GCR005

Overview
NameGCR005
Smed IDSMED30034938
Length (bp)1564
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR005 (SMED30034938) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR005 (SMED30034938) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034938

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30034938SMESG000081069.1 Contig5960newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30034938SMESG000081069.1 Contig5960uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30034938SMESG000081069.1 SmedASXL_000086SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034938SMESG000081069.1 dd_Smed_v6_79595_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034938SMESG000081069.1 dd_Smed_v6_67188_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30034938SMESG000081069.1 dd_Smed_v6_78619_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR005 vs. Ensembl Human
Match: ADRA1D (adrenoceptor alpha 1D [Source:HGNC Symbol;Acc:HGNC:280])

HSP 1 Score: 130.183 bits (326), Expect = 1.280e-31
Identity = 74/210 (35.24%), Postives = 110/210 (52.38%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKT--IIMRVHCGGFRTDSSS 949
            TN FI+NLAV+DLLL   VLP S   +VL   W FG A C +W A DVL CTASIL+L  IS DRY+ +R+ ++Y + MT +    +L  +W+ A ++S   +L               V P              C IT+ + GY ++S+  S+Y+P+ V+V  Y  ++  A  T   +  G +K   GK   +++R+HC G  T +  
Sbjct:  131 TNYFIVNLAVADLLLSATVLPFSATMEVLGF-WAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWK----------EPVPPDERF----------CGITEEA-GYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAG-VKRERGKASEVVLRIHCRGAATGADG 317          

HSP 2 Score: 68.9366 bits (167), Expect = 9.953e-12
Identity = 35/81 (43.21%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSW--FDGVFWLGYCNSLLNPWIYALFSKDFRLAY 1497
            + V L +  RE KAA+ L I+ G F+LCW PFF V   G+ +  +  S   F  +FWLGY NS +NP IY   S++F+ A+
Sbjct:  333 LSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAF 413          
BLAST of GCR005 vs. Ensembl Human
Match: ADRA1B (adrenoceptor alpha 1B [Source:HGNC Symbol;Acc:HGNC:278])

HSP 1 Score: 126.331 bits (316), Expect = 1.594e-30
Identity = 83/247 (33.60%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKN-RDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNK 1054
            R  TN FI+NLA++DLLL   VLP S   +VL   W  G   C IW A DVL CTASIL+L  IS DRYI +R  ++Y + +T +   + L SVW+ + +IS            ++  K    N  +            C +T+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K   + K + +R+H   F  D+      L S+   G      PR  I+   FKF  + K
Sbjct:   77 RTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISI---------GPLLGWKEPAPNDDKE-----------CGVTE-EPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDT------LSSTKAKGH----NPRSSIAVKLFKFSREKK 291          

HSP 2 Score: 85.5001 bits (210), Expect = 4.752e-17
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = 1
Query: 1189 EIKC*LH*FNQNKRSLTQTSEIKIIP-----VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            E+   +H  N ++ +L+ T      P     V L +  RE KAA+ LGI+ G FILCWLPFFI    G+ +  +  PD+ F  VFWLGY NS LNP IY   SK+F+ A+ R L
Sbjct:  250 ELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRIL 363          
BLAST of GCR005 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 120.939 bits (302), Expect = 1.039e-29
Identity = 68/199 (34.17%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVH 919
            T+ +I+NLAV+DLLL   VLP S   +VL   W FG   C IW A DVL CTASI+ L +IS DRYI +  P+RY + +T +   + L  VW  + +IS                    + P             IC I +  PGY+++SA GS+Y+PL +++  Y  ++  A +   G+  G +    D + + +R+H
Sbjct:   61 THYYIVNLAVADLLLTSTVLPFSAIFEVLGY-WAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVIS--------------------IGPLFGWRQPAPEDETICQINEE-PGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIH 237          
BLAST of GCR005 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 122.479 bits (306), Expect = 2.195e-29
Identity = 68/199 (34.17%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVH 919
            T+ +I+NLAV+DLLL   VLP S   +VL   W FG   C IW A DVL CTASI+ L +IS DRYI +  P+RY + +T +   + L  VW  + +IS                    + P             IC I +  PGY+++SA GS+Y+PL +++  Y  ++  A +   G+  G +    D + + +R+H
Sbjct:   61 THYYIVNLAVADLLLTSTVLPFSAIFEVLGY-WAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVIS--------------------IGPLFGWRQPAPEDETICQINEE-PGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIH 237          

HSP 2 Score: 81.2629 bits (199), Expect = 1.013e-15
Identity = 42/92 (45.65%), Postives = 59/92 (64.13%), Query Frame = 1
Query: 1267 VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRF-----LCRKR 1521
            V L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+F+ +    ++ F  VFWLGY NS +NP IY   S++F+ A++       LCRK+
Sbjct:  259 VRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQ 350          
BLAST of GCR005 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 122.094 bits (305), Expect = 2.208e-29
Identity = 68/199 (34.17%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVH 919
            T+ +I+NLAV+DLLL   VLP S   +VL   W FG   C IW A DVL CTASI+ L +IS DRYI +  P+RY + +T +   + L  VW  + +IS                    + P             IC I +  PGY+++SA GS+Y+PL +++  Y  ++  A +   G+  G +    D + + +R+H
Sbjct:   61 THYYIVNLAVADLLLTSTVLPFSAIFEVLGY-WAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVIS--------------------IGPLFGWRQPAPEDETICQINEE-PGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIH 237          

HSP 2 Score: 81.2629 bits (199), Expect = 9.268e-16
Identity = 42/92 (45.65%), Postives = 59/92 (64.13%), Query Frame = 1
Query: 1267 VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRF-----LCRKR 1521
            V L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+F+ +    ++ F  VFWLGY NS +NP IY   S++F+ A++       LCRK+
Sbjct:  259 VRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQ 350          
BLAST of GCR005 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 132.109 bits (331), Expect = 4.292e-33
Identity = 82/211 (38.86%), Postives = 122/211 (57.82%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTIC----GIAKGRLKNRDGKT 901
            V+++     ++R + TNI + +LA +DLL+G+IV+P+S+ + + N RW  G  LC++W  SDVLLCTASILNL VIS DRY AI +P++Y    + K    LLT+VW  +F++  P  +   +     N+ I + N T +      S    C+ + S   Y IYSA GS+Y+PL+VM++ Y  IF  A +        +   RL NR  KT
Sbjct:   13 VVLSVVVYKRMRTF-TNILLTSLATADLLVGLIVMPMSLLDLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSW-----NLFIDNNNNTGS------SEDFKCAYSPSV-AYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKT 210          

HSP 2 Score: 67.3958 bits (163), Expect = 1.092e-11
Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN---------IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            RE KA + +GI+   FI+CW+PFFI+Y+   F  +         I   +F    WLGY NS+LNP IY +++ DFR  +R  L
Sbjct:  382 RERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFF---LWLGYSNSVLNPIIYTMYNGDFRRCFRDLL 461          
BLAST of GCR005 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 131.724 bits (330), Expect = 1.327e-32
Identity = 82/211 (38.86%), Postives = 122/211 (57.82%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTIC----GIAKGRLKNRDGKT 901
            V+++     ++R + TNI + +LA +DLL+G+IV+P+S+ + + N RW  G  LC++W  SDVLLCTASILNL VIS DRY AI +P++Y    + K    LLT+VW  +F++  P  +   +     N+ I + N T +      S    C+ + S   Y IYSA GS+Y+PL+VM++ Y  IF  A +        +   RL NR  KT
Sbjct:   92 VVLSVVVYKRMRTF-TNILLTSLATADLLVGLIVMPMSLLDLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSW-----NLFIDNNNNTGS------SEDFKCAYSPSV-AYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKT 289          

HSP 2 Score: 67.0106 bits (162), Expect = 1.404e-11
Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN---------IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            RE KA + +GI+   FI+CW+PFFI+Y+   F  +         I   +F    WLGY NS+LNP IY +++ DFR  +R  L
Sbjct:  461 RERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFF---LWLGYSNSVLNPIIYTMYNGDFRRCFRDLL 540          
BLAST of GCR005 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 130.954 bits (328), Expect = 2.407e-32
Identity = 82/211 (38.86%), Postives = 122/211 (57.82%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTIC----GIAKGRLKNRDGKT 901
            V+++     ++R + TNI + +LA +DLL+G+IV+P+S+ + + N RW  G  LC++W  SDVLLCTASILNL VIS DRY AI +P++Y    + K    LLT+VW  +F++  P  +   +     N+ I + N T +      S    C+ + S   Y IYSA GS+Y+PL+VM++ Y  IF  A +        +   RL NR  KT
Sbjct:  120 VVLSVVVYKRMRTF-TNILLTSLATADLLVGLIVMPMSLLDLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSW-----NLFIDNNNNTGS------SEDFKCAYSPSV-AYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKT 317          

HSP 2 Score: 67.0106 bits (162), Expect = 1.831e-11
Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN---------IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            RE KA + +GI+   FI+CW+PFFI+Y+   F  +         I   +F    WLGY NS+LNP IY +++ DFR  +R  L
Sbjct:  489 RERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFF---LWLGYSNSVLNPIIYTMYNGDFRRCFRDLL 568          
BLAST of GCR005 vs. Ensembl Celegans
Match: ser-3 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:O44986])

HSP 1 Score: 120.168 bits (300), Expect = 1.187e-28
Identity = 70/198 (35.35%), Postives = 106/198 (53.54%), Query Frame = 2
Query:  287 IAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRL 880
            IAA    +  R  T + I++LA++DLL+G ++LP SI N+VL++ W FG   C IWL  D+ +CTASI NL  IS DRYIAI  P+ Y   +T    +  +  VWI +F+I  P+           +IK  +  P R            C+  ++   Y+++SA  S+YIP+I++V+ Y  I+  A      I  G +
Sbjct:   80 IAAVLLRRRLRSATGLLILSLALADLLVGTVILPFSIANEVLDQYWIFGETWCTIWLTLDIWMCTASIYNLVAISIDRYIAIIKPLNYPMLVTKFRARCTVAIVWIGSFLICSPSFFLAS------SIKDKET-PCR------------CTPANAGRVYVVFSASSSFYIPMIIVVFVYFRIYVAARAATKSIYSGMM 258          

HSP 2 Score: 68.9366 bits (167), Expect = 4.281e-12
Identity = 34/78 (43.59%), Postives = 48/78 (61.54%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            R+  E KAA+ + I+ G FI CWL F +VY        + D  +  VFWLGY NS LNP IY +F+++FR+ ++R L 
Sbjct:  477 RLSLEIKAAKTVAIVTGCFIFCWLGFALVY---GLEIKLNDVVWSIVFWLGYLNSALNPVIYTVFNREFRICFKRLLT 551          
BLAST of GCR005 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 117.857 bits (294), Expect = 1.286e-28
Identity = 78/299 (26.09%), Postives = 145/299 (48.49%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPF--KFCCQ-----NKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQR 1156
            V++      KLR  + N  I++LAV+D+L+G++V+PL++  +++   W  GN LC+IWLA DVL  TASIL++  IS DRY ++ +P+ Y +  T     I +   WI + +I  P I                  P R            CS++ +  GY++YS+ GS+YIP+++++  YA I++   +     ++ RLK  + +   + +     R+ ++ +       +E    I+      ++N     K C Q      ++P    K + + +++  P  D  + +E   F ++
Sbjct:   42 VVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGE-WTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGW--------------RPERA--------EGECSVS-TDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRH----SRQRLKETERRDHTLNMLT--IRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEK 310          

HSP 2 Score: 80.8777 bits (198), Expect = 3.580e-16
Identity = 39/77 (50.65%), Postives = 52/77 (67.53%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRK 1518
            +E +A  +LGII  AFIL WLPFF++YV GAF    P   F   FWLGYCNS +NP IY +F+++F    +R LC++
Sbjct:  318 KERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREF----KRGLCKQ 390          
BLAST of GCR005 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085468)

HSP 1 Score: 120.168 bits (300), Expect = 1.099e-28
Identity = 79/227 (34.80%), Postives = 117/227 (51.54%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATA---HKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSK 952
            ++I A    +     TN FI +LAV+D L+G++V+P S   +VL   WFFG   C IW + DVL  TASILNL VIS DRY AI +P  Y   MT K    L+ +VWI +  ISFP I   V+     + ++                   C+ T+   GY+++S+  S+Y+PL+VMV+ Y  I+  A    +++    K  L       + +R+H GG   D  ++
Sbjct:  128 LVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAI---VWWRAARDGEMPAYK---------------CTFTEHL-GYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQ 335          

HSP 2 Score: 63.5438 bits (153), Expect = 2.625e-10
Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 1
Query: 1312 LGIICGAFILCWLPFFIVYVTGAF------YKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            LGI+ G FI+CWLPFF+V +   F      ++ I  +    V WLG+ NS +NP IYA +S+DFR A+ R LC
Sbjct:  421 LGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAI---VTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of GCR005 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085467)

HSP 1 Score: 119.783 bits (299), Expect = 1.318e-28
Identity = 79/227 (34.80%), Postives = 117/227 (51.54%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATA---HKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSK 952
            ++I A    +     TN FI +LAV+D L+G++V+P S   +VL   WFFG   C IW + DVL  TASILNL VIS DRY AI +P  Y   MT K    L+ +VWI +  ISFP I   V+     + ++                   C+ T+   GY+++S+  S+Y+PL+VMV+ Y  I+  A    +++    K  L       + +R+H GG   D  ++
Sbjct:  128 LVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAI---VWWRAARDGEMPAYK---------------CTFTEHL-GYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQ 335          

HSP 2 Score: 63.5438 bits (153), Expect = 2.275e-10
Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 1
Query: 1312 LGIICGAFILCWLPFFIVYVTGAF------YKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            LGI+ G FI+CWLPFF+V +   F      ++ I  +    V WLG+ NS +NP IYA +S+DFR A+ R LC
Sbjct:  421 LGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAI---VTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of GCR005 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0330293)

HSP 1 Score: 120.553 bits (301), Expect = 2.164e-28
Identity = 77/212 (36.32%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATA--HKTICGIAKGRLKNRDGK-TIIMRVHCGGFRTDSSSK 952
            TN FI +LAV+D L+G++V+P S   +VL   WFFG   C IW + DVL  TASILNL VIS DRY AI +P  Y   MT K    L+ +VWI +  ISFP I   V+     + ++                   C+ T+   GY+++S+  S+Y+PL+VMV+ Y  I+  A        I   ++    G+  + +R+H GG   D  ++
Sbjct:  143 TNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAI---VWWRAARDGEMPAYK---------------CTFTEHL-GYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQ 335          

HSP 2 Score: 64.3142 bits (155), Expect = 1.651e-10
Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 1
Query: 1312 LGIICGAFILCWLPFFIVYVTGAF------YKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            LGI+ G FI+CWLPFF+V +   F      ++ I  +    V WLG+ NS +NP IYA +S+DFR A+ R LC
Sbjct:  421 LGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAI---VTWLGWINSCMNPVIYACWSRDFRRAFVRLLC 490          
BLAST of GCR005 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 119.013 bits (297), Expect = 3.345e-28
Identity = 86/243 (35.39%), Postives = 135/243 (55.56%), Query Frame = 2
Query:  128 NNINLRMEADYLLKSKDFLARKYVGFPSVESVFXXXXXXXXXXXXXXXXXXVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTI 856
            +N  L   +D  L  ++F A ++V  P + S+F+  VL+++ L  ++GN+LV IA     KLRR   N  +++LA+SDL + ++V+P+++  +VL + W FG  LC IW++ DVL CTASILNL  IS DRY+AI  P+ Y    T +   + +  VW+ A  IS P +L L  ++                   +     IC++  +   Y IY+  GS+YIPL VM++ Y  IF  A + +
Sbjct:  133 SNTTLVPLSDTPLLLEEFAAGEFV-LPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRR-PCNYLLVSLALSDLCVALLVMPMALLYEVLEK-WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEH------------------EDEEGQPICTVCQNF-AYQIYATLGSFYIPLSVMLFVYYQIFRAARRIV 353          

HSP 2 Score: 75.0998 bits (183), Expect = 6.070e-14
Identity = 36/78 (46.15%), Postives = 49/78 (62.82%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK-NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            ++ +E KA+  LGII  AF +CWLPFFI+ +   F   ++P S      WLGY NSLLNP IYA  ++DFR  ++  L
Sbjct:  445 QLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL 522          
BLAST of GCR005 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0085746)

HSP 1 Score: 119.013 bits (297), Expect = 3.345e-28
Identity = 86/243 (35.39%), Postives = 135/243 (55.56%), Query Frame = 2
Query:  128 NNINLRMEADYLLKSKDFLARKYVGFPSVESVFXXXXXXXXXXXXXXXXXXVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTI 856
            +N  L   +D  L  ++F A ++V  P + S+F+  VL+++ L  ++GN+LV IA     KLRR   N  +++LA+SDL + ++V+P+++  +VL + W FG  LC IW++ DVL CTASILNL  IS DRY+AI  P+ Y    T +   + +  VW+ A  IS P +L L  ++                   +     IC++  +   Y IY+  GS+YIPL VM++ Y  IF  A + +
Sbjct:  133 SNTTLVPLSDTPLLLEEFAAGEFV-LPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRR-PCNYLLVSLALSDLCVALLVMPMALLYEVLEK-WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEH------------------EDEEGQPICTVCQNF-AYQIYATLGSFYIPLSVMLFVYYQIFRAARRIV 353          

HSP 2 Score: 75.0998 bits (183), Expect = 6.070e-14
Identity = 36/78 (46.15%), Postives = 49/78 (62.82%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK-NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            ++ +E KA+  LGII  AF +CWLPFFI+ +   F   ++P S      WLGY NSLLNP IYA  ++DFR  ++  L
Sbjct:  445 QLAKEKKASTTLGIIMSAFTVCWLPFFILALIRPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL 522          
BLAST of GCR005 vs. Ensembl Zebrafish
Match: adra1d (adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-090312-203])

HSP 1 Score: 143.28 bits (360), Expect = 9.978e-37
Identity = 79/212 (37.26%), Postives = 118/212 (55.66%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRD-GKTIIMRVHCGGFRTDSSSKSQ 958
            TN FI+NLA++DLLL IIVLP S   +VL   W FG   C IW A DVL CTASIL+L VIS DRYI +++ ++Y + MT +   ++L  VW+ + +IS                    + P         S  +IC IT+  PGY ++S+  S+Y+PL+V++  Y  ++  A +T   +  G  + RD    +++R+HC     DSS+ S+
Sbjct:   71 TNFFIVNLAIADLLLSIIVLPFSASLEVLGC-WVFGRVFCNIWAAVDVLCCTASILSLCVISIDRYIGVKHCLKYPTIMTERKAGVILVLVWVSSMVIS--------------------IGPLLGWKEPPPSDESICRITE-EPGYALFSSLFSFYLPLMVILVMYIRVYIVARRTTKSLEAGVKRERDKSMEVVLRIHCRSMPEDSSTSSK 260          

HSP 2 Score: 74.7146 bits (182), Expect = 7.460e-14
Identity = 39/81 (48.15%), Postives = 51/81 (62.96%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAY 1497
            + V L +  RE KAA+ L I+ G FILCWLPFF V   G+F+  +   D  F  +FWLGY NS +NP IY   SK+F+ A+
Sbjct:  270 LSVRLMKFSREKKAAKTLAIVVGMFILCWLPFFFVLPLGSFFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAF 350          
BLAST of GCR005 vs. Ensembl Zebrafish
Match: adra1ba (adrenoceptor alpha 1Ba [Source:ZFIN;Acc:ZDB-GENE-120510-1])

HSP 1 Score: 141.354 bits (355), Expect = 4.390e-36
Identity = 83/220 (37.73%), Postives = 118/220 (53.64%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNR-DGKTIIMRVHCGGFRTDSSSKSQCLESS 973
            R  TN FIINLA++DLLL   VLP+S   ++LN  W FG   C IW A DVL CTASI++L VIS DRYI +R P++Y S +T K   + +  VW+ AF+IS   +L                 P+ +          +C IT+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K R D   + +R+H  G +T        L SS
Sbjct:   74 RIPTNYFIINLAMADLLLSTTVLPVSATREILNY-WVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLAFVISIGPLLGW------------KEPPSED--------DTVCLITEE-PFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTKNLEAGVMKERMDSNELTLRIHYKGSQTQEDCSKGHLRSS 271          

HSP 2 Score: 84.7297 bits (208), Expect = 4.340e-17
Identity = 41/100 (41.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query: 1216 NQNKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            +Q +   ++      + V L +  RE KAA+ LG++ G FILCWLPFF+    G+F  ++  P+++F  +FWLGY NS LNP IY  +S++F+ A+ R L
Sbjct:  257 SQTQEDCSKGHLRSSLTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGSFNTSLRPPETFFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRIL 356          
BLAST of GCR005 vs. Ensembl Zebrafish
Match: adra1aa (adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-2831])

HSP 1 Score: 133.65 bits (335), Expect = 2.015e-33
Identity = 74/205 (36.10%), Postives = 111/205 (54.15%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGR--LKNRDGKTIIMRVHCG 925
            R  T+ FI+NLAV+DLLL   VLP S   ++L R W FG   C +W A DVL CTASI++L VIS DRYI +  P++Y S +T +   + L ++W+ +  IS                    + P            +IC IT+  PGY I+SA GS+Y+PL+V++  Y  ++  A +   G+  G+   K+   +T+ +R+H G
Sbjct:   72 RTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGR-WIFGRPFCDVWAAMDVLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITIS--------------------IGPLFGWKEPAPDDESICKITE-EPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETRGLISGQKTEKSDHAETVTLRIHRG 254          

HSP 2 Score: 74.3294 bits (181), Expect = 1.214e-13
Identity = 36/77 (46.75%), Postives = 49/77 (63.64%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN--IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAY 1497
            L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+ +      D+ F   FWLGY NS +NP IY   S++F+ A+
Sbjct:  274 LLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAF 350          
BLAST of GCR005 vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 131.339 bits (329), Expect = 1.075e-32
Identity = 84/269 (31.23%), Postives = 137/269 (50.93%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDE-TGKLIQSTPRHRISNC------PFKFCCQNKIPF--TTPKFSFNKS 1093
            R  TN FI+NLA++DLLLG  VLP+S   +V+   W FG   C +W A DVL CTASI++L VIS DRYI + +P++Y + +T +   + +  VW+ + +IS                    + P             +C+I +  P Y ++S+ GS+YIPLIV++  Y  ++  A +T   +  G + ++ +   I +R+H G    + + KS+  ++ +  T KL++ +   + +         F  C    +PF  T P  SFN S
Sbjct:   79 RSPTNYFIVNLAIADLLLGTTVLPVSATLEVVGH-WVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVIS--------------------IGPLLGWKEPPSPDDTVCAINEE-PFYALFSSLGSFYIPLIVILVMYCRVYVVAKRTTKNLEAGVKTESMNSGEITLRIHRGSQVHEDAGKSRAHQARNSLTVKLLKFSREKKAAKTLGVVVGMFTLCW---LPFFLTLPIVSFNTS 322          

HSP 2 Score: 78.5666 bits (192), Expect = 5.015e-15
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 1
Query: 1216 NQNKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL---CRKR 1521
            +Q + SLT         V L +  RE KAA+ LG++ G F LCWLPFF+     +F  ++  P++    +FWLGY NS LNP IY  +S++F+LA+ R L   C +R
Sbjct:  273 HQARNSLT---------VKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPETVSSIIFWLGYFNSCLNPIIYPCYSREFKLAFIRILKCRCHRR 370          
BLAST of GCR005 vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 129.798 bits (325), Expect = 3.628e-32
Identity = 84/269 (31.23%), Postives = 136/269 (50.56%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDE-TGKLIQSTPRHRISNC------PFKFCCQNKIPF--TTPKFSFNKS 1093
            R  TN FI+NLA++DLLLG  VLP+S   +V+   W FG   C +W A DVL CTASI++L VIS DRYI + +P++Y + +T +   + +  VW+ + +IS                    + P             +C+I +  P Y ++S+ GS+YIPLIV++  Y  ++  A  T   +  G + ++ +   I +R+H G    + + KS+  ++ +  T KL++ +   + +         F  C    +PF  T P  SFN S
Sbjct:   79 RSPTNYFIVNLAIADLLLGTTVLPVSATLEVVGH-WVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVIS--------------------IGPLLGWKEPPSPDDTVCAINEE-PFYALFSSLGSFYIPLIVILVMYCRVYVVAKMTTKNLEAGVKTESMNSGEITLRIHRGSQVHEDAGKSRAHQARNSLTVKLLKFSREKKAAKTLGVVVGMFTLCW---LPFFLTLPIVSFNTS 322          

HSP 2 Score: 78.5666 bits (192), Expect = 4.970e-15
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 1
Query: 1216 NQNKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL---CRKR 1521
            +Q + SLT         V L +  RE KAA+ LG++ G F LCWLPFF+     +F  ++  P++    +FWLGY NS LNP IY  +S++F+LA+ R L   C +R
Sbjct:  273 HQARNSLT---------VKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPETVSSIIFWLGYFNSCLNPIIYPCYSREFKLAFIRILKCRCHRR 370          
BLAST of GCR005 vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 130.568 bits (327), Expect = 3.105e-32
Identity = 80/227 (35.24%), Postives = 119/227 (52.42%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNR-DGKTIIMRVHCGGFRTDSSSKSQ 958
            VII+  T+ +LR   TN  I+NLA++DLLL   VLP S   +++   W FG  LC +W A DVL CTASI +L  IS DRYI +R+ +RY + +T K   + L  VW+F+ +IS                    + P             +C IT +   Y I+S+  S+YIPLIV++  Y  ++  A +    +  G +K R D K + +R+HC   + DS + S+
Sbjct:   65 VIISVVTNKQLR-IPTNYLIVNLAIADLLLSSTVLPFSATKEIVGY-WVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSLRYPTIVTRKRTILALLGVWMFSTVIS--------------------IGPLLGWKEPAPPDTYVCEIT-TEIFYAIFSSLASFYIPLIVILVMYCRVYVVAKRITKNLEAGVMKERMDSKELTLRIHCRNKQDDSPNNSK 268          

HSP 2 Score: 74.3294 bits (181), Expect = 1.751e-13
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query: 1222 NKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            N   +        + + L +  RE KAA+ LGI+ G FILCWLPFF V    +  +++  P +    +FWLGY NS +NP IY   SK+F+ A+ R L
Sbjct:  265 NNSKVQNNQPRSALSLKLLKFSREKKAAKTLGIVVGMFILCWLPFFTVLPLSSLSEHLTPPVTLEKIIFWLGYFNSCINPIIYPCSSKEFKRAFIRIL 362          
BLAST of GCR005 vs. Ensembl Xenopus
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495969])

HSP 1 Score: 127.872 bits (320), Expect = 2.948e-31
Identity = 73/212 (34.43%), Postives = 114/212 (53.77%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRD-GKTIIMRVHCGGFRTDSSSKSQ 958
            TN FI+NLA++DLLL   VLP S   +VL   W FG   C IW A DVL CTASI++L VIS DRY+ ++  ++Y + MT K   ++L  +W+ + +IS                    + P            + CSIT+  PGY ++S+  S+Y+PL+V++  Y  ++  A +T   +  G  K R+    +++R+HC     +SSS ++
Sbjct:   77 TNYFIVNLAIADLLLSTTVLPFSATLEVLGF-WAFGRVFCDIWAAVDVLCCTASIMSLCVISIDRYVGVKYSLKYPTIMTEKKAVVILILLWLSSMVIS--------------------IGPLLGWKEPPPPDDSKCSITE-EPGYALFSSLFSFYLPLLVILVMYFRVYIVARRTTKSLEAGVKKERNKSMEVVLRIHCRSVLEESSSSTR 266          

HSP 2 Score: 79.7221 bits (195), Expect = 2.760e-15
Identity = 41/85 (48.24%), Postives = 55/85 (64.71%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            + V L +  RE KAA+ L I+ G FILCWLPFF++   G+F+  +   DS F  +FWLGY NS +NP IY   SK+F+ A+ R L
Sbjct:  277 LSVRLLKFSREKKAAKTLAIVVGVFILCWLPFFLILPLGSFFPALKPTDSVFKVIFWLGYFNSCVNPIIYPCSSKEFKRAFIRIL 361          
BLAST of GCR005 vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 123.25 bits (308), Expect = 1.056e-29
Identity = 71/199 (35.68%), Postives = 103/199 (51.76%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVH 919
            T+ FI NLAV+DLLL  +VLP S   ++    W FG   C IW A DVL CTASI++L  IS DRYI +  P+RY S MT K   + L  +W+ + +IS                    + P             IC IT   PGY ++SAFGS+Y+PL +++  Y  ++  A +    +  G +L+  D + + +R+H
Sbjct:   85 THYFIANLAVADLLLMSMVLPFSATFEI-QGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVIS--------------------IGPLFGWKQPAPEDDKICEITKE-PGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESKVLTSGMKLEKSDSEEVTLRIH 261          

HSP 2 Score: 81.2629 bits (199), Expect = 9.083e-16
Identity = 42/95 (44.21%), Postives = 56/95 (58.95%), Query Frame = 1
Query: 1231 SLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFY--KNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            S + + +     V L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+ Y   N  D+ F   FWLGY NS +NP IY   S +FR A++  L
Sbjct:  271 STSSSKQKTQFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSIYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKAFQNIL 365          
BLAST of GCR005 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 120.939 bits (302), Expect = 2.563e-29
Identity = 72/187 (38.50%), Postives = 104/187 (55.61%), Query Frame = 2
Query:  284 IIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATA 844
            +IAA    +  +   N  I +LAV+DL++ ++VLP++  NQVLN+ W  G   C I+++ DVL CT+SIL+L  I+ DRY AI +PI Y++  T +   +L++  WI  F IS P +L             SD N               C I++  PGY IYS FG++YIPLI+M+  Y  IF  A
Sbjct:   50 VIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNK-WTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPE-----DRSDPNA--------------CKISE-DPGYTIYSTFGAFYIPLILMLVLYGKIFKAA 215          

HSP 2 Score: 82.4185 bits (202), Expect = 2.797e-16
Identity = 42/85 (49.41%), Postives = 56/85 (65.88%), Query Frame = 1
Query: 1282 MQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK--NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL----CRK 1518
            + RE K  + LGII G FI CWLPFFIV +   F +  ++P   FD + WLGY NSLLNP IYA F+KDF+ A+++ +    CR+
Sbjct:  326 LARERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCETCHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKIIKCKFCRQ 410          
BLAST of GCR005 vs. Ensembl Xenopus
Match: prrc2c (proline-rich coiled-coil 2C [Source:Xenbase;Acc:XB-GENE-984671])

HSP 1 Score: 108.227 bits (269), Expect = 6.225e-25
Identity = 69/208 (33.17%), Postives = 108/208 (51.92%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAK--GRLKNRDGK 898
            ++I A    +  +  TN FI +LA +DLL+G+IV+P    + +L+  W F N  C+ W + D+L  TASI  L VI+ DRY AI +P RY S +T    +I++  VW+ + + SF  I    Y+                 S  +      C    ++P Y I S+  S+Y+PL+VM++ YA +F  A K +  I K  GR  N++ +
Sbjct:   57 LVITAIAKFQRLQTVTNYFITSLACADLLMGLIVVPFGASSIILDT-WVFNNFWCEFWTSVDILCVTASIETLCVIAVDRYFAITSPFRYQSLLTKCKARIVILLVWVVSTLTSFLPIYMHWYR-------------IEEESALHCYDDPSCCFFFTNPAYAISSSIISFYLPLVVMIFVYARVFQEAKKQLKKIDKSEGRFHNQNNQ 250          

HSP 2 Score: 72.4034 bits (176), Expect = 5.292e-13
Identity = 36/79 (45.57%), Postives = 49/79 (62.03%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN-IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKR 1521
            +E KA + LGII G F LCWLPFFIV +    +K+ IP   ++ + W+GY NS  NP IY   S DFR  ++  LC ++
Sbjct:  268 KEHKALKTLGIIMGTFTLCWLPFFIVNIVQVMHKDFIPVKVYNFLNWVGYVNSAFNPLIYCR-SPDFRYTFQELLCLRK 345          
BLAST of GCR005 vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 125.946 bits (315), Expect = 8.233e-31
Identity = 83/247 (33.60%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKN-RDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNK 1054
            R  TN FI+NLA++DLLL   VLP S   +VL   W  G   C IW A DVL CTASIL+L  IS DRYI +R  ++Y + +T +   + L SVW+ + +IS            ++  K    N  +            C +T+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K   + K + +R+H   F  D+      L S+   G      PR  I+   FKF  + K
Sbjct:   77 RTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISI---------GPLLGWKEPAPNDDKE-----------CGVTE-EPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDT------LSSTKAKGH----NPRSSIAVKLFKFSREKK 291          

HSP 2 Score: 85.8853 bits (211), Expect = 1.968e-17
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = 1
Query: 1189 EIKC*LH*FNQNKRSLTQTSEI-----KIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            E+   +H  N ++ +L+ T          I V L +  RE KAA+ LGI+ G FILCWLPFFI    G+ +  +  PD+ F  VFWLGY NS LNP IY   SK+F+ A+ R L
Sbjct:  250 ELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR005 vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 125.946 bits (315), Expect = 1.542e-30
Identity = 83/247 (33.60%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKN-RDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNK 1054
            R  TN FI+NLA++DLLL   VLP S   +VL   W  G   C IW A DVL CTASIL+L  IS DRYI +R  ++Y + +T +   + L SVW+ + +IS            ++  K    N  +            C +T+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K   + K + +R+H   F  D+      L S+   G      PR  I+   FKF  + K
Sbjct:   77 RTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISI---------GPLLGWKEPAPNDDKE-----------CGVTE-EPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDT------LSSTKAKGH----NPRSSIAVKLFKFSREKK 291          

HSP 2 Score: 85.8853 bits (211), Expect = 2.414e-17
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = 1
Query: 1189 EIKC*LH*FNQNKRSLTQTSEIKIIP-----VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            E+   +H  N ++ +L+ T      P     V L +  RE KAA+ LGI+ G FILCWLPFFI    G+ +  +  PD+ F  VFWLGY NS LNP IY   SK+F+ A+ R L
Sbjct:  250 ELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR005 vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 125.946 bits (315), Expect = 1.542e-30
Identity = 83/247 (33.60%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKN-RDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNK 1054
            R  TN FI+NLA++DLLL   VLP S   +VL   W  G   C IW A DVL CTASIL+L  IS DRYI +R  ++Y + +T +   + L SVW+ + +IS            ++  K    N  +            C +T+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K   + K + +R+H   F  D+      L S+   G      PR  I+   FKF  + K
Sbjct:   77 RTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISI---------GPLLGWKEPAPNDDKE-----------CGVTE-EPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDT------LSSTKAKGH----NPRSSIAVKLFKFSREKK 291          

HSP 2 Score: 85.8853 bits (211), Expect = 2.414e-17
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = 1
Query: 1189 EIKC*LH*FNQNKRSLTQTSEIKIIP-----VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            E+   +H  N ++ +L+ T      P     V L +  RE KAA+ LGI+ G FILCWLPFFI    G+ +  +  PD+ F  VFWLGY NS LNP IY   SK+F+ A+ R L
Sbjct:  250 ELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR005 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 117.857 bits (294), Expect = 3.772e-29
Identity = 67/199 (33.67%), Postives = 101/199 (50.75%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVH 919
            T+ +I+NLAV+DLLL   VLP S   ++L   W FG   C IW A DVL CTASI+ L +IS DRYI +  P+RY + +T +     L  VW  + +IS                    + P             IC I +  PGY+++SA GS+Y+PL +++  Y  ++  A +   G+  G +    D + + +R+H
Sbjct:   61 THYYIVNLAVADLLLTSTVLPFSAIFEILGY-WAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVIS--------------------IGPLFGWRQQAPEDETICQINE-EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIH 237          
BLAST of GCR005 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 120.939 bits (302), Expect = 4.761e-29
Identity = 67/199 (33.67%), Postives = 101/199 (50.75%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVH 919
            T+ +I+NLAV+DLLL   VLP S   ++L   W FG   C IW A DVL CTASI+ L +IS DRYI +  P+RY + +T +     L  VW  + +IS                    + P             IC I +  PGY+++SA GS+Y+PL +++  Y  ++  A +   G+  G +    D + + +R+H
Sbjct:   61 THYYIVNLAVADLLLTSTVLPFSAIFEILGY-WAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVIS--------------------IGPLFGWRQQAPEDETICQINE-EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIH 237          

HSP 2 Score: 85.1149 bits (209), Expect = 4.112e-17
Identity = 43/90 (47.78%), Postives = 59/90 (65.56%), Query Frame = 1
Query: 1267 VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYR---RFLCRKR 1521
            V L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+F+ N   P++ F  VFWLGY NS +NP IY   S++F+ A++   R  C +R
Sbjct:  259 VRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRR 348          
BLAST of GCR005 vs. UniProt/SwissProt
Match: sp|O77408|OAR1_LYMST (Octopamine receptor 1 OS=Lymnaea stagnalis OX=6523 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 4.640e-43
Identity = 111/323 (34.37%), Postives = 164/323 (50.77%), Query Frame = 2
Query:  290 AASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTL-VYQNTIINIKISDVNP--------------------------TRNMSFS-----NLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNR--------DGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIES 1138
            A +TS KLR   TN+FI+NLA +DLLLG++VLP S  N++ +  W FG+  C++WLA DV LCTASILNL  IS DRY+AI  PIRY   M+ K  + L+  VW+F+F+I  P ++      + I++   +   P                            NM+ +     + S+   C +T+S  GY IY+A GS++IP++VMV+FY  I+  A KTI   AKG LK +           ++ +R+H GG R  S+  S     S   G    +  R           C +K      +F   + +SH P +  C+S ++
Sbjct:   52 AVATSRKLRTV-TNVFIVNLACADLLLGVLVLPFSAVNEIKDV-WIFGHVWCQVWLAVDVWLCTASILNLCCISLDRYLAITRPIRYPGLMSAKRAKTLVAGVWLFSFVICCPPLIGWNDGGDGIMDYNGTTATPIPVTTTQTPVTGRDDVLCDNGFNYSTNSNMNTTCTYSGDSSLSTTCELTNSR-GYRIYAALGSFFIPMLVMVFFYLQIYRAAVKTISAYAKGELKTKYSVRENGSKTNSVTLRIHRGG-RGPSTGSSVYRHGSTYGGSAAGAATREG---------CGDKDAAGGRRFGRQEMDSHLP-VRKCRSSDA 360          

HSP 2 Score: 98.5969 bits (244), Expect = 2.037e-20
Identity = 45/80 (56.25%), Postives = 58/80 (72.50%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN-IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            + +  RE KAA+ L II GAFI+CW+PFF +Y+ GAF +N I    F   FWLGYCNS +NP +YALFS+DFR A+R+ L
Sbjct:  508 MQKFNREKKAAKTLAIIVGAFIMCWMPFFTIYLVGAFCENCISPIVFSVAFWLGYCNSAMNPCVYALFSRDFRFAFRKLL 587          
BLAST of GCR005 vs. UniProt/SwissProt
Match: sp|Q93126|GPR9_AMPAM (Probable G-protein coupled receptor No9 OS=Amphibalanus amphitrite OX=1232801 PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 9.458e-39
Identity = 84/217 (38.71%), Postives = 130/217 (59.91%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG--RLKNRDGKTIIMRVHCG 925
            V++A     KLR   TN+FI++LA +DLL+G++VLP S   +VL+  W +G+  C +WLA DV +CT+SILNL  IS DRY+A+  PI Y S M+ +  + L+ +VW+ +F+I FP ++         N +   +  +R  S   L+    C +T+   GY+IYSA GS+++P  VM++FY  I+ TA  T   IA+G    K  +   + +R+H G
Sbjct:   54 VVMAVFVHSKLRTV-TNLFIVSLACADLLVGMLVLPFSATLEVLDV-WLYGDVWCSVWLAVDVWMCTSSILNLCAISLDRYLAVSQPISYPSLMSTRRAKQLIAAVWVLSFVICFPPLVGW-------NDRPGTLIGSRGSSACRLT----CELTNER-GYVIYSALGSFFLPSTVMLFFYGRIYRTAVSTTRAIAQGFRTTKEDEEGRLTLRIHRG 256          

HSP 2 Score: 87.8113 bits (216), Expect = 4.069e-17
Identity = 42/80 (52.50%), Postives = 54/80 (67.50%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN-IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCR 1515
            R + E KAA+ +GII G FILCWLPFF+ Y+   F  + +P   F   FWLGYCNS +NP +YAL S+DFR A+   LC+
Sbjct:  365 RFRMETKAAKTVGIIVGLFILCWLPFFVCYLVRGFCADCVPPLLFSVFFWLGYCNSAVNPCVYALCSRDFRFAFSSILCK 444          
BLAST of GCR005 vs. UniProt/SwissProt
Match: sp|Q91175|ADA1A_ORYLA (Alpha-1A adrenergic receptor OS=Oryzias latipes OX=8090 GN=adra1a PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.489e-33
Identity = 74/201 (36.82%), Postives = 110/201 (54.73%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVHCG 925
            T  FI+NLAV+DLLL   VLP S   ++L+R W FG   C IW A DVL CTASI++L VIS DRYI +  P+RY + MT +   + +  +W+ + IIS                    + P             +C IT+  PGY I+SA GS+Y+PL +++  Y  ++  A K   G+ +G +++  D + +I+R+H G
Sbjct:   61 TYYFIVNLAVADLLLSSTVLPFSAIFEILDR-WVFGRVFCNIWAAVDVLCCTASIMSLCVISVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVIIS--------------------IGPLFGWKEPAPEDETVCKITE-EPGYAIFSAVGSFYLPLAIILAMYCRVYVVAQKESRGLKEGQKIEKSDSEQVILRMHRG 239          

HSP 2 Score: 73.9442 bits (180), Expect = 9.403e-13
Identity = 36/81 (44.44%), Postives = 51/81 (62.96%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK--NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+ +      D+ F   FWLGY NS +NP IY   +++F+ A++  L
Sbjct:  259 LLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYLCSNQEFKKAFQSLL 339          
BLAST of GCR005 vs. UniProt/SwissProt
Match: sp|P25100|ADA1D_HUMAN (Alpha-1D adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1D PE=1 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 6.148e-31
Identity = 74/210 (35.24%), Postives = 110/210 (52.38%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKT--IIMRVHCGGFRTDSSS 949
            TN FI+NLAV+DLLL   VLP S   +VL   W FG A C +W A DVL CTASIL+L  IS DRY+ +R+ ++Y + MT +    +L  +W+ A ++S   +L               V P              C IT+ + GY ++S+  S+Y+P+ V+V  Y  ++  A  T   +  G +K   GK   +++R+HC G  T +  
Sbjct:  131 TNYFIVNLAVADLLLSATVLPFSATMEVLGF-WAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWK----------EPVPPDERF----------CGITEEA-GYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAG-VKRERGKASEVVLRIHCRGAATGADG 317          

HSP 2 Score: 68.9366 bits (167), Expect = 4.780e-11
Identity = 35/81 (43.21%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSW--FDGVFWLGYCNSLLNPWIYALFSKDFRLAY 1497
            + V L +  RE KAA+ L I+ G F+LCW PFF V   G+ +  +  S   F  +FWLGY NS +NP IY   S++F+ A+
Sbjct:  333 LSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAF 413          
BLAST of GCR005 vs. UniProt/SwissProt
Match: sp|P35368|ADA1B_HUMAN (Alpha-1B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1B PE=1 SV=3)

HSP 1 Score: 126.331 bits (316), Expect = 7.653e-30
Identity = 83/247 (33.60%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKN-RDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNK 1054
            R  TN FI+NLA++DLLL   VLP S   +VL   W  G   C IW A DVL CTASIL+L  IS DRYI +R  ++Y + +T +   + L SVW+ + +IS            ++  K    N  +            C +T+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K   + K + +R+H   F  D+      L S+   G      PR  I+   FKF  + K
Sbjct:   77 RTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGY-WVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISI---------GPLLGWKEPAPNDDKE-----------CGVTE-EPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDT------LSSTKAKGH----NPRSSIAVKLFKFSREKK 291          

HSP 2 Score: 85.5001 bits (210), Expect = 2.282e-16
Identity = 50/114 (43.86%), Postives = 66/114 (57.89%), Query Frame = 1
Query: 1189 EIKC*LH*FNQNKRSLTQTSEIKIIP-----VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            E+   +H  N ++ +L+ T      P     V L +  RE KAA+ LGI+ G FILCWLPFFI    G+ +  +  PD+ F  VFWLGY NS LNP IY   SK+F+ A+ R L
Sbjct:  250 ELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRIL 363          
BLAST of GCR005 vs. TrEMBL
Match: A0A193KU21 (GCR005 OS=Schmidtea mediterranea OX=79327 GN=gcr005 PE=2 SV=1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 360/363 (99.17%), Postives = 361/363 (99.45%), Query Frame = 2
Query:  146 MEADYLLKSKDFLARKYVGFPSVESVFXXXXXXXXXXXXXXXXXXVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKTNEA 1234
            MEADYLLKSKDFLARKYVGFPSVESVFILFVLILIDLSILIGNILVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKT  +
Sbjct:    1 MEADYLLKSKDFLARKYVGFPSVESVFILFVLILIDLSILIGNILVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKTKRS 363          

HSP 2 Score: 213.386 bits (542), Expect = 0.000e+0
Identity = 100/104 (96.15%), Postives = 101/104 (97.12%), Query Frame = 1
Query: 1213 FNQNKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF 1524
              + KRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF
Sbjct:  357 LTKTKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF 460          
BLAST of GCR005 vs. TrEMBL
Match: W2TZ93 (7 transmembrane receptor OS=Necator americanus OX=51031 GN=NECAME_00032 PE=3 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 3.305e-45
Identity = 91/309 (29.45%), Postives = 152/309 (49.19%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKIS-DVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQ-NKIPFTTPKFSFNKSNSHNPNLDDC-KSIESINFSQRDTGIESDYELLKSN 1198
            V++      KLR  + N  II+LA++DLL+G++V+PL++  ++    W  GN LC++WLA DVL  TASIL++  IS DRY ++ +P+ Y +  T K   I +   WI + +I  P I     +       +S D+     +  + L +   C I+   PGY++YS+ GS+YIP+I++V  YA I++   K     ++ RLK  + +   + +      T    + + LE + +  +   S  +  I+    + C Q  KI    PK    K ++    L    K    I  S++D   E     LK+ 
Sbjct:   42 VVVTVYRDRKLRLQRQNWLIISLALADLLVGLLVMPLTLIYEITGE-WKMGNVLCEMWLALDVLFVTASILHICAISLDRYFSVTSPLTYPAKRTPKRMFIYIGVAWIVSLLICLPPIFGWRPERRPGECAVSTDIGTIHKIVLTKLVLKNYCKISALIPGYVLYSSLGSFYIPVIILVIVYAKIYSITIKH----SRQRLKETERRDNTLNLLTAKPTTKQIVELELLEENSDGEEKDNSNNKEEIN----QVCWQLRKISEELPKVKLKKVSATQRLLHTFEKKPAVIPKSEKDLSAEKRRRKLKAK 341          

HSP 2 Score: 79.7221 bits (195), Expect = 3.305e-45
Identity = 40/77 (51.95%), Postives = 51/77 (66.23%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRK 1518
            +E +A  +LGII  AFIL WLPFF+ YV GAF    P   F   FWLGYCNS +NP IY +F+++F    +R LCR+
Sbjct:  341 KERQATLLLGIILSAFILSWLPFFVFYVIGAFGYEAPAIVFKFFFWLGYCNSGINPVIYTVFNREF----KRGLCRQ 413          
BLAST of GCR005 vs. TrEMBL
Match: A0A1S3K9Y2 (dopamine receptor 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180005 PE=3 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 3.427e-44
Identity = 100/336 (29.76%), Postives = 159/336 (47.32%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGR---LKNRDGKTIIMRVHCGGFRTDSSS---------KSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKTNEA*RKRVK 1252
            ++I A    +  R  TN F+++LAV+DL++G IV+P SI  ++ + RW +G   C +W + DVL  TASILNL VIS DRY AI +PI+Y   M+++   IL+  VWI +  ISFP I+     + ++                      +C  T+ +  Y++ S+  S+Y PL++M+Y Y  I+  A + +  +  G    +   +G+ + +R+H GG R  ++S          S    +  ET       PR+       +  C N+          NK N+ N NL    SIE    S     IE+  E    N    ++    +  RKR+K
Sbjct:  153 LVITAIVKERYLRANTNYFLVSLAVADLVVGSIVMPFSIALEIRSGRWVYGKLWCDLWHSFDVLGSTASILNLCVISMDRYWAITDPIKYPHRMSSRRVCILIALVWICSGSISFPAIMWWRAVDPVLP-------------------DTVCLFTEDT-AYLLISSAISFYTPLVIMLYVYWKIYRAAAEQLRSLRHGSKSVVSGINGQKLTLRIHRGGARPGATSLLMMNVRKNLSIYTPAIAETNDFSPIKPRY------LRNGCHNQ---------SNKRNTTNNNL----SIEDDTASVNSAFIENQNENEDDNAPVSDIHSPAKFIRKRLK 449          

HSP 2 Score: 80.1073 bits (196), Expect = 3.427e-44
Identity = 44/88 (50.00%), Postives = 54/88 (61.36%), Query Frame = 1
Query: 1258 IIPVPLSRMQREAKAARMLGIICGAFILCWLPFF---IVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            +I   LS++ RE KAA+ LGI+ G FI+CWLPFF   ++Y         PD  F    WLGY NS +NP IYAL  KDFR A+ R LC
Sbjct:  452 VIKTKLSKVARERKAAKTLGIVIGVFIICWLPFFAANLLYGICGTCVLHPDIIFPVFTWLGYINSGMNPIIYALSLKDFRRAFSRILC 539          
BLAST of GCR005 vs. TrEMBL
Match: A0A1I8HKB0 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.291e-44
Identity = 95/221 (42.99%), Postives = 137/221 (61.99%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTI-------INIKISDVNPTRNMSFSN-LSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVH 919
            V++AA TS KL+   T+ F+++LAVSDLLLG+ VLP SI +QVL + W F +  C+IWLA DV  CTASILNL +IS DRYI++R+P++Y + M  K  ++L+  VW  A  IS P +L L+ Q           +  +     T N S  + L +   C+I  S+PGYI+YSA GS+++P ++M YFYA IFA  H+T+    +G  +N       +R+H
Sbjct:   47 VVLAACTSTKLQGALTSTFVVSLAVSDLLLGLGVLPFSITHQVLLKHWVFSSWWCQIWLALDVWTCTASILNLVIISLDRYISLRHPLKYPNLMDRKRARLLVAGVWALACAISLPTLLKLLLQTDADENDSLRRSTWLEQDKRTANESVGDCLQLGPTCTIAHSTPGYIVYSALGSFFLPFLIMTYFYAHIFAAVHRTLKAGRRGAAENGQ-----LRIH 262          

HSP 2 Score: 86.6557 bits (213), Expect = 1.960e-14
Identity = 46/82 (56.10%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN-IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKR 1521
            R  RE KAARML IIC  F+ CW PFF VY+ GA   + I    FD  FWLGY NS LNP IYALFS D+R A++  + R+R
Sbjct:  325 RYGRELKAARMLAIICITFVGCWAPFFSVYLYGAVCPDCISALAFDICFWLGYVNSALNPLIYALFSADYRRAFKTLILRRR 406          
BLAST of GCR005 vs. TrEMBL
Match: A0A1I8HFH6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 5.401e-44
Identity = 95/221 (42.99%), Postives = 137/221 (61.99%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTI-------INIKISDVNPTRNMSFSN-LSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVH 919
            V++AA TS KL+   T+ F+++LAVSDLLLG+ VLP SI +QVL + W F +  C+IWLA DV  CTASILNL +IS DRYI++R+P++Y + M  K  ++L+  VW  A  IS P +L L+ Q           +  +     T N S  + L +   C+I  S+PGYI+YSA GS+++P ++M YFYA IFA  H+T+    +G  +N       +R+H
Sbjct:   47 VVLAACTSTKLQGALTSTFVVSLAVSDLLLGLGVLPFSITHQVLLKHWVFSSWWCQIWLALDVWTCTASILNLVIISLDRYISLRHPLKYPNLMDRKRARLLVAGVWALACAISLPTLLKLLLQTDADENDSLRRSTWLEQDKRTANESVGDCLQLGPTCTIAHSTPGYIVYSALGSFFLPFLIMTYFYAHIFAAVHRTLKAGRRGAAENGQ-----LRIH 262          

HSP 2 Score: 86.6557 bits (213), Expect = 1.971e-14
Identity = 46/82 (56.10%), Postives = 54/82 (65.85%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN-IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKR 1521
            R  RE KAARML IIC  F+ CW PFF VY+ GA   + I    FD  FWLGY NS LNP IYALFS D+R A++  + R+R
Sbjct:  326 RYGRELKAARMLAIICITFVGCWAPFFSVYLYGAVCPDCISALAFDICFWLGYVNSALNPLIYALFSADYRRAFKTLILRRR 407          
BLAST of GCR005 vs. Ensembl Cavefish
Match: adra1ba (adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033427])

HSP 1 Score: 142.51 bits (358), Expect = 1.534e-36
Identity = 82/223 (36.77%), Postives = 118/223 (52.91%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNR-DGKTIIMRVHCGGFRTDSSSKSQCLESSDET 982
            R  TN FIINLA++DLLLG  VLP+S   ++LN  W FG   C IW A DVL CTASI++L VIS DRYI +R P++Y S +T K   + +  VW+ A +IS                    + P             IC IT+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K R D   + +R+HC G    + ++ +C  +   T
Sbjct:   77 RIPTNYFIINLAMADLLLGTTVLPVSATLEILNY-WVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLATVIS--------------------IGPLLGWKEPPSDDDTICPITEE-PFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTRNLEAGVMKERMDSSELTLRIHCKG----AQAQEECGGAGKGT 273          

HSP 2 Score: 86.6557 bits (213), Expect = 1.061e-17
Identity = 43/90 (47.78%), Postives = 61/90 (67.78%), Query Frame = 1
Query: 1267 VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL---CRKR 1521
            V L +  RE KAA+ LG++ G FILCWLPFF+    G+F  N+  P+++F  +FWLGY NS LNP IY  +S++F+ A+ R L   C++R
Sbjct:  280 VKLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGSFNANLRPPETFFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRILRCQCQQR 369          
BLAST of GCR005 vs. Ensembl Cavefish
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027862])

HSP 1 Score: 136.732 bits (343), Expect = 2.058e-34
Identity = 77/225 (34.22%), Postives = 120/225 (53.33%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKT-IIMRVHCGGFRTDSSSKSQCLESSDETGK 988
            R  TN FI+NLA++DLLLG++VLP S   +VL   W FG   C IW A DVL CTASIL+L +IS DRY+ ++  +RY + MT +   ++L  +W+ + +IS                    + P         +  ++CSIT+  PGY ++S+  S+Y+PL V++  Y  ++  A +T   +  G  + R   T +++R+HC       S   + LE S   G+
Sbjct:   87 RTVTNFFIVNLAIADLLLGVVVLPFSASLEVLGC-WVFGRVFCNIWAAVDVLCCTASILSLCIISVDRYVGVKYCLRYPTIMTERKAGVILVVIWVASAVIS--------------------IGPLLGWKEPPPADESVCSITE-EPGYALFSSLFSFYLPLSVILVMYFRVYVVARRTSRSLEAGVKRERGTSTDVVLRIHC------RSLPEEALEHSRSRGR 283          

HSP 2 Score: 77.411 bits (189), Expect = 9.175e-15
Identity = 40/85 (47.06%), Postives = 53/85 (62.35%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            + V L +  RE KAA+ L I+ G F+LCWLPFF V   G+F+  +   D  F  +FWLGY NS +NP IY   SK+F+ A+ R L
Sbjct:  291 LSVRLMKFSREKKAAKTLAIVVGMFVLCWLPFFFVLPLGSFFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAFTRLL 375          
BLAST of GCR005 vs. Ensembl Cavefish
Match: adra1aa (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103024013])

HSP 1 Score: 131.339 bits (329), Expect = 8.887e-33
Identity = 78/220 (35.45%), Postives = 113/220 (51.36%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGR--LKNRDGKTIIMRVHCGGFRTDSSSKSQCLES 970
            R  T+ FI NLAV+DLLL   VLP S   ++L   W FG A C +W A DVL CTASI++L  IS DRYI +  P+RY + +T +   + L  VW  +  IS                    V P             +C IT+  PGY I+SA GS+Y+PL+V++  Y  ++  A +   G+ KG+   K+   + + +R+H G     S+S+ + L S
Sbjct:   72 RTVTHYFIANLAVADLLLSSTVLPFSAIFEMLGH-WVFGRAFCDVWAAMDVLCCTASIMSLCAISVDRYIGVSYPLRYPTIVTERRALLALMGVWALSITIS--------------------VGPLFGWKEPAPEDETVCKITE-EPGYAIFSAVGSFYLPLVVILVMYCRVYVVARRETRGLRKGQKTEKSDHAEAVTLRIHRG---NTSASEDEALRS 266          

HSP 2 Score: 73.9442 bits (180), Expect = 1.207e-13
Identity = 37/81 (45.68%), Postives = 50/81 (61.73%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK--NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+ +      D+ F   FWLGY NS +NP IY   S++F+ A+   L
Sbjct:  274 LLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVL 354          
BLAST of GCR005 vs. Ensembl Cavefish
Match: adra2c (alpha-2C adrenergic receptor-like [Source:NCBI gene;Acc:103033245])

HSP 1 Score: 120.553 bits (301), Expect = 3.019e-29
Identity = 73/244 (29.92%), Postives = 128/244 (52.46%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRH 1012
            V+IA  TS  L+    N+F+++LA +D+L+  +++P S+ N+++   WFFG   C I+LA DVL CT+SI++L  IS DRY ++   + Y    T +  + ++  VW+ + +ISFP ++++  ++  IN+K                    C I D +  YI+YS+ GS++ P ++M+  Y  I+  A      +++ R K+ DG     R+   G   D  S+     +S   G+     P+H
Sbjct:   54 VVIAVLTSRALKP-PQNLFLVSLATADILVATLIMPFSLANELMGY-WFFGKVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLISMDRKDQEINVKPQ------------------CEINDHT-WYILYSSIGSFFAPCVIMILVYIRIYQVAKTRTRSMSEKR-KDPDGGAEAPRLE-NGLSQDDLSRENGHCTSPPPGE-----PKH 269          

HSP 2 Score: 73.559 bits (179), Expect = 1.157e-13
Identity = 33/79 (41.77%), Postives = 49/79 (62.03%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN---IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCR 1515
            RE +   +L ++ G F++CW PFF  Y      +    IP+  F   FW+GYCNS LNP IY +F++DFR A+++ LC+
Sbjct:  348 REKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCEIPEPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQKILCK 426          
BLAST of GCR005 vs. Ensembl Cavefish
Match: ENSAMXT00000035837.1 (D(4) dopamine receptor-like [Source:NCBI gene;Acc:103025686])

HSP 1 Score: 73.1738 bits (178), Expect = 5.188e-28
Identity = 33/77 (42.86%), Postives = 48/77 (62.34%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYK--NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            RE KA ++L ++ G F+ CW PFF+V+VT A  +  +I  +    V WLGY NS +NP IY  F+ +FR  + + LC
Sbjct:  358 RERKAMKVLPVVVGVFLACWTPFFVVHVTKALCESCDIGPTLISVVTWLGYVNSAVNPIIYTAFNAEFRNVFHKLLC 434          

HSP 2 Score: 71.633 bits (174), Expect = 5.188e-28
Identity = 77/295 (26.10%), Postives = 142/295 (48.14%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDG--KTIIMRVHCGGFRTDSSSKSQCLESSDE--TGKLIQSTPRHRIS-NCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESI--NFSQRDTGIESDY 1180
            +  TN FI++LAV+DLLL ++VLPL + ++ L  +W     +C   +  DV+LCTASILNL  IS DRYIA+  P++Y     +     L+T+ W+ +  ++ P I  L   N +         P RN          +C + D++  ++IYS+  S+++P  VM+  Y  +F    +   G ++ RL    G   ++ +R+     R    ++ + +    E  +   + +TP   +S   P       +    +P    +   +   ++ D +++E    + S R+ G+E ++
Sbjct:   69 KTATNYFIVSLAVADLLLAVLVLPLYVYSEFLGGKWTLSMYICDALMTMDVMLCTASILNLCAISVDRYIAVVVPLKYNRNQFSVRQLALITATWVLSLGVASPVIFGL---NQV---------PNRNTH--------VCKLEDNN--FVIYSSVCSFFVPCPVMLLLYYWMFRGLKRWSSGRSRSRLNRPSGGRHSLSLRLGAALQREKGRAREKVVYLMPEGLSPTSLSATPASPLSPTSPVTLSTDEQPEGQSPMADTDPMTTQMDSVSDAENVEKATEDGSLRENGLEKNH 341          
BLAST of GCR005 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 7.050e-29
Identity = 73/188 (38.83%), Postives = 104/188 (55.32%), Query Frame = 2
Query:  284 IIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAH 847
            +IAA    +  +   N  I +LAV+DLL+ I+VLP++   QVL+R W  G  +C I++A DVL CT+SIL+L VI+ DRY AI NPI Y++  T +   I+++  W+  F IS P +L             +D N               C I+    GY IYS FG++YIPLI+M+  Y+ IF  A 
Sbjct:   57 VIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDR-WTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPE-----DRADPN--------------ACKISQDH-GYTIYSTFGAFYIPLILMLVLYSRIFRAAR 223          

HSP 2 Score: 47.3654 bits (111), Expect = 4.750e-6
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 1
Query: 1390 NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL----CRK 1518
            ++P   F  + WLGY NSLLNP IYA F+KDF+ A+++ +    CR+
Sbjct:  342 HLPPGVFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCKFCRQ 388          
BLAST of GCR005 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 7.046e-25
Identity = 64/202 (31.68%), Postives = 113/202 (55.94%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKN 886
            V IA  TS  L+  + N+F+++LA +D+L+  +V+P S+ N+++   W FG+  C+++LA DVL CT+SI++L  IS DRY ++   +RY    T +  +  +  VW+ A +ISFP ++        I+ +       RN S S  S+   C + + +  Y++ S   S++ P ++M+  YA I+         +AKGR ++
Sbjct:   54 VAIAVFTSKSLKAAQ-NLFLVSLAAADILVATLVMPFSLANELMGY-WVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVGTGRPPANIH-RHRHQGSGRNASSSPSSVLPTCKLNEET-WYVLSSCTASFFTPCLIMLLVYARIYQ--------VAKGRARH 243          

HSP 2 Score: 71.2478 bits (173), Expect = 1.751e-13
Identity = 34/81 (41.98%), Postives = 47/81 (58.02%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYK---NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKR 1521
            RE +   +L ++ G F+ CW PFF  Y      +     P+  F   FW GYCNS LNP IY +F++DFR A++  LCR+R
Sbjct:  387 REKRFTFVLAVVMGVFVACWFPFFFSYSLTKICEASCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNILCRRR 467          
BLAST of GCR005 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 2.107e-23
Identity = 64/189 (33.86%), Postives = 100/189 (52.91%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFP------NILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYAS 829
            VI+A S   KL+   TN F+++LAV+D+L+GI+V+P+S+ N +   +W    +LC +W+  DVL  TASI++L  IS DRYIAI+ PI +  + +     + + +VW+ +  IS P        L  VY +    + ISD                          +IIY +  S+++PLI+MV  Y S
Sbjct:   45 VILAVSLEKKLQT-ATNYFLMSLAVADMLVGILVMPISLLNILYGFKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGSCQMNISD--------------------------FIIYGSLSSFFLPLIIMVASYVS 206          

HSP 2 Score: 51.9878 bits (123), Expect = 1.825e-7
Identity = 26/85 (30.59%), Postives = 47/85 (55.29%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAF------YKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            +  +  E +A+++LGI+   F+  W PFFI  V  A        ++   +  D   W+GY +S +NP +Y LF++ +R A+ R++
Sbjct:  306 MQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAALLDVFVWVGYVSSGVNPLVYTLFNRTYRQAFARYI 390          
BLAST of GCR005 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 100.138 bits (248), Expect = 4.585e-23
Identity = 60/190 (31.58%), Postives = 93/190 (48.95%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHK 850
            ++IAA ++ +  R   N  I +LAV+DLL+  +V+P++    V+   W  G ALC +WL+ DV  CTASIL+L  I+ DR+ AI +   Y    T     +++ + W+ A  IS P +            +  D    R            C I      Y IYS FG++Y+PL +++  Y  IF  A +
Sbjct:   67 LVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVA-AAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLF----------WRRRDPAKPR------------CIIEHDHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKR 233          

HSP 2 Score: 78.5666 bits (192), Expect = 7.041e-16
Identity = 36/80 (45.00%), Postives = 54/80 (67.50%), Query Frame = 1
Query: 1285 QREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN--IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRK 1518
             RE +AA+ LG+I GAF++CWLPFFI  +     K+  +     D + WLGY NSL+NP IY +F++DF+ A+R+ + R+
Sbjct:  345 SRERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLVSRQ 424          
BLAST of GCR005 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010620.1 (pep scaffold:Pmarinus_7.0:GL476906:12757:15672:-1 gene:ENSPMAG00000009618.1 transcript:ENSPMAT00000010620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 4.740e-23
Identity = 57/169 (33.73%), Postives = 88/169 (52.07%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASI 832
            TN FI++LAV+DLL+GI+VLPL + ++ L+  W  G+ LC   +  DV+LCTASI NL  IS DR+IA+R P+ Y     N     L+T+ W             L           ++ NP R+         A+C +    P ++I+S+  S+++P   M+  Y  +
Sbjct:    1 TNWFIVSLAVADLLVGILVLPLFVYSEFLSGVWTLGSGLCDALMTLDVMLCTASIYNLCAISLDRFIAVRAPLHYEHKRVNVRQAALITATW------------LLSLALASPLALGANSNPERD--------PAVCRL--ERPAFVIFSSVCSFFVPCPAMLALYCCV 147          
BLAST of GCR005 vs. Ensembl Nematostella
Match: EDO34093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD2])

HSP 1 Score: 69.707 bits (169), Expect = 2.502e-24
Identity = 69/282 (24.47%), Postives = 119/282 (42.20%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPI---RYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGS---YYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPF---KFCCQNKIPFTTPKFSFNKSNS 1099
            VI+    +  LRR  TN+FI++LA SDLL   + +P  +     +  W  G+ +C IW    ++    SIL L  ++ +R+  +++P+   R    +T++   I + ++W ++ + +            +I  + SDV+        N++ H             +YSA  S   + +P+I+  Y Y  IF  AH+   G A    +N D K +              +K+    S    GK   S    RIS C       C Q K      +  F+KS++
Sbjct:   19 VIVTIVRNTSLRRVTTNLFILSLAFSDLLTASLAMPFDLEALAGSLPWKHGHVICDIWATMYLIAVPTSILTLLAVAVERFKTLKDPLNKFRESHSVTHRRAIIAIFTLWGYSIMFAVV---------PLIGWRRSDVSVIDGQCIFNIT-H-------------VYSALSSVVNFLLPVILTAYLYVRIFMIAHRHAPGAATQ--QNTDHKRL--------------AKTATFRSEKHKGKASVS----RISVCRVIRESLCSQGK---KKTRIDFHKSSA 254          

HSP 2 Score: 60.8474 bits (146), Expect = 2.502e-24
Identity = 35/103 (33.98%), Postives = 52/103 (50.49%), Query Frame = 1
Query: 1213 FNQNKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAF----YKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            F+++  S+T+ +E          M R  +AAR + +I  AF LCW PF ++ VT A        +    F  +  LGY NS LNP++Y+   K FR+   R L
Sbjct:  249 FHKSSASVTRAAE-------AGAMYRNIRAARTVAVIVFAFFLCWAPFTVLSVTMATCYTCTHAVSSELFSALLLLGYTNSALNPFLYSFKDKRFRVTCVRML 344          
BLAST of GCR005 vs. Ensembl Nematostella
Match: EDO33023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STC6])

HSP 1 Score: 88.5817 bits (218), Expect = 3.952e-19
Identity = 60/197 (30.46%), Postives = 94/197 (47.72%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAK 871
            V+I  S + +LR    N FI +LAVSDLL+ ++ LPL I   + N  W      C +W+ SD++   +S+ NL +IS DRYIA+  P+ Y   +T++     +  VW++  I +                 +S +N T    F   SI      T S P Y       ++++PL++ ++ Y  IF  A      IAK
Sbjct:   40 VLITVSVNNRLRSSPANYFIASLAVSDLLVALVSLPLRIDQMLHNHNWCLSLEACALWIWSDMICSGSSVGNLAIISMDRYIALSRPLHYRMQVTSQRAFAGIAFVWVYFSIWA----------------CLSFMNWTE---FGTQSIFITTECTKSDPVYYTVVLSTAFFLPLLIFIFNYCRIFGIARSQARNIAK 217          

HSP 2 Score: 48.521 bits (114), Expect = 3.722e-6
Identity = 31/89 (34.83%), Postives = 48/89 (53.93%), Query Frame = 1
Query: 1276 SRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAF-YKNIPD-SWFDGVFW---------LGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            SR +R  KAA+ + ++   FI+CW PF I+++   +  + I D     G+F          L   NS LNP IYAL++++FR A +  L
Sbjct:  240 SRRERNFKAAKTVALVGCCFIICWCPFIIIFIVSLWCVECILDLQKHTGLFMFIKVVFVYILPAINSCLNPGIYALYNREFRQALKETL 328          
BLAST of GCR005 vs. Ensembl Nematostella
Match: EDO38342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD89])

HSP 1 Score: 87.0409 bits (214), Expect = 1.089e-18
Identity = 36/98 (36.73%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  323 KTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFI 616
            KTN+F++NLA++D+ L ++ +P ++ + +    W FG+  CK+    + L C ASIL LT +S +R+IAI +P++Y  WMT +  +I++  +W+ + I
Sbjct:   71 KTNVFVVNLAIADISLAVLAMPFTMTSSI-TYEWIFGDTFCKVQGIFNSLFCEASILTLTFVSLERFIAILHPLKYQQWMTPRTIKIMVVYIWLQSLI 167          

HSP 2 Score: 57.7658 bits (138), Expect = 4.394e-9
Identity = 29/83 (34.94%), Postives = 43/83 (51.81%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFI-VYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF 1524
            + ++E KA  M+ I+ G F  CW P  + ++   +     PDS+F    WL   NS LN  IY L +  F+ A++  L R RF
Sbjct:  249 KTKQEHKATIMIAIVVGTFSACWFPHAVGIFCLVSGNCEWPDSYFIATTWLAMLNSALNSGIYGLMNSSFKRAFKSILLRDRF 331          
BLAST of GCR005 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 87.0409 bits (214), Expect = 1.801e-18
Identity = 55/189 (29.10%), Postives = 91/189 (48.15%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRW--FFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGR 877
            R  TN  +++LAVSDLL+G + LP  +   +    W    G   C+ W+  D+L   AS++NL  ISFDR +AI+ P+RY   MT+K   IL+  VWI+A   +F + +    ++TI                   + +  C I      YI   A  +++ PL++++  Y  +   A +    + K +
Sbjct:   55 RSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEWEGESTI-------------------AAYPQCGIRARV--YITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEK 222          

HSP 2 Score: 54.299 bits (129), Expect = 6.840e-8
Identity = 28/85 (32.94%), Postives = 47/85 (55.29%), Query Frame = 1
Query: 1279 RMQREAKAARMLGIICGAFILCWLPFFIVYVTGAF-------YKNIPDS-----WFDGVFWLGYCNSLLNPWIYALFSKDFRLAY 1497
             + ++ KA + L ++ G FILCW PFF+++VT  +        + IP +         V+ L   NS  NP IY+ F+++FR+A+
Sbjct:  284 HIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAF 368          
BLAST of GCR005 vs. Ensembl Nematostella
Match: EDO47155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT4])

HSP 1 Score: 82.8037 bits (203), Expect = 1.445e-17
Identity = 56/193 (29.02%), Postives = 98/193 (50.78%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPI---RYLSWMTNKNCQILLTSVWIFAFIIS-FPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAH 847
            V +A S S  LR+  TN FI++LAVSDL+   + +P  +   + N RW  G+  C +W    ++   +SIL+L  +S DRY A+R+P+   R   +MT K   I++  +W ++ + +  P I   +Y+N +I+          N+ + N           +   Y I ++F ++ +P++VM   Y  I+  A 
Sbjct:   13 VCVAFSMSPILRKSPTNYFILSLAVSDLITATLCVPFDVDQTITNWRWNHGSFACSVWTTVYLIAVPSSILSLLAVSVDRYKALRDPLNRFRQTRFMTRKKACIIIGLLWTYSLLFAILPEIGWRLYENNVID----------NVCYFN-----------TPREYSILNSFLNFVLPVLVMCVLYLQIYFIAR 184          
BLAST of GCR005 vs. Ensembl Medaka
Match: ENSORLT00000042787.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:101155866])

HSP 1 Score: 111.309 bits (277), Expect = 1.156e-41
Identity = 87/310 (28.06%), Postives = 145/310 (46.77%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTI-CGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQ--NKIPFTTPK-----FSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYEL 1186
            VIIA   S  LR  + N+F+++LA +D+L+ +IV+P S+  ++L   W F +  C+I  A DVL CTASI++L  I+ DRY++I  P+ Y +  + +  +  +  VW+ A ++SFP +L L  ++                      +   C   D  P YI+YS  GS++ P ++M+  Y  I+  A + + C   + R           R   G    D+  KS   ES  + G+   + P   ++      C Q  +K P  +P      FS    N+   +L   +  ++++ S      ESD EL
Sbjct:   48 VIIAVLMSRSLRGPQ-NLFLVSLAAADILVALIVVPFSMAYELLGC-WVFSSIWCEIHKALDVLFCTASIVHLCAIALDRYLSISRPVSYGTTRSRRRIKSAIVMVWLIAAVVSFPPLLYLDTKD---------------------KVKGKCE-PDDKPWYILYSTIGSFFAPCVIMILVYIRIYQIAKRHMHCPPGEKR-----------RSFYGAATDDTEMKSLPEESQKDVGQRAPAAPELSLTTV-HTDCAQWNDKKPAESPTEGPPLFSTAVPNAAR-DLPKAEGEDAVHTSSS----ESDTEL 316          

HSP 2 Score: 78.9518 bits (193), Expect = 1.156e-41
Identity = 42/112 (37.50%), Postives = 61/112 (54.46%), Query Frame = 1
Query: 1225 KRSLTQTSEIKIIP--------VPLSR----MQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKN---IPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCR 1515
            K ++  +S  K++P         P+SR    + RE +   +L ++ G F++CW PFF  Y   A       +PD  F   FW GYCNS LNP IY +F++DFR A++R L R
Sbjct:  343 KNTIKTSSGTKLLPEDTAKTQETPISRHKAMINREKRFTLVLAVVMGVFVVCWFPFFFSYSLKAVCPEKYQVPDPLFRFFFWSGYCNSCLNPIIYTIFNRDFRTAFKRILFR 454          
BLAST of GCR005 vs. Ensembl Medaka
Match: adra1aa (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101157705])

HSP 1 Score: 133.65 bits (335), Expect = 1.505e-33
Identity = 74/201 (36.82%), Postives = 109/201 (54.23%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKG-RLKNRDGKTIIMRVHCG 925
            T  FI+NLAV+DLLL   VLP S   ++L+R W FG   C IW A DVL CTASI++L VIS DRYI +  P+RY + MT +   + +  +W+ + IIS                    + P             +C IT+  PGY I+SA GS+Y+PL +++  Y  ++  A K   G+ +G + +  D + +I+R+H G
Sbjct:   68 TYYFIVNLAVADLLLSSTVLPFSAIFEILDR-WVFGRVFCNIWAAVDVLCCTASIMSLCVISVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVIIS--------------------IGPLFGWKEPAPEDETVCKITE-EPGYAIFSAVGSFYLPLAIILAMYCRVYVVAQKESRGLKEGQKTEKSDSEQVILRMHRG 246          

HSP 2 Score: 74.7146 bits (182), Expect = 6.704e-14
Identity = 36/81 (44.44%), Postives = 51/81 (62.96%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK--NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            L +  RE KAA+ LGI+ G F+LCWLPFF+V   G+ +      D+ F   FWLGY NS +NP IY   +++F+ A++  L
Sbjct:  266 LLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGSIFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSNQEFKKAFQSLL 346          
BLAST of GCR005 vs. Ensembl Medaka
Match: ENSORLT00000000867.2 (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:101159125])

HSP 1 Score: 134.42 bits (337), Expect = 1.781e-33
Identity = 75/204 (36.76%), Postives = 110/204 (53.92%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNR--DGKTIIMRVHC 922
            R  TN FIINLA++DLLL   VLP+S   +VL+  W FG   C IW A DVL CTASI++L VIS DRYI +R P++Y   +T +   + +  VWI +F+IS                    + P             +C IT + P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G +K+R  +   + +R+HC
Sbjct:   83 RSPTNYFIINLAIADLLLSTTVLPVSATLEVLDY-WVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPMIVTKRRALLAMLGVWILSFVIS--------------------IGPLLGWKEPPSQDDTVCLIT-AEPFYALFSSLGSFYIPLGVILAMYCRVYVVAKRTTRNLEAGMMKDRAENSNELTLRIHC 264          

HSP 2 Score: 79.337 bits (194), Expect = 2.823e-15
Identity = 37/76 (48.68%), Postives = 52/76 (68.42%), Query Frame = 1
Query: 1267 VPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFR 1488
            V L +  RE KAA+ LG++ G FILCWLPFF+V   G+   ++  P++ F  +FWLGY NS LNP IY  +S++F+
Sbjct:  289 VKLLKFSREKKAAKTLGVVVGMFILCWLPFFLVLPIGSISSSLRPPETLFKVIFWLGYFNSCLNPIIYPCYSREFK 364          
BLAST of GCR005 vs. Ensembl Medaka
Match: adra1d (adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157273])

HSP 1 Score: 133.65 bits (335), Expect = 1.802e-33
Identity = 78/216 (36.11%), Postives = 116/216 (53.70%), Query Frame = 2
Query:  326 TNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKT-IIMRVHC----GGFRTDSSSKSQ 958
            TN FI+NLA++DLL+ IIVLP S   +VL   W FG   C +W A DVL CTASIL+L +IS DRYI +++ ++Y S MT +    +L  VW+ + +IS                    V P            +IC IT+  PGY ++S+  S+Y+PL+V++  Y  ++  A +T   +  G  + RD    +++R+HC    G  R  SS  S+
Sbjct:   77 TNFFIVNLAIADLLVSIIVLPFSASLEVLGC-WMFGRVFCNVWAAVDVLCCTASILSLCMISIDRYIGVKHCLKYPSIMTERKAVAILMLVWVSSLVIS--------------------VGPLLGWKEPPPVDESICRITEE-PGYALFSSLFSFYLPLLVILIMYFRVYVVARRTTKSLEAGVKRERDKSVEVVLRIHCRSVLGDARPASSKSSK 270          

HSP 2 Score: 72.7886 bits (177), Expect = 2.564e-13
Identity = 37/85 (43.53%), Postives = 53/85 (62.35%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            + V L +  RE KAA+ L ++ G FI+CWLPFF+    G+ +  +   ++ F  VFWLGY NS +NP IY   SK+F+ A+ R L
Sbjct:  278 LSVRLMKFSREKKAAKTLAVVVGMFIVCWLPFFLFLPIGSVFPALKPSETVFKVVFWLGYFNSCINPMIYPCSSKEFQRAFIRLL 362          
BLAST of GCR005 vs. Ensembl Medaka
Match: ENSORLT00000006865.2 (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101159926])

HSP 1 Score: 129.028 bits (323), Expect = 9.520e-32
Identity = 73/204 (35.78%), Postives = 112/204 (54.90%), Query Frame = 2
Query:  317 RYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNR-DGKTIIMRVHCG 925
            R  TN FIINLA++DLLLG  VLP+S   ++LN  W FG   C IW A DVL CTASI++L VIS DRYI + +P++Y   +T K   + +  VW+ + +IS   +L      +  +++                    C IT+  P Y ++S+ GS+YIPL V++  Y  ++  A +T   +  G ++ R +   + +R+H G
Sbjct:   79 RTPTNYFIINLAMADLLLGTTVLPVSATKEILNY-WVFGRIFCDIWAALDVLCCTASIMSLCVISIDRYIGVSHPLQYPGIVTEKRALLAMLGVWVLSVVISIGPLLGWKQPPSDDDME--------------------CLITEE-PFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTRNLEAGVMRERMNTSELTLRIHKG 260          

HSP 2 Score: 85.5001 bits (210), Expect = 2.545e-17
Identity = 42/85 (49.41%), Postives = 58/85 (68.24%), Query Frame = 1
Query: 1261 IPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNI--PDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            + V L +  RE KAA+ LG++ G FILCWLPFF+    G+F +N+  P+  F  +FWLGY NS LNP IY  +S++F+LA+ R L
Sbjct:  284 LTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLTLPLGSFNENLRPPELLFRVIFWLGYFNSCLNPIIYPCYSREFKLAFIRIL 368          
BLAST of GCR005 vs. Planmine SMEST
Match: SMESG000081069.1 (SMESG000081069.1)

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 360/363 (99.17%), Postives = 361/363 (99.45%), Query Frame = 2
Query:  146 MEADYLLKSKDFLARKYVGFPSVESVFXXXXXXXXXXXXXXXXXXVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKTNEA 1234
            MEADYLLKSKDFLARKYVGFPSVESVFILFVLILIDLSILIGNILVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKT  +
Sbjct:    1 MEADYLLKSKDFLARKYVGFPSVESVFILFVLILIDLSILIGNILVIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQNKIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNVDSINLTKTKRS 363          

HSP 2 Score: 213.386 bits (542), Expect = 0.000e+0
Identity = 100/104 (96.15%), Postives = 101/104 (97.12%), Query Frame = 1
Query: 1213 FNQNKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF 1524
              + KRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF
Sbjct:  357 LTKTKRSLTQTSEIKIIPVPLSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRKRF 460          
BLAST of GCR005 vs. Planmine SMEST
Match: SMESG000009251.1 (SMESG000009251.1)

HSP 1 Score: 171.014 bits (432), Expect = 1.769e-47
Identity = 101/226 (44.69%), Postives = 137/226 (60.62%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTR----NMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTIIMRVHCG-GFRTDS 943
            VII   +  +LR    NIFIINLA SDL LG+ VLPLS+ N++L + W FGN LC  WLA DV L TASILNL ++  DR+IAI + IRY S M++   +IL++ VWI AFII  P I T++  ++ +N+  +  N       N  +    I+  CSI +S+  Y IYSA GS++IPLI+++YFY+ IFAT  +       G L         MR+H G G R +S
Sbjct:   41 VIILVKSFWRLRNSIANIFIINLAASDLFLGVFVLPLSLINELLKKHWIFGNELCGSWLAIDVCLSTASILNLVIVGLDRFIAICHSIRYTSLMSHGRARILVSLVWISAFIICAPTIFTVISSDS-VNVITNQSNFVHILYYNYKYCYQIINYSCSIENSNQIYKIYSALGSFFIPLIILIYFYSRIFATVKENAKKFRTGALSTDKKGQPAMRIHLGSGNRKNS 265          

HSP 2 Score: 92.0485 bits (227), Expect = 9.982e-20
Identity = 44/83 (53.01%), Postives = 58/83 (69.88%), Query Frame = 1
Query: 1276 SRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDS--WFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCRK 1518
            ++  RE KAAR+L I+CGAFI+CW PFF +Y+ GAF  N+ +    FD  FWLGY NS LNP IY + S+DFR A+R+   R+
Sbjct:  359 NKYARETKAARLLAIVCGAFIVCWAPFFTLYILGAFV-NLHEEGLLFDIFFWLGYTNSALNPIIYFIVSRDFRTAFRKIFLRR 440          
BLAST of GCR005 vs. Planmine SMEST
Match: SMESG000059264.1 (SMESG000059264.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.604e-42
Identity = 93/223 (41.70%), Postives = 129/223 (57.85%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNI-------LTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLK-NRDGKTIIMRVHCG 925
            VI   +T  KL+R  T  FII+LA+SDLLLG  VLP S   ++L + W FG  +C +WLA DVLL TASI NL +I  DRY+AI  P +Y   M N   + L+  VWIF+FII  P I        ++ Y N++   KI +     N S        +CSI +S+  Y +YSAFGS+YIPL+++++FY  IF   ++    I KG +K ++      MR+H G
Sbjct:   34 VIFGVATIWKLKRSVTTNFIISLAISDLLLGAFVLPFSSTTELLKQTWIFGYKICHLWLAVDVLLSTASIYNLVIIGLDRYLAICWPFKYPVLMNNSKAKFLVGFVWIFSFIICSPTIQLIFSDSTSISYDNSLFPSKIHEKYIRINSS--------MCSIKNSNKYYKVYSAFGSFYIPLVILIFFYTRIFTKVNENFRNIHKGTIKIDQSSIENCMRIHKG 248          

HSP 2 Score: 93.9745 bits (232), Expect = 2.095e-20
Identity = 45/81 (55.56%), Postives = 58/81 (71.60%), Query Frame = 1
Query: 1276 SRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK-NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLCR 1515
            +++  E KAARMLG+ICGAFI+CWLPFF  Y+T AF + +     F   FWLGY NS LNP IY ++SK+FR A++  LCR
Sbjct:  335 NKISSETKAARMLGVICGAFIVCWLPFFSWYLTSAFVELDEASPIFSVFFWLGYVNSALNPIIYVIWSKNFRQAFKTLLCR 415          
BLAST of GCR005 vs. Planmine SMEST
Match: SMESG000044639.1 (SMESG000044639.1)

HSP 1 Score: 123.635 bits (309), Expect = 1.353e-30
Identity = 70/190 (36.84%), Postives = 112/190 (58.95%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHK 850
            V+IA ST  +L+  + N F+ +LA++DLLLGI++LP S+ N++  R W FG  LC +WLA DVLLCTASI++L +IS DRY +I  PI+Y +  T      ++ + WI + +I  P +                   + +++FS  S    C +T +   Y++YS+ GS+YIPL++++  Y  +F  A +
Sbjct:   43 VLIAISTDYRLKNIQ-NWFLGSLAIADLLLGILILPFSLFNEIFGR-WIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGW---------------SSHSLNFSISSNEQKCELTQNR-AYVLYSSIGSFYIPLLIIIIVYLQVFIEAKR 214          

HSP 2 Score: 80.8777 bits (198), Expect = 3.739e-16
Identity = 37/74 (50.00%), Postives = 51/74 (68.92%), Query Frame = 1
Query: 1288 REAKAARMLGIICGAFILCWLPFFIVYVTGAFYKNIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFL 1509
            RE +   +LG++ GAFI+CWLPFF  Y+   F K + +  F   FWLGYCNS LNP IY ++++DFR A++R L
Sbjct:  311 RERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWLGYCNSGLNPIIYTVYNRDFRKAFQRIL 384          
BLAST of GCR005 vs. Planmine SMEST
Match: SMESG000018302.1 (SMESG000018302.1)

HSP 1 Score: 122.479 bits (306), Expect = 3.151e-30
Identity = 79/226 (34.96%), Postives = 120/226 (53.10%), Query Frame = 2
Query:  281 VIIAASTSVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKIWLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVWIFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSIT-DSSPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKTII------MRVHCGGFRT 937
            VIIA +++  LR   TN FI++LA +DLL+G++V+P ++ N++    W FG   C +W A DVL  TASILNL +I+ +RY    +P+     +TNKNC I++  VW  +  ISFP I+                        S+ +  ++CS    + P YI  S+  S+Y PL++M+  Y  I+ TA + I  + KG     DG   +      +R+H GGFR 
Sbjct:   35 VIIAVASNSNLRTC-TNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQ--------------------SSDTYDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGERVIEDGDKALNNPPVRLRIHKGGFRA 239          

HSP 2 Score: 71.2478 bits (173), Expect = 5.028e-13
Identity = 39/88 (44.32%), Postives = 48/88 (54.55%), Query Frame = 1
Query: 1273 LSRMQREAKAARMLGIICGAFILCWLPFFIVYVTGAFYK--------NIPDSWFDGVFWLGYCNSLLNPWIYALFSKDFRLAYRRFLC 1512
            L +   E KAAR LG + G FILCWLPFFI  +  +           +I D     V WLGY NS +NP IYA   + FR+A+ R LC
Sbjct:  299 LIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLC 386          
The following BLAST results are available for this feature:
BLAST of GCR005 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA1D1.280e-3135.24adrenoceptor alpha 1D [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1B1.594e-3033.60adrenoceptor alpha 1B [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A1.039e-2934.17adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A2.195e-2934.17adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A2.208e-2934.17adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR005 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyra-34.292e-3338.86TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-31.327e-3238.86TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-32.407e-3238.86TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
ser-31.187e-2835.35SERotonin/octopamine receptor family [Source:UniP... [more]
octr-11.286e-2826.09OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of GCR005 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop1R21.099e-2834.80gene:FBgn0266137 transcript:FBtr0085468[more]
Dop1R21.318e-2834.80gene:FBgn0266137 transcript:FBtr0085467[more]
Dop1R22.164e-2836.32gene:FBgn0266137 transcript:FBtr0330293[more]
5-HT73.345e-2835.39gene:FBgn0004573 transcript:FBtr0334508[more]
5-HT73.345e-2835.39gene:FBgn0004573 transcript:FBtr0085746[more]
back to top
BLAST of GCR005 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1d9.978e-3737.26adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-09... [more]
adra1ba4.390e-3637.73adrenoceptor alpha 1Ba [Source:ZFIN;Acc:ZDB-GENE-1... [more]
adra1aa2.015e-3336.10adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1bb1.075e-3231.23adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1bb3.628e-3231.23adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of GCR005 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000011711.13.105e-3235.24adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
ADRA1D2.948e-3134.43adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495... [more]
efr3b1.056e-2935.68EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
ENSXETT00000046867.12.563e-2938.505-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
prrc2c6.225e-2533.17proline-rich coiled-coil 2C [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of GCR005 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adra1b8.233e-3133.60adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1b1.542e-3033.60adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1b1.542e-3033.60adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1a3.772e-2933.67adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a4.761e-2933.67adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
back to top
BLAST of GCR005 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O77408|OAR1_LYMST4.640e-4334.37Octopamine receptor 1 OS=Lymnaea stagnalis OX=6523... [more]
sp|Q93126|GPR9_AMPAM9.458e-3938.71Probable G-protein coupled receptor No9 OS=Amphiba... [more]
sp|Q91175|ADA1A_ORYLA5.489e-3336.82Alpha-1A adrenergic receptor OS=Oryzias latipes OX... [more]
sp|P25100|ADA1D_HUMAN6.148e-3135.24Alpha-1D adrenergic receptor OS=Homo sapiens OX=96... [more]
sp|P35368|ADA1B_HUMAN7.653e-3033.60Alpha-1B adrenergic receptor OS=Homo sapiens OX=96... [more]
back to top
BLAST of GCR005 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU210.000e+099.17GCR005 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
W2TZ933.305e-4529.457 transmembrane receptor OS=Necator americanus OX=... [more]
A0A1S3K9Y23.427e-4429.76dopamine receptor 2 isoform X1 OS=Lingula unguis O... [more]
A0A1I8HKB05.291e-4442.99G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8HFH65.401e-4442.99G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of GCR005 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1ba1.534e-3636.77adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033... [more]
ADRA1D2.058e-3434.22adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027... [more]
adra1aa8.887e-3335.45alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adra2c3.019e-2929.92alpha-2C adrenergic receptor-like [Source:NCBI gen... [more]
ENSAMXT00000035837.15.188e-2842.86D(4) dopamine receptor-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of GCR005 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009127.17.050e-2938.83pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000008360.17.046e-2531.68pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
ENSPMAT00000006953.12.107e-2333.86pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
HTR1F4.585e-2331.585-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000010620.14.740e-2333.73pep scaffold:Pmarinus_7.0:GL476906:12757:15672:-1 ... [more]
back to top
BLAST of GCR005 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR005 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340932.502e-2424.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330233.952e-1930.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383421.089e-1836.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473591.801e-1829.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471551.445e-1729.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR005 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042787.11.156e-4128.06alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
adra1aa1.505e-3336.82alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
ENSORLT00000000867.21.781e-3336.76alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adra1d1.802e-3336.11adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157... [more]
ENSORLT00000006865.29.520e-3235.78alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
back to top
BLAST of GCR005 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081069.10.000e+099.17SMESG000081069.1[more]
SMESG000009251.11.769e-4744.69SMESG000009251.1[more]
SMESG000059264.11.604e-4241.70SMESG000059264.1[more]
SMESG000044639.11.353e-3036.84SMESG000044639.1[more]
SMESG000018302.13.151e-3034.96SMESG000018302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034938 ID=SMED30034938|Name=GCR005|organism=Schmidtea mediterranea sexual|type=transcript|length=1564bp
TAAATATCATTGTTTAAAAATCTCTAACCAATCAAGTCGCGAGTCTTTCT
CATCAAAGTGTATTTTTTATTCGTTATGTATTTCAAGTGTTAATTTTTTT
GTTTTTCTTTCACCAAAGCATATTATCAATAATATAAATTTAAGAATGGA
AGCCGATTATTTGTTGAAGTCGAAAGATTTTTTGGCTAGAAAATATGTCG
GTTTTCCATCTGTTGAATCGGTTTTCATACTTTTCGTTTTGATTTTGATC
GACTTGAGTATCCTTATCGGCAACATTCTTGTTATTATAGCCGCCTCGAC
GTCGGTAAAACTTCGGCGATATAAAACGAATATTTTTATTATTAATCTCG
CTGTCAGTGACTTGTTGTTGGGAATTATTGTTTTGCCTCTCTCTATTGGT
AATCAAGTGTTAAATCGGCGATGGTTTTTCGGAAACGCTCTTTGTAAGAT
TTGGCTAGCGTCGGACGTCCTGTTATGTACGGCAAGTATTTTAAATTTAA
CCGTGATATCATTCGACCGCTATATCGCAATCCGAAACCCAATTCGATAT
CTTTCATGGATGACAAATAAGAACTGCCAAATCCTTTTAACATCTGTGTG
GATATTTGCGTTTATTATATCGTTTCCGAATATTTTGACTCTTGTCTATC
AAAACACAATTATAAACATAAAAATATCGGATGTGAACCCAACAAGAAAT
ATGTCATTTAGTAACTTGTCAATCCACGCCATATGCAGCATAACGGATTC
TTCTCCTGGTTATATTATTTATTCTGCCTTCGGTTCGTATTATATCCCAT
TAATTGTCATGGTTTATTTTTATGCAAGTATTTTTGCAACTGCCCATAAA
ACGATTTGTGGTATTGCAAAAGGTCGTTTAAAGAATCGAGATGGCAAAAC
GATTATCATGAGAGTTCATTGCGGCGGTTTCCGAACGGATAGTAGCAGTA
AATCTCAGTGTTTGGAAAGTTCCGATGAAACAGGAAAATTGATTCAGTCA
ACTCCTAGGCATCGAATCAGTAATTGCCCTTTCAAGTTTTGCTGTCAAAA
CAAAATCCCTTTCACGACACCAAAATTTTCCTTCAACAAATCTAACAGCC
ATAACCCGAACCTTGACGACTGTAAATCCATTGAATCTATCAATTTCAGC
CAAAGAGACACGGGAATTGAATCCGATTATGAATTATTGAAATCAAATGT
TGACTCCATTAATTTAACCAAAACAAACGAAGCTTGACGCAAACGAGTGA
AATAAAGATTATACCGGTGCCATTGAGTAGAATGCAAAGAGAGGCTAAAG
CAGCGAGGATGTTGGGCATTATTTGTGGAGCTTTCATTTTATGTTGGCTT
CCATTCTTTATCGTTTACGTTACAGGGGCATTTTATAAAAACATTCCAGA
TAGTTGGTTCGACGGGGTTTTTTGGTTGGGTTATTGTAATTCTCTGTTAA
ATCCTTGGATATACGCATTGTTCTCTAAAGATTTCAGGTTAGCTTATCGG
CGATTCCTGTGCAGAAAGCGATTTTAATATTTGTTTTAATTCAGTTTATT
CACTATGAGTCCGT
back to top

protein sequence of SMED30034938-orf-1

>SMED30034938-orf-1 ID=SMED30034938-orf-1|Name=SMED30034938-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
KYHCLKISNQSSRESFSSKCIFYSLCISSVNFFVFLSPKHIINNINLRME
ADYLLKSKDFLARKYVGFPSVESVFILFVLILIDLSILIGNILVIIAAST
SVKLRRYKTNIFIINLAVSDLLLGIIVLPLSIGNQVLNRRWFFGNALCKI
WLASDVLLCTASILNLTVISFDRYIAIRNPIRYLSWMTNKNCQILLTSVW
IFAFIISFPNILTLVYQNTIINIKISDVNPTRNMSFSNLSIHAICSITDS
SPGYIIYSAFGSYYIPLIVMVYFYASIFATAHKTICGIAKGRLKNRDGKT
IIMRVHCGGFRTDSSSKSQCLESSDETGKLIQSTPRHRISNCPFKFCCQN
KIPFTTPKFSFNKSNSHNPNLDDCKSIESINFSQRDTGIESDYELLKSNV
DSINLTKTNEA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0004935adrenergic receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0071875adrenergic receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 155..177
score: 41.11
coord: 191..212
score: 20.82
coord: 109..130
score: 40.2
coord: 255..278
score: 25.4
coord: 75..99
score: 25.97
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 90..290
e-value: 2.5E-49
score: 168.0
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 161..177
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 286..322
e-value: 7.9E-60
score: 204.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 80..285
e-value: 7.9E-60
score: 204.9
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 67..317
NoneNo IPR availablePANTHERPTHR24247:SF134OCTOPAMINE RECEPTOR OAMBcoord: 67..317
NoneNo IPR availableCDDcd149677tmA_amine_R-likecoord: 90..281
e-value: 2.47536E-49
score: 165.814
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 70..284
NoneNo IPR availableTMHMMTMhelixcoord: 194..216
NoneNo IPR availableTMHMMTMhelixcoord: 110..132
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 90..283
score: 32.428