GO:0032873negative regulation of stress-activated MAPK cascade
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0043508negative regulation of JUN kinase activity
GO:0044387negative regulation of protein kinase activity by regulation of protein phosphorylation
GO:0045088regulation of innate immune response
GO:0046329negative regulation of JNK cascade
GO:0048709oligodendrocyte differentiation
GO:0060266negative regulation of respiratory burst involved in inflammatory response
GO:0090335regulation of brown fat cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
GO:0017017MAP kinase tyrosine/serine/threonine phosphatase activity
GO:0033549MAP kinase phosphatase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0016607nuclear speck
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 220..359
e-value: 8.4E-46
score: 168.2
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 220..361
score: 39.153
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 228..358
e-value: 2.0E-36
score: 124.7
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 204..363
e-value: 6.0E-48
score: 164.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 209..360
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 66..199
e-value: 9.1E-12
score: 47.2
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 78..196
NoneNo IPR availablePANTHERPTHR10159DUAL SPECIFICITY PROTEIN PHOSPHATASEcoord: 99..363
NoneNo IPR availableCDDcd14567DSP_DUSP10coord: 222..367
e-value: 9.09569E-58
score: 183.412
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 303..313
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 288..340
score: 14.069