SMED30034943

Overview
NameSMED30034943
Smed IDSMED30034943
Length (bp)2017
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30034943 (SMED30034943) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30034943 (SMED30034943) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30034943 (SMED30034943) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30034943 (SMED30034943) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034943

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034943SMESG000013014.1 Contig4544newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034943SMESG000013014.1 Contig4544uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034943SMESG000016189.1 Contig4544newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034943SMESG000016189.1 Contig4544uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30034943SMESG000013014.1 Contig4544newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034943SMESG000013014.1 Contig4544uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034943SMESG000016189.1 Contig4544newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034943SMESG000016189.1 Contig4544uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30034943SMESG000013014.1 dd_Smed_v6_9781_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30034943SMESG000013014.1 dd_Smed_v6_9781_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30034943SMESG000013014.1 dd_Smed_v6_9781_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30034943SMESG000013014.1 dd_Smed_v6_9781_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30034943 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.017162:1786..3802 -10049
Homology
BLAST of SMED30034943 vs. TrEMBL
Match: A0A267ENF6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009342g1 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.058e-14
Identity = 130/589 (22.07%), Postives = 253/589 (42.95%), Query Frame = 2
Query:   89 ILIFNNQNEPILNIYDD-YFYNLVILPSKARFGNDVEQTSIK--NVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEK--CSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKIL--LQEMW-LMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYF--RQVNERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRF-----SRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLD-------PFVLWID-NKDG-HKYRIVRIFHSTASGLLIPCNVHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSIDKLHYL--------------GTIYGNQLRQNFRIV---LSRHSSSS------DLFERAIKELL---------KVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVLYPGLVHFIVKTRKLHNSLICPVVD 1687
            +++FN+ N+ +    D  Y  NL+     +    ++   S +  +VL+QLFSP++ + N ++ T ++ +  + L N + ++     +  +I +   K  C         +K+L  +E  + S  G  +  +K   E    ++  +   W  +   E    ++ +ER+ +   +K      + + S  R F  R+     ++H LI  G+KL  L+ S E  S   A+D L  + +  ALF +F     SR +EP     N  ++   + +     S  ++ NE  +S+  S      P  S   + +T  +++ +  T+   ST SS   ++       P V  I+ NK    + + + +F +T +  L P   H + +  NV+++ +E  +E       +++  R   + +S   +  D L+ ++  I   +  +  L                 +     +  R V   LSR +  S      DL+  A++ LL          VFE ++ Q+      K+   +C++        RK+++D+L  L +KA RNL+ +S    Y GLVHF +  R+  + ++ P  D
Sbjct:    4 LVVFNSVNDIVFCHADQAYLANLLAAYRGSNEAGEIAGVSRQTLDVLVQLFSPLLTTYN-LMRTQQSAYRRVVLANSEEVVFRRCEDFLMIGVFGSKTFCP-------PAKQLANVERQLRSLVGPYFETLKHYKEGAFSLVGSMVSGWKTLFTHELAFTFSAVERVKVEGSIKA-----KAIESIERGFQRRRRELSGVEHVLIVCGTKLLCLY-STERTSKLVAQDFLTLISLVPALFPKFDVYDESRYKEPEGATFNSCAEPTNSSSNSDVSSAFHSCNEFVLSAPHS------PRSSG--LATTPERINGAFGTSQRQSTSSSGSCIELEHNAHYPLVQQIELNKSSPSESKAMLVFLNTTTSTLSPFKAHFVPMTGNVVFLALEA-VEPRSVARLVDRMHRAADRALSHVSQPVDDLAAMQAAICAELHSVRRLLVELIRTLREPPGVAASFAPACERAMRDVNDHLSRAAPGSEHFRTVDLYLNAVENLLHKLKSSVMKGVFENLFLQF----PFKMTATVCQAVQDLAQACRKDLQDYLPFLDVKARRNLASSSVLANYIGLVHFALVDRR-SDEIVAPTPD 564          
BLAST of SMED30034943 vs. TrEMBL
Match: A0A267DH76 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009342g3 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.017e-13
Identity = 130/589 (22.07%), Postives = 254/589 (43.12%), Query Frame = 2
Query:   89 ILIFNNQNEPILNIYDD-YFYNLVILPSKARFGNDVEQTSIK--NVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEK--CSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKIL--LQEMW-LMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYF--RQVNERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRF-----SRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLD-------PFVLWID-NKDG-HKYRIVRIFHSTASGLLIPCNVHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSIDKLHYL--------------GTIYGNQLRQNFRIV---LSRHSSSS------DLFERAIKELL---------KVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVLYPGLVHFIVKTRKLHNSLICPVVD 1687
            +++FN+ N+ +    D  Y  NL+     +    ++   S +  +VL+QLFSP++ + N ++ T ++ +  + L N + ++     +  +I +   K  C         +K+L  +E  + S  G  +  +K   E    ++  +   W  +   E    ++ +ER+ +   +K      + + S  R F  R+     ++H LI  G+KL  L+ S E  S   A+D L  + +  ALF +F     SR +EP     N  ++   + +     S  ++ NE  +S++ S      P  S   + +T  +++ +  T+   ST SS   ++       P V  I+ NK    + + + +F +T +  L P   H + +  NV+++ +E  +E       +++  R   + +S   +  D L+ ++  I   +  +  L                 +     +  R V   LSR +  S      DL+  A++ LL          VFE ++ Q+      K+   +C++        RK+++D+L  L +KA RNL+ +S    Y GLVHF +  R+  + ++ P  D
Sbjct:   16 LVVFNSVNDIVFCHADQAYLANLLAAYRGSNEAGEIAGVSRQTLDVLVQLFSPLLTTYN-LMRTQQSAYRRVVLANSEEVVFRRCEDFLMIGVFGSKTFCP-------PAKQLANVERQLRSLVGPYFETLKHYKEGAFSLVGSMVSGWKTLFTHELAFTFSAVERVKVEGGIKA-----KAIESIERGFQRRRRELSGVEHVLIVCGTKLLCLY-STERTSKLVAQDFLTLISLVPALFPKFDVYDESRYKEPEGATFNSCAEPTNSSSNSDVSSAFHSCNEFVLSANHS------PRSSG--LATTPERINGAFGTSQRQSTSSSGSCIELEHNAHYPLVQQIELNKSSPSESKAMLVFLNTTTSTLSPFKAHFVPMTGNVVFLALEA-VEPRSVARLVDRMHRAADRALSHVSQPVDDLAAMQAAICAELHSVRRLLVELIRTLREPPGVAASFAPACERAMRDVNDHLSRAAPGSEHFRTVDLYLNAVENLLHKLKSSVMKGVFENLFLQF----PFKMTATVCQAVQDLAQACRKDLQDYLPFLDVKARRNLASSSVLANYIGLVHFALVDRR-SDEIVAPTPD 576          
BLAST of SMED30034943 vs. TrEMBL
Match: A0A1W5BQS3 (Hermansky-Pudlak syndrome 1 protein homolog OS=Ciona intestinalis OX=7719 GN=LOC100180307 PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.301e-11
Identity = 117/554 (21.12%), Postives = 237/554 (42.78%), Query Frame = 2
Query:  197 QTSIKNVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEKCSFRQHTSIISKKLELIEWIICSFYGICW------SQMKFNSERW--LKILLQEMWLMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYFRQV-NERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEITSTVSKLSDS-IKTNSITSTCSSVRDL---DPFVLWIDNK---------DGH---------KYRIVRIFHSTASGLLIPCNVHLIKLAR--NVIYIGVEEDLENNIQLPALEKS------IRLLRKM---------------ISDFDKNSDFLSIIKTR--IGQSIDKLHYLGTIYGNQLRQNFRI-VLSRHSSSSDLFERAIK----ELLKVFELIYCQYYISGTIKVN-EKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVLYPGLVHF--IVKTRKLHNS 1666
            ++S  + +   F P+  S   +   L    S++   +  T+++   +  F+ I +   CS  +    +S++L  +   I   +G C       +Q+      W  +  +LQ+   +   E + +  G+ERI +N    +N+    V+  + + F  + N   +++ L+FVG+K+ +LH S+ A  N   ++ L  + +S+    +     E +   N + SD +L  + I S    +   + P   S+  +E   P     ++TS    LS +  ++ + T   SSVR     D  V  + N          D H         K   + ++ +T     +P  ++ I ++   N+++I          ++P  E S      + LLRK+               +++ +K S  L + KTR   G+S  +L  L + + +  ++N  + V + +   + L E  ++    +L + F+ ++  Y  S   + +   LCK     Y   + ++ D+   L +K  RN++ + +   YPGLVHF  +++TR+   S
Sbjct:   39 ESSFDSYIQMYFLPVFLSHQMLKSQLNEACSSVSSDDQDTVVVFQDFQEFVYIAVETSCSGGKEK--LSRELSFLRNSISFLFGACGHSELKTTQVTTKERAWHSVTTILQQYTSLCELENSFLLEGVERIRVNED--VNKVCNTVIQKSMKSFESLSNLHNVQYGLVFVGAKILTLHASSRARYNLSTQNILQIITLSSLGSGQTDSEHEVK---NEVRSDSELESSEIPS----DIGLDLPFIPSTDDEEDVFPPQEPKDLTSDAGPLSSTGSQSQNETELGSSVRSQYSEDSQVTSVSNNSIRMVNNHFDAHGKENASFNIKNTCIPVYLTTPEHPCLPHLLYCIPISDQVNLVFI---------FKVPHSEVSDMVCGMLDLLRKLKFSDRKLEVIGGQTTVNNLEKCSKLL-VQKTRELKGKSRSRLKRLTSSWNSNGQRNLNMFVNTGNGEYTKLLETCVRDTKEQLRRFFQSLFPSYLTSDATQWHTADLCK----IYKFAKAKLTDYTEYLHVKCTRNITMSPYLATYPGLVHFSLVLRTREQTGS 567          
BLAST of SMED30034943 vs. TrEMBL
Match: A0A158NZG2 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105626226 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.941e-10
Identity = 117/533 (21.95%), Postives = 225/533 (42.21%), Query Frame = 2
Query:  212 NVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEKCSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKILLQEMWL-----MDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYFRQV-NERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPRVQENNLISDKDLTKNLIRSISKDNAANET--PVSSSSSTDEF---FIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLDPF--VLWIDNKDGHKYRIVRIFHSTASGLLIPCNVHLIKLARNVIYIGVEE-----DLENNIQL--------PALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSID--------KLHYLGTIYGNQLR-QNFRIVLSRHSSSSDLFERAIKELLKVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVL------YPGLVHFIVKTRKLHNSLICPVVD 1687
            N++MQLFSPI+ SQ+ M       ++++   +G  ++         + + ++     +HT         +   +     +C   +      W K+ L    L     + N E +++   +E++ +N+  ++   VL+VL       +   +E    H L+ VGSK  SL++S  A  +  A D LL +++                     I +K   +N  +S S DN  ++   P SS   +DE    F  +L+ P  +  ++ L    + +S+    SS+ D D +     +  +  +    V +F  + S  LI     +++     I  G+ +     +L NN+Q         PA E     ++K++    KN       ++ +G  +D        K  ++   Y + LR ++  +VL   +++S   E  +KELL++    + + ++   I V   + +       +VR+++ DF   L +KA++N +  S   +      +PGLVHFI   R  H  L+ P +D
Sbjct:   53 NIIMQLFSPIVTSQHVMASQFGNSYTSMKFQDGTNMVFDEYIGYTFMYIAAKDVELMRHT---------LGVCVSIVQHVCGPDIAILKTNWQKMCLVSSLLDAWSNLRNCEQSMLTEAVEQLSVNA--EVASSVLKVLHDACDKLKNSQSEFSNLHLLLLVGSKFLSLYSSKNA-HDLYASDILLMILLC-------------------WIVNKKRKQN--QSESNDNCCDDILLPESSVLKSDETKLNFGAKLATP-TSEDITDLFRGSRESSVNEGLSSLTDDDLYSQSFLLGCQHNYTANAVHVFELSDSINLIT----IVEATNLSISSGLCDSFHYLNLINNLQFQRDIDEMKPAFEHLDVAIKKVLEGIKKN-------RSNVGNDVDMCQKRLQTKWDFVRKKYSDLLRSRDPEVVLQIEANTSGFVE-TLKELLRL--TCFDKNFLKQGIDVLTTVGR-------LVRQKLNDFSDFLKVKALKNFTLGSSLTINKYLEEFPGLVHFIYIDRNTHR-LVAPTLD 529          
BLAST of SMED30034943 vs. TrEMBL
Match: A0A3L8DPX6 (Uncharacterized protein OS=Ooceraea biroi OX=2015173 GN=DMN91_004735 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.774e-9
Identity = 116/554 (20.94%), Postives = 236/554 (42.60%), Query Frame = 2
Query:   86 SILIFNNQNEPILNIYDDYFYNLVILPSKARFGNDVEQTS-------IKNVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEKCSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKILLQEMWL-----MDNTEFNLMYTGIERIDLNSK-----LKINERVLEVLVSNSRYFRQVNERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEF---FIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLDPF--VLWIDNKDGHKYRIVRIFH----------------STASGLLIPCN-VHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSID--------KLHYLGTIYGNQLRQNFRIVLSRHSSSSDLFERAIKELLKVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSF 1606
            +ILIF+N N+ +    D  F + ++  +K +   D + TS         N++MQLFSPI+ SQ+ M       ++++   +G  ++         + + +++    + T  I   + ++         +C   +      W K  L    L     + N E +++   IE++ +N++     LK+     + L S+   F  +      H LI VGSK  SL++S  A  +  A D LL +++ + +    ++ R+   + N+  +D D+                 P +S+S +DE    F  +L+ P  +  ++ L    + +S+    SS+ D D +  +L +  +  +    V IF                 ST+SGL   C+  H + +  N+ +    ++L+     PA E     ++K++    KN       ++ +G  +D        K  ++   Y + LR     V+ +  +++  F   +KELL++    + + ++   I V   + +       +VR+++ DF   L +KA++N +  S+
Sbjct:    3 AILIFDNLNDVLFVKCDKKFASHILKLAKTQGLLDDKDTSNLENSIPSPNIIMQLFSPIVTSQHLMASQFGNSYTSMKFQDGTNMVFDEYIGYTFMYIAAKEIDLMRRT--IGVGVSIVRH-------VCGPDVAILKTNWQKACLVSSLLDAWSDLRNYEQSMLIEAIEQLSVNTEVASSVLKVLHDACDKLKSSQAEFSNL------HMLILVGSKFLSLYSSKNA-HDLCASDILLMILLCSVI----NKKRKRDSENNDESNDNDIL---------------LPDNSASKSDEVKINFGAKLATP-TSEDITDLFKGSRESSVNENLSSLTDEDLYSQLLLLGCQHNYTANTVHIFELSDSINLITIVEATNLSTSSGL---CDSFHYLDVINNLQFQRAFDELK-----PAFENLDGAIKKVLEGIRKN-------RSNVGNDVDMCQKRLQTKWDFVRKKYNDLLRSRDPEVILQIEANTTGFVETLKELLRL--TCFDRNFLKQGIDVLTTVGR-------LVRQKLNDFSDFLKVKALKNFTLGSY 496          
BLAST of SMED30034943 vs. Planmine SMEST
Match: SMESG000013014.1 (SMESG000013014.1)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 629/630 (99.84%), Postives = 630/630 (100.00%), Query Frame = 2
Query:   80 FHSILIFNNQNEPILNIYDDYFYNLVILPSKARFGNDVEQTSIKNVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEKCSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKILLQEMWLMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYFRQVNERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLDPFVLWIDNKDGHKYRIVRIFHSTASGLLIPCNVHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSIDKLHYLGTIYGNQLRQNFRIVLSRHSSSSDLFERAIKELLKVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVLYPGLVHFIVKTRKLHNSLICPVVDQDYLSDFKIQRLHLLADLCQKIGTQMELSSTWRHIEICDRYFRCTYVKQKYKILEDKYHEFELTVFHLSEVSLSLVKKQISLLMNQFLPDQRGA 1969
            FHSILIFNNQNEPILNIYDDYFYNLVILPSKARFGNDVEQTSIKNVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEKCSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKILLQEMWLMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYFRQVNERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLDPFVLWIDNKDGHKYRIVRIFHS+ASGLLIPCNVHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSIDKLHYLGTIYGNQLRQNFRIVLSRHSSSSDLFERAIKELLKVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVLYPGLVHFIVKTRKLHNSLICPVVDQDYLSDFKIQRLHLLADLCQKIGTQMELSSTWRHIEICDRYFRCTYVKQKYKILEDKYHEFELTVFHLSEVSLSLVKKQISLLMNQFLPDQRGA
Sbjct:    8 FHSILIFNNQNEPILNIYDDYFYNLVILPSKARFGNDVEQTSIKNVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIILLSEKCSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKILLQEMWLMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYFRQVNERKIKHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPRVQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEITSTVSKLSDSIKTNSITSTCSSVRDLDPFVLWIDNKDGHKYRIVRIFHSSASGLLIPCNVHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISDFDKNSDFLSIIKTRIGQSIDKLHYLGTIYGNQLRQNFRIVLSRHSSSSDLFERAIKELLKVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFLSILSIKAIRNLSPTSFYVLYPGLVHFIVKTRKLHNSLICPVVDQDYLSDFKIQRLHLLADLCQKIGTQMELSSTWRHIEICDRYFRCTYVKQKYKILEDKYHEFELTVFHLSEVSLSLVKKQISLLMNQFLPDQRGA 637          
The following BLAST results are available for this feature:
BLAST of SMED30034943 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ENF67.058e-1422.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DH761.017e-1322.07Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1W5BQS32.301e-1121.12Hermansky-Pudlak syndrome 1 protein homolog OS=Cio... [more]
A0A158NZG27.941e-1021.95Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
A0A3L8DPX63.774e-920.94Uncharacterized protein OS=Ooceraea biroi OX=20151... [more]
back to top
BLAST of SMED30034943 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30034943 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013014.10.000e+099.84SMESG000013014.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034943 ID=SMED30034943|Name=SMED30034943|organism=Schmidtea mediterranea sexual|type=transcript|length=2017bp
ATCGGATCGATCAAAGGTTGAATCGATTTCAAGAACAATCTATGAAATCA
ATAATTAAATGGAATCTAATAATGAAATATTTCATTCTATATTAATATTT
AACAATCAAAACGAACCAATTCTGAATATCTACGATGACTATTTTTATAA
TCTCGTTATCTTACCAAGCAAGGCTCGATTTGGAAACGATGTGGAACAAA
CGTCGATTAAAAACGTTCTCATGCAACTATTTTCTCCCATAATCGCTTCA
CAGAACGCCATGATAGATACTTTGAAGACGAAATTCTCAGCGATAGATTT
GTTCAATGGACAGACGTTAATTCTCCACAATGTCTACAACTGTTTTCTGA
TTATTCTACTATCTGAAAAGTGCTCATTTCGACAGCACACATCGATCATA
AGCAAAAAGCTGGAGTTGATAGAATGGATCATTTGTAGTTTTTATGGAAT
TTGTTGGAGTCAGATGAAATTCAACAGTGAGAGATGGCTGAAAATATTAC
TCCAGGAAATGTGGCTCATGGATAATACGGAGTTCAATTTGATGTATACC
GGCATTGAAAGGATTGATTTGAATTCAAAACTGAAAATAAACGAAAGGGT
TCTGGAGGTTTTGGTAAGCAATTCGAGATATTTTCGACAAGTAAACGAAA
GAAAAATCAAGCATCAATTAATTTTCGTTGGGTCTAAATTATTTTCTCTT
CATACCAGCAATGAAGCATTGAGTAATTTTAAAGCAAAGGATAACTTACT
TTTTGTTATAATTAGCAACGCGCTCTTCAATCGGTTTTCAAGAGCAAGAG
AGCCTCGGGTTCAGGAGAATAATTTGATCAGCGATAAAGACCTAACGAAA
AATTTAATTAGATCGATTTCCAAAGACAACGCTGCAAATGAAACTCCCGT
CAGTAGTTCTTCCTCAACTGATGAATTTTTTATCCCAGAATTATCCGATC
CTGAAATTACATCGACTGTTAGTAAATTATCTGATTCGATTAAAACAAAC
TCTATAACTTCAACTTGCTCGTCTGTTAGGGACCTTGATCCTTTTGTTTT
GTGGATTGATAACAAGGATGGACATAAATACAGAATCGTGAGAATATTCC
ACAGTACCGCCAGTGGTTTATTAATCCCATGCAATGTACATTTGATTAAA
CTAGCCAGAAATGTGATATATATTGGAGTTGAAGAAGACCTGGAAAATAA
CATTCAACTACCGGCCTTGGAAAAAAGTATTCGATTACTCAGGAAAATGA
TTTCCGACTTTGACAAAAATTCAGATTTTTTGTCAATTATTAAAACAAGA
ATAGGACAGTCGATTGATAAGCTCCATTATCTTGGAACGATTTATGGTAA
CCAGTTGCGACAGAATTTTCGGATAGTTTTATCGAGACATTCCAGTTCGT
CGGATTTGTTTGAGAGAGCAATCAAAGAGTTGCTCAAAGTTTTTGAACTC
ATTTATTGTCAGTATTATATTTCAGGTACAATAAAAGTCAACGAAAAACT
CTGTAAATCTTTTTTGCGCTGTTATTCTATGGTTCGAAAAGAAATGGAAG
ACTTTTTGTCAATTCTAAGTATAAAAGCAATTAGAAATTTGTCTCCGACA
TCATTTTACGTTCTTTATCCCGGTCTTGTGCACTTTATTGTCAAAACTCG
AAAACTCCATAATTCTTTGATTTGTCCGGTAGTCGATCAGGATTATTTGT
CGGATTTTAAAATCCAAAGGTTGCATCTACTCGCTGATTTGTGTCAGAAA
ATCGGAACTCAAATGGAATTGTCCAGCACTTGGAGGCACATTGAGATTTG
TGATCGGTATTTTCGGTGCACTTACGTCAAGCAGAAATACAAAATACTCG
AAGACAAATACCACGAATTTGAACTGACAGTGTTTCATTTGTCTGAGGTC
AGCCTTTCGTTGGTAAAGAAACAAATAAGTCTTTTGATGAATCAGTTCTT
GCCAGATCAGAGGGGAGCTGATAGCACTTTATTGGATTTAATGAGTTAAA
TTTTGATTTTACTGTAG
back to top

protein sequence of SMED30034943-orf-1

>SMED30034943-orf-1 ID=SMED30034943-orf-1|Name=SMED30034943-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=647bp
MESNNEIFHSILIFNNQNEPILNIYDDYFYNLVILPSKARFGNDVEQTSI
KNVLMQLFSPIIASQNAMIDTLKTKFSAIDLFNGQTLILHNVYNCFLIIL
LSEKCSFRQHTSIISKKLELIEWIICSFYGICWSQMKFNSERWLKILLQE
MWLMDNTEFNLMYTGIERIDLNSKLKINERVLEVLVSNSRYFRQVNERKI
KHQLIFVGSKLFSLHTSNEALSNFKAKDNLLFVIISNALFNRFSRAREPR
VQENNLISDKDLTKNLIRSISKDNAANETPVSSSSSTDEFFIPELSDPEI
TSTVSKLSDSIKTNSITSTCSSVRDLDPFVLWIDNKDGHKYRIVRIFHST
ASGLLIPCNVHLIKLARNVIYIGVEEDLENNIQLPALEKSIRLLRKMISD
FDKNSDFLSIIKTRIGQSIDKLHYLGTIYGNQLRQNFRIVLSRHSSSSDL
FERAIKELLKVFELIYCQYYISGTIKVNEKLCKSFLRCYSMVRKEMEDFL
SILSIKAIRNLSPTSFYVLYPGLVHFIVKTRKLHNSLICPVVDQDYLSDF
KIQRLHLLADLCQKIGTQMELSSTWRHIEICDRYFRCTYVKQKYKILEDK
YHEFELTVFHLSEVSLSLVKKQISLLMNQFLPDQRGADSTLLDLMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000039gamma neoblast
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR026053HPS1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026053Hermansky-Pudlak syndrome 1 proteinPANTHERPTHR12761HERMANSKY-PUDLAK SYNDROME PROTEIN 1coord: 43..544