PH domain-containing protein

Overview
NamePH domain-containing protein
Smed IDSMED30034934
Length (bp)2865
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PH domain-containing protein (SMED30034934) t-SNE clustered cells

Violin plots show distribution of expression levels for PH domain-containing protein (SMED30034934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PH domain-containing protein (SMED30034934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PH domain-containing protein (SMED30034934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30034934SMESG000020711.1 dd_Smed_v4_4917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 422.935 bits (1086), Expect = 2.979e-135
Identity = 258/700 (36.86%), Postives = 395/700 (56.43%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDY----LRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E    P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  E +        D  PE L+     K Y    + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    KEE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLITPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPEQIT------TDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 422.935 bits (1086), Expect = 2.979e-135
Identity = 258/700 (36.86%), Postives = 395/700 (56.43%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDY----LRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E    P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  E +        D  PE L+     K Y    + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    KEE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLITPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPEQIT------TDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 422.935 bits (1086), Expect = 3.216e-135
Identity = 261/707 (36.92%), Postives = 400/707 (56.58%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E +  P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  E +        D  PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    KEE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLITPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPEQIT------TDITPECLVSPRYLKKYKNKQPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 683          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT2 (fermitin family member 2 [Source:HGNC Symbol;Acc:HGNC:15767])

HSP 1 Score: 422.935 bits (1086), Expect = 3.216e-135
Identity = 261/707 (36.92%), Postives = 400/707 (56.58%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E +  P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  E +        D  PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    KEE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLITPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPEQIT------TDITPECLVSPRYLKKYKNKQPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 683          
BLAST of PH domain-containing protein vs. Ensembl Human
Match: FERMT1 (fermitin family member 1 [Source:HGNC Symbol;Acc:HGNC:15889])

HSP 1 Score: 406.757 bits (1044), Expect = 4.161e-129
Identity = 255/714 (35.71%), Postives = 403/714 (56.44%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISI----TDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIP----LVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQL---VQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKD-ELNQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRL--QTPAPQAVLTKEDLNNRLKDLND--YMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKL-VFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            MLS  +    SWEL + +     + Q +V +RV GD+H+GGVM K VE +   QDWSD  LWW  K+ WL  T  TLD+YGVQ+++KL     H  L + LP++  V + V+FSA +F  V  ICK   IR  EELSL  P      K+  K  +    +   I  ++SS   S          +SP     T+   +  +N  T   S M+ F+ S  ++  Q+C+ L      FS+    P +S      ++QP++L+ KA+LN+ WLDSSRSLMEQGI  D  + L  RFK++ F+DLN KYDAVRI+QL+EQA+W ++   +D TE+EM++F ALQ     +  +S E Q+          A     DE++  +S LE    G   K D  L      P+L  +L+++R  KL  K+ K+ W + +   + ++ +K+ E  +P+ ++ +  C++  +VNV+  KF IK+         E   + D+++ Y+ WMAA  L ++ KT+ +   +Q E+ NI+  LR+  +  A Q   + E++     D+N   ++  +  K+ KSK  L +RI E+H NV  + +++AK ++IQAWQ L  FG+TY +V+F    K++I+G+++NR++ I+  +G    T  F++++ WN+NW+  +V+++F       F  LS +CK V E+IGGY+FL+ R+ D+N+ L+  LFHKLTG
Sbjct:    1 MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWLLKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLKMVRLRVSFSAVVFKAVSDICKILNIRRSEELSLLKPSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASGSS-------VSPGLYSKTMTPIYDPIN-GTPASSTMTWFSDSPLTE--QNCSILA-----FSQ----PPQSPEALADMYQPRSLVDKAKLNAGWLDSSRSLMEQGIQED--EQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIFAALQYHIS-KLSLSAETQDF---------AGESEVDEIEAALSNLEVTLEG--GKADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNLRGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRCDHENQYAQWMAACMLASKGKTMADSS-YQPEVLNILSFLRMKNRNSASQVASSLENM-----DMNPECFVSPRCAKRHKSKQ-LAARILEAHQNVAQMPLVEAKLRFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDAATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVFTAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          
BLAST of PH domain-containing protein vs. Ensembl Celegans
Match: unc-112 (pep chromosome:WBcel235:V:14691854:14697107:-1 gene:WBGene00006836.1 transcript:C47E8.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-112)

HSP 1 Score: 423.32 bits (1087), Expect = 2.588e-135
Identity = 246/731 (33.65%), Postives = 397/731 (54.31%), Query Frame = 3
Query:   78 IDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPL-SPTSNYN--------TLKYPFGTLN-HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGP-----EFSECMK----------MPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGI-NADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLG-MKSQKRLWCVLQKQKLNFYVSKDELNQ-PINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ-----------TPAPQAVLTK--EDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            IDG W+L I +TD+  +  + V G++++GG+M + V     ++DWSDH LWWP+K  WL HTR+TLDQ G+ + ++LE   +H +  + LP M  +   V+FS + F    ++C++ GIR+ EELSL+  +  EDL+   +     +   +++  E    P  L    P+ +  SN +         L       N H  GTL    T  + +S   P + N  +   P      FSE ++           P  +   +  +F+P+N ++KA +N  WLDSSRSLMEQGI   D    +  RFKF  F+DLN KYD VRI+QL+EQAKW ++    D TE+E  +F ALQLQA LQ +    ++N               +D+VD+++ ELE+            L Q P L   L+  +  KL   K  KR +   +   L+++ S  ++N  P+    +  C++  +V+V   K+ IK+     E   +F  + D++  Y+ WMAA RL +R K++ +   +Q+E+E+I  +L++Q           T + +A   K   D N     +++Y+  K +++A+SK  ++ R+ ++H NVR L+  +AK +YI+AWQ L   GI Y IV+F    K E++ +A NR+  +N ++G+   T  F++M+ W++NW+   + + F+   + FKPLS +CK V EFIGGY+FL+ R+ + +Q L+ +LFHKLTG
Sbjct:   11 IDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPS-PGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDI---ILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEPEEN--------------NKDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSS-YQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFN-----VDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDEDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTG 717          
BLAST of PH domain-containing protein vs. Ensembl Celegans
Match: unc-112 (pep chromosome:WBcel235:V:14691857:14696654:-1 gene:WBGene00006836.1 transcript:C47E8.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-112)

HSP 1 Score: 423.32 bits (1087), Expect = 2.588e-135
Identity = 246/731 (33.65%), Postives = 397/731 (54.31%), Query Frame = 3
Query:   78 IDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPL-SPTSNYN--------TLKYPFGTLN-HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGP-----EFSECMK----------MPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGI-NADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLG-MKSQKRLWCVLQKQKLNFYVSKDELNQ-PINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ-----------TPAPQAVLTK--EDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            IDG W+L I +TD+  +  + V G++++GG+M + V     ++DWSDH LWWP+K  WL HTR+TLDQ G+ + ++LE   +H +  + LP M  +   V+FS + F    ++C++ GIR+ EELSL+  +  EDL+   +     +   +++  E    P  L    P+ +  SN +         L       N H  GTL    T  + +S   P + N  +   P      FSE ++           P  +   +  +F+P+N ++KA +N  WLDSSRSLMEQGI   D    +  RFKF  F+DLN KYD VRI+QL+EQAKW ++    D TE+E  +F ALQLQA LQ +    ++N               +D+VD+++ ELE+            L Q P L   L+  +  KL   K  KR +   +   L+++ S  ++N  P+    +  C++  +V+V   K+ IK+     E   +F  + D++  Y+ WMAA RL +R K++ +   +Q+E+E+I  +L++Q           T + +A   K   D N     +++Y+  K +++A+SK  ++ R+ ++H NVR L+  +AK +YI+AWQ L   GI Y IV+F    K E++ +A NR+  +N ++G+   T  F++M+ W++NW+   + + F+   + FKPLS +CK V EFIGGY+FL+ R+ + +Q L+ +LFHKLTG
Sbjct:   11 IDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPS-PGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDI---ILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEPEEN--------------NKDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSS-YQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFN-----VDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDEDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTG 717          
BLAST of PH domain-containing protein vs. Ensembl Fly
Match: Fit1 (gene:FBgn0035498 transcript:FBtr0073209)

HSP 1 Score: 432.18 bits (1110), Expect = 9.871e-139
Identity = 269/719 (37.41%), Postives = 399/719 (55.49%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN--HNTGTL--------------------SPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFEN--NMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVD-GQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ--PINEILVSSCQMKAEVNVSANKFFIK------ITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            + +W L I ITD+Q E  +RV+GD HIGGVM   V+  +  +DWSDH LWWP KNIWL+ TR+TLDQ GVQS+S L    +H  L V +P +  +   VNFSA  F  V+ +CK+  IR+PEELS   PL  E LK N +  + + KI   +++        L T   +  T  YN      G+L+  HN   L                    SP  T+  + +       NS      +  E + M  +S   +    L +PK+ ++KARLN  WLDSS S+MEQG+       L  RFK+  F+DLN KYD VRI+QL+EQAKW +++  L+ TE+E ++F ALQ Q   QT++     +  +   D        ED++D  ++EL+    G     D G + + P L   L+  +  +  +K  KR +   +   L+ Y S+DE  +  P   I +  C++  +VN++  KF I+      I      E   + DN++ Y+ WMAA RL A+ ++L +   +  E+ +I  +L++Q PA  A LT   +N R  +  DY+  K+++K  SK     RI E+HANVR LS++DAK KYIQAWQ L +FG+T  I+KFD   KEE++G+A NRIM ++ N+GD   T  ++ M++WN+NW  + +++  +   +VF   S +CK V EFIGGY+F++ R+ + NQ LN ++FHKLTG
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFS-KLPQRKIPVAEANGIAYVQPALDTNSFVPITGAYNGSN---GSLDRSHNGNLLCAPASPYTRRAATAPGTPISSPTGTWKHNSTGYASYDSNSSF---GDLQENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVRE--YDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGI---DTSSQETGGEDDIDSALNELQITLEGPGGGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSS-YDSEVSSIRSLLQMQKPAQGAPLT---VNPRSVEPMDYLSPKMMRKLSSKAV--QRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQDENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTG 705          
BLAST of PH domain-containing protein vs. Ensembl Fly
Match: Fit1 (gene:FBgn0035498 transcript:FBtr0073210)

HSP 1 Score: 432.18 bits (1110), Expect = 9.871e-139
Identity = 269/719 (37.41%), Postives = 399/719 (55.49%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN--HNTGTL--------------------SPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFEN--NMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVD-GQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ--PINEILVSSCQMKAEVNVSANKFFIK------ITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            + +W L I ITD+Q E  +RV+GD HIGGVM   V+  +  +DWSDH LWWP KNIWL+ TR+TLDQ GVQS+S L    +H  L V +P +  +   VNFSA  F  V+ +CK+  IR+PEELS   PL  E LK N +  + + KI   +++        L T   +  T  YN      G+L+  HN   L                    SP  T+  + +       NS      +  E + M  +S   +    L +PK+ ++KARLN  WLDSS S+MEQG+       L  RFK+  F+DLN KYD VRI+QL+EQAKW +++  L+ TE+E ++F ALQ Q   QT++     +  +   D        ED++D  ++EL+    G     D G + + P L   L+  +  +  +K  KR +   +   L+ Y S+DE  +  P   I +  C++  +VN++  KF I+      I      E   + DN++ Y+ WMAA RL A+ ++L +   +  E+ +I  +L++Q PA  A LT   +N R  +  DY+  K+++K  SK     RI E+HANVR LS++DAK KYIQAWQ L +FG+T  I+KFD   KEE++G+A NRIM ++ N+GD   T  ++ M++WN+NW  + +++  +   +VF   S +CK V EFIGGY+F++ R+ + NQ LN ++FHKLTG
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFS-KLPQRKIPVAEANGIAYVQPALDTNSFVPITGAYNGSN---GSLDRSHNGNLLCAPASPYTRRAATAPGTPISSPTGTWKHNSTGYASYDSNSSF---GDLQENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVRE--YDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGI---DTSSQETGGEDDIDSALNELQITLEGPGGGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSS-YDSEVSSIRSLLQMQKPAQGAPLT---VNPRSVEPMDYLSPKMMRKLSSKAV--QRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQDENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTG 705          
BLAST of PH domain-containing protein vs. Ensembl Fly
Match: Fit2 (gene:FBgn0036688 transcript:FBtr0075275)

HSP 1 Score: 422.165 bits (1084), Expect = 6.104e-135
Identity = 252/724 (34.81%), Postives = 398/724 (54.97%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTL----SPMSTFNKSLSSQIPQSCNSLVIEGP-----------------------EFSECMKM--PAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQ-LVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ--PINEILVSSCQMKAEVNVSANKFFIKITTSN------REEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            + SW L I ITD+  E  +RVRGD HIGG+M + V+  +  +DWSDH LWWP +N+WLS T+ TLDQ GVQ++S L    +H  L V LP +  +   V++S   FS V+ +CK+  IR+PEELSL  PL  E LK N      + ++   +       P      +P + T+++  +   F     +TG+L    +P S F   LS    ++ + +    P                       +F E +    P        +  +PK+L++KARLN  WLDSS S+MEQGI       L  RFK+  F+DLN K D VRI+QL+EQAKW +++  LD TE+E ++F ALQ Q     + + +   +     +     N  EDE+D  + EL+    G     D + + + P L   LR  +  +  ++  KR +   +   L+ + + ++  +  P   I +  C++  +VN+S  K+ I++  S         E   + +N+  Y+ WMAA RL A+ ++L +   ++ E+++I+ +L++Q PA    +   +++ R  +  DY+  K+I+K  +K     RI E+HANVR L+ LD+K KYIQAW+ L +FG++  I+KFD   KEE++G+A NRIM ++ +SGD   T  ++ M++WN+NW+ + +++ F+   +VF   S +CK V EFIGGY+F++ R+ D NQ LN +LFHKLTG
Sbjct:    6 ENSWNLRIFITDLALEKTMRVRGDQHIGGIMLQLVDP-ENPKDWSDHALWWPARNVWLSRTKLTLDQCGVQADSLLHFTPMHKILRVQLPDLRYLDSRVDYSVKTFSAVVNLCKQLDIRYPEELSLCKPLEAEHLKRNFAQVPHQKRVPIAE-------PDGTTYLQPAADTNSFVPISTSFHGEGGSTGSLDKPSAPGSFFCAPLSPHNHRARSPVRTVSPFPGTWKQSQLGYATYDSSSSSLGDFQENLASSPPTPCADVRALQLRPKSLVEKARLNVGWLDSSLSIMEQGIRE--YDTLCLRFKYFTFFDLNPKCDQVRINQLYEQAKWSVLNEELDCTEEESLMFAALQFQVNHHVDHTPQGAAVD-SGIETSSQENDNEDEIDSALKELQITLEGPDYGGDSRNITRIPELSDYLRYLKPQRFTLRGYKRYYFTYRDLHLHLFKNAEDSRRVAPAISINLKGCEVTPDVNLSQGKYAIRLEVSPDGGHGINSEVWVRCENEQQYAKWMAACRLAAKGRSLADSS-YESEVDSILSLLQMQRPAHGVHV---NIDPRSVEAVDYLSPKIIRKLSNKAV--QRILEAHANVRELNALDSKLKYIQAWRSLPDFGVSLFIIKFDGHRKEELLGVAHNRIMRMDLSSGDHIKTWRYNTMKAWNVNWNIKCMMIQFEDENVVFSCHSADCKVVHEFIGGYIFMSMRSKDTNQTLNEELFHKLTG 712          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt1 (fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3264])

HSP 1 Score: 421.009 bits (1081), Expect = 6.378e-135
Identity = 247/694 (35.59%), Postives = 390/694 (56.20%), Query Frame = 3
Query:   87 SWELTISITDIQNE----VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLG-DQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            +WEL+I +   + +     K+RV+GD+H+GG+M K VE ++  QDWSDH +WW  K+ WL  T  TLD+YG+Q+N+ L     H  L + LP+M  + +PV FS  +F  V  ICK   IR  EELSL  P  +                   +  + K    +L T E L       T+    G L   + T++P+   +    S  P S  SL   G   + C   P     E   L++P  +  KA +N+ WLDSSRSLMEQGI  + +  L  RFK+H F+DLN KYDAVRI QL+EQA+W ++   +D TE+EM++F +LQ     +  +STE       P DN D   V  DEV+  +S LE    G +  K+   +   P+LE +L+++R  +L +K  K  W V +   ++++ +KD  N +PI ++ +  C++  +VNV+  KF +K+         E   + +N+  Y+ W AA  L ++ KT+     ++ E++NI   L++++ AP       D+ +   +   ++  +  KK K+K  L +RI E+H N+  LS+++AK ++IQAWQ L +FGI Y IV+F    K+E++GI++NR++ I+ ++G    T  FS+M+ WN+NW+  +V ++F ++  + F   S +CK V E+IGGY+FL+ R+ D+N+ L+ +LFHKLTG
Sbjct:   10 TWELSIQVDQREGDEGMRFKLRVKGDLHVGGLMLKLVEKIKAPQDWSDHAIWWEQKSCWLLKTHWTLDKYGIQANADLRYTPQHKSLCIQLPNMKNIKLPVTFSGVVFRAVAEICKTLNIRRTEELSLLKPTDEP------------------KKKKKKDKGTDLATDEIL-------TMDITGGALGMYSKTMTPIYDPD----SGSPVSSTSLWYGGSPLTAC--QPNLPPEELAKLYKPLTMEDKAAINAGWLDSSRSLMEQGIQENDR--LLLRFKYHCFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHI-CKLTLSTE-------PLDNSDEKEV--DEVEAALSNLETHLEGRNADKILEDITDIPKLEDTLKLFRPKRLTLKPYKEYWFVFRDTTISYFKNKDSANKEPIEQLHLRGCEVIPDVNVTERKFGLKLLLPAADGMNEVYIRCENETQYAKWKAACILASKGKTMAYSS-YRTEVKNIQSFLQMKSLAPPPGQAAPDVESMEMNPECFVSPRYAKKFKTKQ-LTTRILEAHHNISQLSLMEAKMRFIQAWQSLPDFGIKYYIVRFRGSKKDELLGISYNRLIRIDMSTGLPVTTWRFSNMKQWNVNWEIRQVTIEFDQSVSIAFSCQSCDCKVVHEYIGGYIFLSTRSKDQNETLDEELFHKLTG 658          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt1 (fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE-030131-3264])

HSP 1 Score: 421.009 bits (1081), Expect = 6.378e-135
Identity = 247/694 (35.59%), Postives = 390/694 (56.20%), Query Frame = 3
Query:   87 SWELTISITDIQNE----VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLG-DQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            +WEL+I +   + +     K+RV+GD+H+GG+M K VE ++  QDWSDH +WW  K+ WL  T  TLD+YG+Q+N+ L     H  L + LP+M  + +PV FS  +F  V  ICK   IR  EELSL  P  +                   +  + K    +L T E L       T+    G L   + T++P+   +    S  P S  SL   G   + C   P     E   L++P  +  KA +N+ WLDSSRSLMEQGI  + +  L  RFK+H F+DLN KYDAVRI QL+EQA+W ++   +D TE+EM++F +LQ     +  +STE       P DN D   V  DEV+  +S LE    G +  K+   +   P+LE +L+++R  +L +K  K  W V +   ++++ +KD  N +PI ++ +  C++  +VNV+  KF +K+         E   + +N+  Y+ W AA  L ++ KT+     ++ E++NI   L++++ AP       D+ +   +   ++  +  KK K+K  L +RI E+H N+  LS+++AK ++IQAWQ L +FGI Y IV+F    K+E++GI++NR++ I+ ++G    T  FS+M+ WN+NW+  +V ++F ++  + F   S +CK V E+IGGY+FL+ R+ D+N+ L+ +LFHKLTG
Sbjct:   10 TWELSIQVDQREGDEGMRFKLRVKGDLHVGGLMLKLVEKIKAPQDWSDHAIWWEQKSCWLLKTHWTLDKYGIQANADLRYTPQHKSLCIQLPNMKNIKLPVTFSGVVFRAVAEICKTLNIRRTEELSLLKPTDEP------------------KKKKKKDKGTDLATDEIL-------TMDITGGALGMYSKTMTPIYDPD----SGSPVSSTSLWYGGSPLTAC--QPNLPPEELAKLYKPLTMEDKAAINAGWLDSSRSLMEQGIQENDR--LLLRFKYHCFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHI-CKLTLSTE-------PLDNSDEKEV--DEVEAALSNLETHLEGRNADKILEDITDIPKLEDTLKLFRPKRLTLKPYKEYWFVFRDTTISYFKNKDSANKEPIEQLHLRGCEVIPDVNVTERKFGLKLLLPAADGMNEVYIRCENETQYAKWKAACILASKGKTMAYSS-YRTEVKNIQSFLQMKSLAPPPGQAAPDVESMEMNPECFVSPRYAKKFKTKQ-LTTRILEAHHNISQLSLMEAKMRFIQAWQSLPDFGIKYYIVRFRGSKKDELLGISYNRLIRIDMSTGLPVTTWRFSNMKQWNVNWEIRQVTIEFDQSVSIAFSCQSCDCKVVHEYIGGYIFLSTRSKDQNETLDEELFHKLTG 658          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 407.142 bits (1045), Expect = 2.234e-129
Identity = 262/724 (36.19%), Postives = 401/724 (55.39%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL----QIPLV---------KEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPE-----PLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F IR PEELSL    + P           +E L+    L    S   +I SS    S    PT +     PLSPTS +      FG         SP+S  N S L+   P +   ++++                    +++P++L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  +DN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E +  P +++ +  C++  +VN+S  KF IK+         E   + D +  Y+ WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    K+E+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGPLLTPGSG--SIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------FGD--------SPLSEGNPSILAVSQPITSPDILVK--------------------MYKPQSLLDKAKINQGWLDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQII---EPITT---DIN---PECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 680          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 405.216 bits (1040), Expect = 1.446e-128
Identity = 257/728 (35.30%), Postives = 397/728 (54.53%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELS------------------------LQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPE-----PLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDY----LRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F IR PEELS                        L+ PL+     S+  +  +     +I SS    S    PT +     PLSPTS +      FG         SP+S  N S L+   P +   ++++                    +++P++L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  +DN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E +  P +++ +  C++  +VN+S  KF IK+         E   + D +  Y+ WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     K Y    + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    K+E+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGPLLTPGSASD--VLYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------FGD--------SPLSEGNPSILAVSQPITSPDILVK--------------------MYKPQSLLDKAKINQGWLDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQII---EPITT---DIN---PECLVSPRYLKKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 684          
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 404.445 bits (1038), Expect = 2.632e-128
Identity = 260/735 (35.37%), Postives = 401/735 (54.56%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELS------------------------LQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPE-----PLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F IR PEELS                        L+ PL+     S+  +  +     +I SS    S    PT +     PLSPTS +      FG         SP+S  N S L+   P +   ++++                    +++P++L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  +DN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E +  P +++ +  C++  +VN+S  KF IK+         E   + D +  Y+ WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    K+E+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLNRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMRVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEDAEEETLELEGPLLTPGSASD--VLYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------FGD--------SPLSEGNPSILAVSQPITSPDILVK--------------------MYKPQSLLDKAKINQGWLDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSREEAHGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAQWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQII---EPITT---DIN---PECLVSPRYLKKYKNKQPGFVRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKDELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 691          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 404.831 bits (1039), Expect = 2.703e-128
Identity = 263/707 (37.20%), Postives = 395/707 (55.87%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHK-----AVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPE-----KLIKKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL I +TD+  +V +RV G+VHIGGVM K     A+  L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL        L+     T  K K    Q  +N     EL  P  L+P S      Y    L   T T +  S     LS       +S + EG      +  P  S      +++P+ L+ KA++N  WLDS+RSLMEQ +  +    L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +S+E+        +N D      DEVD  +S+LE  +  G  S + G +   P L   L+V++  KL +K  K+ WC  +   ++ Y SK+E N  P +++ +  C++  +VN+S  KF IK+     E   E   + +N+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P      + +N+   D+N   PE     + +KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + +F    KEE+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F KLT
Sbjct:   15 DGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL--------LRKPRDPTKKKKKKIDDQCEDNIL---ELEGPL-LTPGSGS---IYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKEN--DALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENH------YNNSDKE---VDEVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQFIPDQVNS---DIN---PECVVSPRYLKKYKNKQPGYVRDLITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEMRLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 688          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 403.675 bits (1036), Expect = 4.728e-128
Identity = 259/696 (37.21%), Postives = 392/696 (56.32%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPE-----KLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL I +TD+  +V +RV G+VHIGGVM K        +DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL        L+     T  K K    Q  +N     EL  P  L+P S Y++       L   T T +  S     LS       +S + EG      +  P  S      +++P+ L+ KA++N  WLDS+RSLMEQ +  +    L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +S+E+        +N D      DEVD  +S+LE  +  G  S + G +   P L   L+V++  KL +K  K+ WC  +   ++ Y SK+E N  P +++ +  C++  +VN+S  KF IK+     E   E   + +N+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P      + +N+   D+N   PE     + +KK K+K  + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + +F    KEE+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F KLT
Sbjct:   13 DGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKL-------KDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL--------LRKPRDPTKKKKKKIDDQCEDNIL---ELEGPL-LTPGSIYSS-----PGLYSKTMTPTYDSRDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKEN--DALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENH------YNNSDKE---VDEVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQFIPDQVNS---DIN---PECVVSPRYLKKYKNKQ-ITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEMRLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 665          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 401.364 bits (1030), Expect = 2.665e-127
Identity = 258/695 (37.12%), Postives = 391/695 (56.26%), Query Frame = 3
Query:   84 GSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPE-----KLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            G+WEL I +TD+  +V +RV G+VHIGGVM K        +DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL        L+     T  K K    Q  +N     EL  P  L+P S Y++       L   T T +  S     LS       +S + EG      +  P  S      +++P+ L+ KA++N  WLDS+RSLMEQ +  +    L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +S+E+        +N D      DEVD  +S+LE  +  G  S + G +   P L   L+V++  KL +K  K+ WC  +   ++ Y SK+E N  P +++ +  C++  +VN+S  KF IK+     E   E   + +N+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P      + +N+   D+N   PE     + +KK K+K  + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + +F    KEE+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F KLT
Sbjct:    8 GTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKL-------KDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL--------LRKPRDPTKKKKKKIDDQCEDNIL---ELEGPL-LTPGSIYSS-----PGLYSKTMTPTYDSRDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKEN--DALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENH------YNNSDKE---VDEVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQFIPDQVNS---DIN---PECVVSPRYLKKYKNKQ-ITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEMRLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 659          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 401.749 bits (1031), Expect = 6.482e-127
Identity = 265/724 (36.60%), Postives = 402/724 (55.52%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHK-----AVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKY-PF-GTLNHNTG----TLSPM--STFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPE-----KLIKKAKSKDYL---------------RSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL I +TD+  +V +RV G+VHIGGVM K     A+  L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL        L+     T  K K    Q  +N     EL  P  L+P S  + L   P  G++  + G    T++P   S     LS       +S + EG      +  P  S      +++P+ L+ KA++N  WLDS+RSLMEQ +  +    L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +S+E+        +N D      DEVD  +S+LE  +  G  S + G +   P L   L+V++  KL +K  K+ WC  +   ++ Y SK+E N  P +++ +  C++  +VN+S  KF IK+     E   E   + +N+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P      + +N+   D+N   PE     + +KK K+K +L                +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + +F    KEE+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F KLT
Sbjct:   15 DGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL--------LRKPRDPTKKKKKKIDDQCEDNIL---ELEGPL-LTPGSGTDVLYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKEN--DALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENH------YNNSDKE---VDEVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQFIPDQVNS---DIN---PECVVSPRYLKKYKNKQHLYFKQMETIISNLVQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEMRLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 708          
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Match: sh3bgrl3 (SH3 domain binding glutamate-rich protein like 3 [Source:Xenbase;Acc:XB-GENE-965976])

HSP 1 Score: 400.979 bits (1029), Expect = 1.019e-126
Identity = 263/716 (36.73%), Postives = 395/716 (55.17%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHK-----AVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPE-----KLIKKAKSKDYL---------------RSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL I +TD+  +V +RV G+VHIGGVM K     A+  L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL        L+     T  K K    Q  +N     EL  P  L+P S      Y    L   T T +  S     LS       +S + EG      +  P  S      +++P+ L+ KA++N  WLDS+RSLMEQ +  +    L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +S+E+        +N D      DEVD  +S+LE  +  G  S + G +   P L   L+V++  KL +K  K+ WC  +   ++ Y SK+E N  P +++ +  C++  +VN+S  KF IK+     E   E   + +N+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P      + +N+   D+N   PE     + +KK K+K +L                +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + +F    KEE+IGI +NR++ ++  +GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F KLT
Sbjct:   15 DGTWELNIHVTDLNRDVTLRVTGEVHIGGVMLKLLIFVALILLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDKVFKAVSDICKTFNIRHPEELSL--------LRKPRDPTKKKKKKIDDQCEDNIL---ELEGPL-LTPGSGS---IYSSPGLYSKTMTPTYDSRDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMYKPQTLLDKAKINQGWLDSARSLMEQDVKEN--DALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSVMSSENH------YNNSDKE---VDEVDAALSDLEITLEGGKTSTILGDITSIPELTDYLKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCENEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQFIPDQVNS---DIN---PECVVSPRYLKKYKNKQHLYFKQMETIISNLVQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLARFQGGKKEELIGITYNRLIRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEMRLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFFKLT 697          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt2 (fermitin family member 2 [Source:MGI Symbol;Acc:MGI:2385001])

HSP 1 Score: 414.461 bits (1064), Expect = 3.151e-132
Identity = 258/701 (36.80%), Postives = 396/701 (56.49%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+ G+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA+ N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW L+   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E    P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  + +        D  PE L+     KK KSK  + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    +EE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLIMPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPVTSPEILAKMFKPQALLDKAKTNQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQLNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPDQIT------TDVNPECLVSPRYLKKYKSKQ-ITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt1 (fermitin family member 1 [Source:MGI Symbol;Acc:MGI:2443583])

HSP 1 Score: 409.838 bits (1052), Expect = 1.848e-130
Identity = 260/719 (36.16%), Postives = 399/719 (55.49%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISI----TDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIP----LVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQL---VQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKD-ELNQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ----TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            MLS  +    SWEL + +     + Q E+ +RV GD+HIGGVM K VE +   QDWSD+ LWW  K  WL  T  TLD+ GVQ+++ L     H  L + LP+   V + V+FSA +F  V  ICK   IR PEELSL  P      K+  K  ++   +   I  ++SS   S     P     + T  Y+ +        + T  LS M+ F  S  ++  Q+C+ L    P        P+  V  +  +FQP++L+ KA++N+ WLDSSRSLMEQ I  D  + L  RFK++ F+DLN KYDAVRI+QL+EQA+W ++   +D TE+EM++F ALQ      ++ + E Q+   K            DEV+  +S LE    G   K D  L      P+L   L+++R  KL +K+ K+ W V +   + ++ +K+ E  +PI ++ +  C++  +VNVS  KF IK+         E   + D++D Y+ WMAA  L ++ KT+ +   +Q E+ +I+  L+++    +P   + L   D+N          PE L+     KK KSK  L +RI E+H NV  + +++AK ++IQAWQ L  FG+TY +V+F    K++I+G+A+NR++ I+  +G    T  F++M+ WN+NW+  +V ++F +   + F  LS +CK V E+IGGY+FL+ R+ D+N+ L+  LFHKLTG
Sbjct:    1 MLSSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKMLRLRLPNAKTVRLRVSFSAVVFKAVADICKVLNIRRPEELSLLKPSSDYCKKKKKKEKNSKEPVIEDILNLESSSTSSGSPVSPGLYSKTMTPTYDPI--------NGTPALSTMTWFGDSPLTE--QNCSVLAFSQPP-------PSPDVLAD--MFQPRSLVDKAKMNAGWLDSSRSLMEQSIQED--EQLQLRFKYYTFFDLNPKYDAVRINQLYEQARWAVLLEEIDCTEEEMLIFAALQYHISKLSQCA-EIQDFATKS---------EVDEVEAALSSLEVTLEG--GKADNTLEDITDIPKLADYLKLFRPKKLMLKACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSS-YQPEVISILSFLKMKNRNSSPLVASSLENMDMN----------PECLVSPCCAKKHKSKQ-LAARILEAHHNVAQMPLVEAKLQFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVAYNRLIRIDAVTGIPVTTWRFANMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt3 (fermitin family member 3 [Source:MGI Symbol;Acc:MGI:2147790])

HSP 1 Score: 286.96 bits (733), Expect = 1.804e-84
Identity = 170/471 (36.09%), Postives = 269/471 (57.11%), Query Frame = 3
Query:  759 PAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQ-SKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDEL-NQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTK---EDLNNRLKDLNDY--MPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            PA        L +P +L  K +L+S WLDSSR LM+QGI A     L+ RFK++ F+DL+ K D VR+ QL+EQA+WDL++  +D TE+EM+VF ALQ      T +S +           + + ++  D++D  ++ LE    G   S +   L   P L+  LR++R  KL +K  ++ W V +   L++Y S+DE    P  ++ +  C++  +VNVS  KF IK+   + E   E   +  ++  Y+ WMAA RL ++ +T+ +   +  E++ I+  L LQ        +    +      + LN Y  +  +  +K K+K  L  RI E+H NV  LS+ +A+ ++IQAWQ L +FGI+YV+V+F    K+EI+GIA NR++ I+   GDV  T  FS+MR WN+NWD  +V ++F +   + F  +S +C+ V E+IGGY+FL+ R   + +EL+  LF +LTG
Sbjct:  203 PAPDPLLLQRLPRPSSLPDKTQLHSRWLDSSRCLMQQGIKAG--DVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYHINKLT-LSGD--------VGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSS-YASEVQAILAFLSLQRAGGSNGGSGNKPQGPEAPAEGLNPYGLVAPRFQRKFKAKQ-LTPRILEAHQNVAQLSLTEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTG 660          

HSP 2 Score: 117.087 bits (292), Expect = 1.752e-26
Identity = 57/135 (42.22%), Postives = 81/135 (60.00%), Query Frame = 3
Query:   63 SENERIDGSWELTISITDIQNE---VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL 458
            +  + ID SWEL + + +   E   V +RV G+ HIGGV+ K VE + RKQDWSDH +WW  K  WL  T  TLD+YG+ ++++L     H  +I+ LP+   + +  +FS  +F  V  IC+   IR PEELSL
Sbjct:    7 ASGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSL 141          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt2 (fermitin family member 2 [Source:MGI Symbol;Acc:MGI:2385001])

HSP 1 Score: 141.354 bits (355), Expect = 4.018e-37
Identity = 67/126 (53.17%), Postives = 85/126 (67.46%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL 458
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+ G+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSL 140          
BLAST of PH domain-containing protein vs. Ensembl Mouse
Match: Fermt3 (fermitin family member 3 [Source:MGI Symbol;Acc:MGI:2147790])

HSP 1 Score: 147.517 bits (371), Expect = 9.618e-37
Identity = 88/254 (34.65%), Postives = 138/254 (54.33%), Query Frame = 3
Query:  759 PAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQ-SKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDEL-NQPINEILVSSCQMKAEVNVSANKFFIKITTSNREEF-KFQFDNKDDYSNWMAA 1511
            PA        L +P +L  K +L+S WLDSSR LM+QGI A     L+ RFK++ F+DL+ K D VR+ QL+EQA+WDL++  +D TE+EM+VF ALQ      T +S +           + + ++  D++D  ++ LE    G   S +   L   P L+  LR++R  KL +K  ++ W V +   L++Y S+DE    P  ++ +  C++  +VNVS  KF IK+   + E   +    N   +S W+ A
Sbjct:  203 PAPDPLLLQRLPRPSSLPDKTQLHSRWLDSSRCLMQQGIKAG--DVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYHINKLT-LSGD--------VGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRNSSTHSGWLPA 445          

HSP 2 Score: 116.701 bits (291), Expect = 1.280e-26
Identity = 57/135 (42.22%), Postives = 81/135 (60.00%), Query Frame = 3
Query:   63 SENERIDGSWELTISITDIQNE---VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL 458
            +  + ID SWEL + + +   E   V +RV G+ HIGGV+ K VE + RKQDWSDH +WW  K  WL  T  TLD+YG+ ++++L     H  +I+ LP+   + +  +FS  +F  V  IC+   IR PEELSL
Sbjct:    7 ASGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSL 141          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VZI3|UN112_DROME (Unc-112-related protein OS=Drosophila melanogaster OX=7227 GN=Fit1 PE=1 SV=1)

HSP 1 Score: 432.18 bits (1110), Expect = 9.895e-138
Identity = 269/719 (37.41%), Postives = 399/719 (55.49%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN--HNTGTL--------------------SPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFEN--NMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVD-GQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ--PINEILVSSCQMKAEVNVSANKFFIK------ITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            + +W L I ITD+Q E  +RV+GD HIGGVM   V+  +  +DWSDH LWWP KNIWL+ TR+TLDQ GVQS+S L    +H  L V +P +  +   VNFSA  F  V+ +CK+  IR+PEELS   PL  E LK N +  + + KI   +++        L T   +  T  YN      G+L+  HN   L                    SP  T+  + +       NS      +  E + M  +S   +    L +PK+ ++KARLN  WLDSS S+MEQG+       L  RFK+  F+DLN KYD VRI+QL+EQAKW +++  L+ TE+E ++F ALQ Q   QT++     +  +   D        ED++D  ++EL+    G     D G + + P L   L+  +  +  +K  KR +   +   L+ Y S+DE  +  P   I +  C++  +VN++  KF I+      I      E   + DN++ Y+ WMAA RL A+ ++L +   +  E+ +I  +L++Q PA  A LT   +N R  +  DY+  K+++K  SK     RI E+HANVR LS++DAK KYIQAWQ L +FG+T  I+KFD   KEE++G+A NRIM ++ N+GD   T  ++ M++WN+NW  + +++  +   +VF   S +CK V EFIGGY+F++ R+ + NQ LN ++FHKLTG
Sbjct:    6 ENTWNLRILITDLQVEKTLRVKGDQHIGGVMLNLVDP-ELPKDWSDHALWWPAKNIWLTRTRSTLDQAGVQSDSFLHFTPMHKTLRVQMPDLRYLDYRVNFSAKTFGAVVSLCKDLDIRYPEELSFCKPLEPEHLKKNFS-KLPQRKIPVAEANGIAYVQPALDTNSFVPITGAYNGSN---GSLDRSHNGNLLCAPASPYTRRAATAPGTPISSPTGTWKHNSTGYASYDSNSSF---GDLQENLAMSPRSPSPDVRARLVRPKSRVEKARLNVGWLDSSLSIMEQGVRE--YDTLCLRFKYFTFFDLNPKYDQVRINQLYEQAKWSILNEELEPTEEETLMFAALQFQVNHQTDLHPPGIDSGI---DTSSQETGGEDDIDSALNELQITLEGPGGGKDQGNITRIPELSDYLKFLKPQRFTLKGYKRYFFTYRDLHLHLYKSQDESRRGAPTISINLKGCEVTPDVNLAQGKFAIRLEVPSEIRNGPNSEVWVRCDNEEQYAKWMAACRLAAKGRSLADSS-YDSEVSSIRSLLQMQKPAQGAPLT---VNPRSVEPMDYLSPKMMRKLSSKAV--QRILEAHANVRQLSLMDAKMKYIQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVNWGIKCMMIQLQDENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTG 705          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96AC1|FERM2_HUMAN (Fermitin family homolog 2 OS=Homo sapiens OX=9606 GN=FERMT2 PE=1 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.431e-134
Identity = 258/700 (36.86%), Postives = 395/700 (56.43%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDY----LRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E    P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  E +        D  PE L+     K Y    + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    KEE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLITPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPITSPEILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPEQIT------TDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q18685|UN112_CAEEL (Protein unc-112 OS=Caenorhabditis elegans OX=6239 GN=unc-112 PE=1 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 3.292e-134
Identity = 246/731 (33.65%), Postives = 397/731 (54.31%), Query Frame = 3
Query:   78 IDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPL-SPTSNYN--------TLKYPFGTLN-HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGP-----EFSECMK----------MPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGI-NADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLG-MKSQKRLWCVLQKQKLNFYVSKDELNQ-PINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ-----------TPAPQAVLTK--EDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            IDG W+L I +TD+  +  + V G++++GG+M + V     ++DWSDH LWWP+K  WL HTR+TLDQ G+ + ++LE   +H +  + LP M  +   V+FS + F    ++C++ GIR+ EELSL+  +  EDL+   +     +   +++  E    P  L    P+ +  SN +         L       N H  GTL    T  + +S   P + N  +   P      FSE ++           P  +   +  +F+P+N ++KA +N  WLDSSRSLMEQGI   D    +  RFKF  F+DLN KYD VRI+QL+EQAKW ++    D TE+E  +F ALQLQA LQ +    ++N               +D+VD+++ ELE+            L Q P L   L+  +  KL   K  KR +   +   L+++ S  ++N  P+    +  C++  +V+V   K+ IK+     E   +F  + D++  Y+ WMAA RL +R K++ +   +Q+E+E+I  +L++Q           T + +A   K   D N     +++Y+  K +++A+SK  ++ R+ ++H NVR L+  +AK +YI+AWQ L   GI Y IV+F    K E++ +A NR+  +N ++G+   T  F++M+ W++NW+   + + F+   + FKPLS +CK V EFIGGY+FL+ R+ + +Q L+ +LFHKLTG
Sbjct:   11 IDGKWQLPILVTDLNIQRSISVLGNLNVGGLMLELVSECDVERDWSDHALWWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKEARIQLPDMQMIDARVDFSVNSFKATKKLCRDLGIRYSEELSLKRYIPPEDLRRGTSDADNMNGPLSMRPGEESVGPMTLRKAAPIFASQSNLDMRRRGQSPALSQSGHIFNAHEMGTLPRHGTLPRGVSPS-PGAYNDTMRRTPIMPSISFSEGLENEQFDDALIHSPRLAPSRDTPVFRPQNYVEKAAINRGWLDSSRSLMEQGIFEGDI---ILLRFKFMNFFDLNPKYDPVRINQLYEQAKWSILLDEFDHTEEEATLFAALQLQATLQRDSPEPEEN--------------NKDDVDILLDELEQNLDAAALNRRSDLTQVPELADYLKYMKPKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSAPLGHFSLKGCEVSQDVSVGQQKYHIKLLLPTAEGMIDFILKCDSEHQYARWMAACRLASRGKSMADSS-YQQEVESIKNLLKMQSGNGNENGNSNTASRKAAAVKLPNDFN-----VDEYISSKYVRRARSKQQIQQRVSDAHGNVRQLTATEAKLQYIRAWQALPEHGIHYFIVRFRNARKAELVAVAVNRLAKLNMDNGESLKTWRFANMKKWHVNWEIRHLKIQFEDEDIEFKPLSADCKVVHEFIGGYIFLSMRSKEHSQNLDEELFHKLTG 717          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CIB5|FERM2_MOUSE (Fermitin family homolog 2 OS=Mus musculus OX=10090 GN=Fermt2 PE=1 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.204e-131
Identity = 258/701 (36.80%), Postives = 396/701 (56.49%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLN-----HNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL++ +TD+  +V +RV G+VHIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+ G+Q+++KL+    H  L + LP+M  V V VNFS  +F  V  ICK F IR PEELSL         K    L            SE+++   E P   P S  S Y++      T+      H+   LSP S +            +S + EG      +  P  S      +F+P+ L+ KA+ N  WLDSSRSLMEQ +  +  + L  RFK++ F+DLN KYDA+RI+QL+EQAKW L+   ++ TE+EM++F ALQ      + +++E         ++++ ++   DEVD  +S+LE  +  G  S + G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E    P +++ +  C++  +VN+S  KF IK+     E   E   + DN+  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P   L  + +        D  PE L+     KK KSK  + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ I +F    +EE+IGIA+NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F    +L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKCGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLD---------DQSEDEALELEGPLIMPGS-GSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFG----------DSALSEGNPGILAVSQPVTSPEILAKMFKPQALLDKAKTNQGWLDSSRSLMEQDVKEN--EALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWALLLEEIECTEEEMMMFAALQYHINKLSIMTSE---------NHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSREESSGTPAHQLNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHLNPDPQLIPDQIT------TDVNPECLVSPRYLKKYKSKQ-ITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKREELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 676          
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Match: sp|P59113|FERM1_MOUSE (Fermitin family homolog 1 OS=Mus musculus OX=10090 GN=Fermt1 PE=1 SV=4)

HSP 1 Score: 409.838 bits (1052), Expect = 1.292e-129
Identity = 260/719 (36.16%), Postives = 399/719 (55.49%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISI----TDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIP----LVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQL---VQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKD-ELNQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ----TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            MLS  +    SWEL + +     + Q E+ +RV GD+HIGGVM K VE +   QDWSD+ LWW  K  WL  T  TLD+ GVQ+++ L     H  L + LP+   V + V+FSA +F  V  ICK   IR PEELSL  P      K+  K  ++   +   I  ++SS   S     P     + T  Y+ +        + T  LS M+ F  S  ++  Q+C+ L    P        P+  V  +  +FQP++L+ KA++N+ WLDSSRSLMEQ I  D  + L  RFK++ F+DLN KYDAVRI+QL+EQA+W ++   +D TE+EM++F ALQ      ++ + E Q+   K            DEV+  +S LE    G   K D  L      P+L   L+++R  KL +K+ K+ W V +   + ++ +K+ E  +PI ++ +  C++  +VNVS  KF IK+         E   + D++D Y+ WMAA  L ++ KT+ +   +Q E+ +I+  L+++    +P   + L   D+N          PE L+     KK KSK  L +RI E+H NV  + +++AK ++IQAWQ L  FG+TY +V+F    K++I+G+A+NR++ I+  +G    T  F++M+ WN+NW+  +V ++F +   + F  LS +CK V E+IGGY+FL+ R+ D+N+ L+  LFHKLTG
Sbjct:    1 MLSSGDLTSASWELVVRVDHANGEQQTEITLRVSGDLHIGGVMLKLVEQMNIAQDWSDYALWWEQKRCWLLKTHWTLDKCGVQADANLLFTPQHKMLRLRLPNAKTVRLRVSFSAVVFKAVADICKVLNIRRPEELSLLKPSSDYCKKKKKKEKNSKEPVIEDILNLESSSTSSGSPVSPGLYSKTMTPTYDPI--------NGTPALSTMTWFGDSPLTE--QNCSVLAFSQPP-------PSPDVLAD--MFQPRSLVDKAKMNAGWLDSSRSLMEQSIQED--EQLQLRFKYYTFFDLNPKYDAVRINQLYEQARWAVLLEEIDCTEEEMLIFAALQYHISKLSQCA-EIQDFATKS---------EVDEVEAALSSLEVTLEG--GKADNTLEDITDIPKLADYLKLFRPKKLMLKACKQYWFVFKDTSIAYFKNKELEQGEPIEKLNLRGCEIVPDVNVSGRKFGIKLLIPVADGMNEVYLRCDHEDQYARWMAACILASKGKTMADSS-YQPEVISILSFLKMKNRNSSPLVASSLENMDMN----------PECLVSPCCAKKHKSKQ-LAARILEAHHNVAQMPLVEAKLQFIQAWQSLPEFGLTYYLVRFKGSKKDDILGVAYNRLIRIDAVTGIPVTTWRFANMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTG 674          
BLAST of PH domain-containing protein vs. TrEMBL
Match: R7UBB8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_187915 PE=4 SV=1)

HSP 1 Score: 523.087 bits (1346), Expect = 3.942e-171
Identity = 278/701 (39.66%), Postives = 432/701 (61.63%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTL--TMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNM-LFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ-PINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            M+S+   +DGSWELTI++TD+Q E  +RV+GD+HIGGVM + VE L    DWSDH LWWP+KN+WL+ TR+TLDQYGVQ++++L    +H  L + LP +    + VNFS+++F+ V+++CKE  IR+PEE+SL   L +++LK N     T+M+          N  SP    +P P SP        Y F     N GTLS             P S +SL  EG   +     P     E  + L++P++  +KAR+N  WLDSSRSLMEQGI  +  + + FRFKF+ FYDLN KYD+VRI+Q+FEQAKW L+S  LD T +EM++F ALQLQA+ Q  +          P  ++D +N  ED++D  +++L+    G        +   P L+  LR+++  K  +K+ K+ + VL+   L  + S+DE  + P+ +I +  C+   ++N+SA K+ +KI   + +   E+  + D +  Y+ WMAA RL ++ KT+ +   ++ E+++++  L +Q PAP   ++   ++ + +   D++    +KK K+K  + +RI E+HANVR +++++AK  YI+AWQ L ++GITY IVKF +  KEE++GIA+NR++ +   +GD   T  F +M++WN+NW+ + V + F   ++ F+ L+ +CKTV EFIGGY+FL+ R+ DKNQ LN ++FHKLTG
Sbjct:    1 MISDEGLVDGSWELTITVTDLQVERTLRVKGDLHIGGVMLRLVEALDIAIDWSDHGLWWPEKNLWLTRTRSTLDQYGVQADARLWFTPMHKTLRIQLPDLQITDIKVNFSSNVFTAVVKLCKELKIRYPEEVSLARKLERDELKKNRGALGTLMR----------NPGSP--FSSPGPQSP--------YMF-----NGGTLS-------------PGSMHSLAFEGAMDTTLANSPKTPTREALLSLYRPRSYAEKARINGGWLDSSRSLMEQGIREN--EVVLFRFKFYSFYDLNPKYDSVRINQIFEQAKWSLLSEELDCTLEEMMMFAALQLQAQFQVTV----------PQPDLDVSNPAEDDIDAALTDLQVSLEGSSVSNSSDIHHVPELQDELRLFKPKKFSLKNYKKFFFVLKDTHLTLFKSRDETQEPPVLKINIRGCEATPDINISARKYNMKIFVPSSDGLVEYWVKADTEGQYAKWMAAFRLASKGKTMADSS-YEAEVQSLLAFLNMQHPAPAPAISPNQVDLQPE---DFVAPCFLKKLKTKQ-VANRILEAHANVREMTLIEAKLNYIKAWQALPDYGITYFIVKFKSSKKEELLGIAYNRMIRMELATGDSTKTWRFPNMQTWNVNWEVKSVDVVFDDERVAFQCLTADCKTVHEFIGGYIFLSMRSGDKNQTLNEEMFHKLTG 646          
BLAST of PH domain-containing protein vs. TrEMBL
Match: V3ZRW4 (B41 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215642 PE=4 SV=1)

HSP 1 Score: 513.842 bits (1322), Expect = 5.427e-167
Identity = 273/710 (38.45%), Postives = 438/710 (61.69%), Query Frame = 3
Query:   51 IQMLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLK-----SNHTLTMMKSKIFAIQS-SENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEG---PEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINA-DFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSK-DELNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            +  ++++ R+DGSW L I++TD+Q E  +RV+GD H+GGVM + VE L    DWSDH LWWP++N+WLS TR+TLDQY VQ+++KL+   +H +L + LP +  + + V+FSA +F+ V+ +CKE GIR PEE+S    + K+DLK     +            A+ S  ++ SS   L    P  P+   ++   P+      TGT+S  ++FN ++S   P S +SL  EG      +    +P+K  F+   +++PKN I+KAR+N  WLDSSRSLMEQGI   DF   + F++KF+ FYDLN KYDA+RI+Q++EQAKW L++  +D TE+EM++F ALQ Q +LQ+ +   D +M    ++N+  N+  +D++D  + +L+E   G+     G +   P L   +R ++  KL +KS KR W   +   +  Y ++ D  +QP+    V  C+   +VN++  K+ IK+   + +   E   +FD+++ Y  WMAA +L ++ KT+ +   +  E++ +   L +Q  AP   +T  +++ + +   D++  +  KK KSK  ++ +I E+H NVR +S++DAK  +I+AWQ L  +GITY +VKF    KEE++G+A NRI+ ++ N+GD + T  ++ ++SW++NW+ E +IL+F+  ++ F  L   CK V EFIGGY+FL+ R+ DKNQ LN ++FHKLTG
Sbjct:    1 MAFIADSGRVDGSWTLNITVTDLQVEKLLRVKGDDHVGGVMLRLVEALDIALDWSDHALWWPERNMWLSRTRSTLDQYSVQADAKLQFTPMHKNLRIQLPDLQVLDMRVDFSAKVFASVVHLCKELGIRHPEEMSFLRKIDKDDLKRVVKEATKKKKKDPEAAGALSSNGQHHSSTGSLDGLSPF-PSRIRSSTGSPYNL--SGTGTMSQFNSFNGTIS---PGSMHSLSFEGMMESTLAISPPVPSKEAFQ--YIYRPKNFIEKARINCVWLDSSRSLMEQGIRENDF---IIFKYKFYNFYDLNPKYDAIRINQIYEQAKWSLMAEEIDCTEEEMMMFAALQFQVQLQSGLPQPDLDM----SNNL--NHTEDDDIDAALKDLQESLEGNSISNSGDITHIPELGDYVRFFKPKKLTLKSYKRYWATFKDNHIALYRNREDTHSQPLMRFCVRGCETTPDVNLTHRKYGIKMFIPDADGMTEIIIKFDSEEQYCRWMAASKLSSKGKTMADSS-YSAEVQALQTFLSMQHTAPAPAITTSNVDIQAE---DFVAPRFYKKIKSKAIVQ-KIMEAHNNVREMSLMDAKLAFIKAWQSLPEYGITYFVVKFINSKKEELLGVASNRIIRMDLNTGDSHKTWRYNTLQSWHVNWEVENMILEFEEGRVTFACLGAPCKVVHEFIGGYIFLSMRSQDKNQSLNEEMFHKLTG 688          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A0L8GYE5 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025940mg PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 4.328e-166
Identity = 283/720 (39.31%), Postives = 428/720 (59.44%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEP-------------LSPTSNYNTLKYPFGTLNHNTGTL------SPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFEN-NMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSK-DELNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLN--DYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            M+S+N  IDGSW+L I++TD+  ++ +RV+GD+HIGGVM + VE L    DWSDH +WWP +N WL+ TR+TLDQY VQ+++KLE   +H  L + LP++  + +PV+FS ++F  VI+ICK+ GIR PEELSL   L KEDLK N         +  +Q   ++      P  +               SP SN    + P  TL+H+ G++      SP +TFN + +S    S +SL ++G      +  P K   E  N+L +PK   +KAR+N  WLDSS SLMEQGI    +  L  RFKF  FYDL+ KYD+VRI+Q++EQAKW LIS  +D TE+EMV+F  LQLQ +L      E QN   +  D  D     ED++D  + EL+E   G  +     +   P L+  +++++  K  +K+ KR +CV ++  ++ Y SK D   +PI  I    C+   +VN+S+ KF IK+    +E   E   +FD K+ Y +WMAA RL ++ KT+ +   ++ E+  +   L +Q PA    +     +  + D+N  D++  + ++K K+  +L+ RI E+H+NV+ +S+ ++K  YI+AWQ L  +GITY I+K +   KEE+IG+A NRI+ ++  SGD   T  ++ +++W +NW+  +VIL F+   ++F   + +CK V EFIGGY+FL+ R+ DKNQ L+  LFHKLTG
Sbjct:    1 MMSDNGYIDGSWQLNINVTDLNVDIALRVKGDLHIGGVMLQLVEALDIALDWSDHGIWWPARNRWLNRTRSTLDQYEVQADAKLEFTPMHKPLQIQLPNLSIIELPVDFSCNVFGAVIQICKKCGIRHPEELSLMRKLEKEDLKKN--------TLIPVQHKRHRQKQPMSPYVDSPNSHNNSSNSLDFYSPHSN----RSPQSTLHHSPGSVHSLSSNSPQNTFNAN-NSYFAGSMHSLHLDGGYEQILLNGPHKPTKEAFNLLLRPKTFAEKARMNKGWLDSSISLMEQGIRE--RHLLLLRFKFFTFYDLSPKYDSVRINQIYEQAKWALISEEIDCTEEEMVMFAGLQLQVQL------ESQNPQPEIFDQTDGQE--EDDIDSALKELKESLEGTTAPSSNDITNVPELDAFIKIFKPKKFTLKNFKRYYCVFREYTISLYKSKEDRAGEPIARISTKGCEASPDVNLSSQKFGIKLFEPTKEGMSEIWLRFDTKELYCDWMAACRLASKGKTMADST-YESEVTTLKTFLSMQEPAADDSIVSS--SGSVPDINVEDFVAPRFVRKLKAGQFLK-RIKEAHSNVKNMSLTESKMAYIKAWQALPEYGITYFIIKMNNMKKEELIGVANNRIIRMDLQSGDSVKTWRYNTLQTWTVNWETRQVILKFEEENIIFDSPAADCKVVHEFIGGYIFLSMRSSDKNQTLDEALFHKLTG 693          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A4D5R9Q1 (Unc-112-related protein OS=Scolopendra viridis OX=118503 PE=4 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 1.365e-161
Identity = 275/710 (38.73%), Postives = 416/710 (58.59%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTM-----------------MKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPF--GTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQ-SKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDEL-NQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            DGSWEL I +TD+Q E  +RV+GD+HIGGVM K VE+L    DWSDH LWWP+KN+WLS TR+TLDQ GVQ+++ L    +H  L + LP +  +   VNFS  +F+ ++ +CK+ GIR PEELS   PL ++DLK N+   M                 M S   +  S +   S   L    P +P ++      P    T   N        TFN + S   P +    +  G + S        S      L +P+NL ++AR+NS WLDSS SLMEQ +  +F   L  R+KF  FYDLN KYD++RI+Q++EQAKW L+S  +D TE+EM++F ALQLQ  LQ+++   + N +            TED++D  +++L+    G   +   G + + P L   LR  +  KL +K  +R + V +   L++Y ++D++  QPI++I +  C++  +VN+S+ K+ IK+   T     E   + D++  Y+ WMAA RL ++ KT+ +   +  E+++I+  L +Q PAP   +    L+    ++ DY+  + +KK K K  + +RI E+HANV+ L++ DAK  YI+AWQ L ++G+   IVKF    KEE++GIAFNR+M ++ +SGD   T  ++ MR+WN+NW+ + V ++F+   +VF  LS +CK V E+IGGY+FL+ R+ D+NQ LN +LFHKLTG
Sbjct:   10 DGSWELRIFVTDLQVERNLRVKGDLHIGGVMLKLVEDLDIAIDWSDHALWWPEKNMWLSRTRSTLDQCGVQADALLHFTPMHKTLRLQLPDLRYIDANVNFSCKVFNAIVNVCKDLGIRHPEELSFGRPLTQDDLKRNYRTPMYHPRHRQQHNTSNLNTTMNSTSLSTNSLDKSGSGGALTPKTPGTPVAS------PLSNSTWRANCNYSPYNGTFNGTFSPSGPNASFDSMNGGGDTSLAHSPQTPSTEAKQSLVRPRNLAERARINSMWLDSSLSLMEQNVK-EFDT-LLLRYKFFTFYDLNPKYDSIRINQIYEQAKWSLLSEEIDCTEEEMMMFAALQLQVNLQSQLPQPEWNTS------------TEDDIDAALTDLQVTLEGSAITNSHGPMTKIPELCDYLRFLKPKKLTLKGFRRYYFVFKDTTLSYYKNRDDVQGQPIHKINLKGCEVTPDVNISSGKYGIKLEVPTNEGMSENCIRCDSEQQYAKWMAACRLASKGKTMADSS-YDGEVQSILAFLSMQHPAPAPAINPNSLD---INVEDYVAPRFLKKLKGKQ-MATRILEAHANVKDLNLNDAKMNYIKAWQALPDYGVALFIVKFTNSKKEELLGIAFNRLMRMDLHSGDHIKTWRYNTMRAWNVNWEVKHVRVEFEEEPVVFSCLSADCKIVHEYIGGYIFLSMRSKDQNQVLNEELFHKLTG 694          
BLAST of PH domain-containing protein vs. TrEMBL
Match: A0A2C9JQH7 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106063740 PE=4 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 5.092e-159
Identity = 283/723 (39.14%), Postives = 421/723 (58.23%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSK---------IFAIQSSENKSSP------KELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMK---MPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINA-DFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTE--DQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQP--INEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVL-TKEDLNNRLKDLN--DYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
             +++ E +DGSWEL I +TD+Q E  +RV GD+HIGGVM K V+ L    DWSDH LWWPDKN WL   R+TLDQY VQ+++KL    +H +L V LP +  + + V+FS   F+ V++ CKE GIR PEELS      KEDLK        + K         + A  +  N S           P+  P+ P+     ++      N +T ++S  STFN ++S   P S +SL  EG   S       +PAK  F+   L++PKN  +KAR+N  WLDSS SL+EQGI   DF   +  +FKF+ FYDLN KYDA+RI+Q++EQAKW LIS  +D TE+EM+VF ALQ Q  +Q+ +     DQ+   +  D         DE+D  + +L+E   G      G +   P L   ++ ++  KL +KS K+ +   +   + FY +K+E + P  +  I V  C+ + +VN+SA+K+ IK+     E   E   +FD ++ Y  WMAA +L ++ KT+ +   ++ E++ I   L LQ P       +    +N + ++N  DY+  +  KK K++  L S+I E+HA+V+ +S+++AK  +I+AWQ L  FGITY  +K     KEE++G+A NRI+ ++ N+GD   T  ++ ++SW++NW+ E VILDF   K+ F  +  +CKT+ EFIGGY+FL+ R+ DKNQ LN ++FHKLTG
Sbjct:    5 FVADGEVVDGSWELNILVTDLQVEKTLRVMGDLHIGGVMVKLVQALDIALDWSDHALWWPDKNKWLLRARSTLDQYNVQADAKLHFTPMHKNLKVQLPDLQVLELSVDFSIKCFATVVQTCKELGIRHPEELSFLRKWDKEDLKKVAKEVHKRKKRGDPDQNGPLSANGTHHNSSGSLDGGKLSPYPSRSPVGPSPTSTLVRSANSPYNLST-SVSGYSTFNGTMS---PGSMHSLSFEGTMESTLANSPFVPAKDAFQ--YLYRPKNFAEKARINCAWLDSSISLLEQGIKENDF---IMLKFKFYNFYDLNPKYDAIRINQIYEQAKWALISEEIDCTEEEMMVFAALQHQVRIQSGLPQPEFDQSQNAQSED---------DEIDAALKDLQESLEGSAVSPHGDITHIPELSDYVKFFKPKKLTLKSYKKYFATFKDTFIAFYRTKEESHGPPIMQRIDVRGCEAQPDVNLSAHKYGIKLFVPEPEGMSEICLRFDLEEQYCRWMAACKLASKGKTMADSS-YEAEVQAIQSFLGLQHPVVSPSHNSPTSSSNVITEVNSDDYIAARFFKKVKARS-LVSKIMEAHASVQEMSLMEAKLAFIKAWQSLPEFGITYFRIKMANSRKEELMGVASNRIIRMDLNTGDSLKTWRYNTLQSWHVNWEVENVILDFDTEKVTFASMECSCKTIHEFIGGYIFLSMRSTDKNQSLNEEMFHKLTG 707          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 390.193 bits (1001), Expect = 1.249e-123
Identity = 246/699 (35.19%), Postives = 380/699 (54.36%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ-PINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDY----LRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F                   +S ++   + SK           SP        LSPTS +      FG         SP+S  N S L+   P S   ++++                    L++P +L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  +DN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E +  P +++ +  C++  +VN+S  KF IK+         E   + D +  Y+ WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     K Y    + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    +EE+IGI +NR++ I+ ++ D   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLNKDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTF-------------------RSIYSSPGLYSKTMTPTYDSRDGSP--------LSPTSAW------FGD--------SPLSEGNPSILAVSQPISSPDILVK--------------------LYKPPSLLDKAKINQGWLDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNALGDITSIPELADYVKVFKPKKLTLKGPKQYWCTFKDITISCYKSREEAHGIPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTERQYAQWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQII---EPITT---DIN---PECLVSPRYLKKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGSKREELIGITYNRLIRIDASTRDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 630          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 389.808 bits (1000), Expect = 2.097e-123
Identity = 249/706 (35.27%), Postives = 384/706 (54.39%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQ-PINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F                   +S ++   + SK           SP        LSPTS +      FG         SP+S  N S L+   P S   ++++                    L++P +L+ KA++N  WLDSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  +DN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y S++E +  P +++ +  C++  +VN+S  KF IK+         E   + D +  Y+ WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    +EE+IGI +NR++ I+ ++ D   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLNKDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKLLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTF-------------------RSIYSSPGLYSKTMTPTYDSRDGSP--------LSPTSAW------FGD--------SPLSEGNPSILAVSQPISSPDILVK--------------------LYKPPSLLDKAKINQGWLDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSSDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNALGDITSIPELADYVKVFKPKKLTLKGPKQYWCTFKDITISCYKSREEAHGIPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTERQYAQWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQII---EPITT---DIN---PECLVSPRYLKKYKNKQPGYIRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGSKREELIGITYNRLIRIDASTRDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLSFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 637          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:103022983])

HSP 1 Score: 376.711 bits (966), Expect = 3.366e-118
Identity = 245/708 (34.60%), Postives = 389/708 (54.94%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQNE----VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYN----TLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLG-DQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLV-FKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            M++  ER   SWEL+I +   Q +     K+ V+GD+HIGG+M K VE ++  Q+WSDH LWW  KN WL     TLD+YGVQ+++ L     H  L++ LP+M  + + ++FS+ +F  V  ICK   IR  EELSL        LK+       K K       E+     E+   + +S T+  +    T+   +   N    + + +     SL+S  P          PE  E  KM           +QP ++  K+ +N+ WLDSS SLMEQGI  + K  L  RFK+H F+DLN KYDAVRI QL+EQA+W ++   ++ TE+EM++F +LQ      T        M+ KP D  D  ++  DEV+  +S LE    G +  K+   +   P+LE +L++YR  +L +++ K  W V +   +++Y +K+  + +PI ++ +  C++  +VNV+  KF IK+         E   + DN+  Y+ W AA  L ++ KT+     +  E+ NI   L++++ AP       D+ +   +   ++  +  KK K+K  L +RI ++H N+  LS+++AK ++IQAWQ L  FGI Y IV+F  C K+EI+GI++NR++ I+ ++     T  FS+M+ WN+NW+  +V ++F     V F   S +C+ V E+IGGY+FL+ R+ D+N+ L+ +LF KLTG
Sbjct:    1 MVTAAER-QNSWELSIQVDQRQGDESMKFKILVKGDLHIGGLMLKLVEKIKTPQNWSDHALWWEKKNCWLLKNHWTLDKYGVQADADLRFTPQHKPLLLQLPNMKTIKLTISFSSVVFKAVEEICKALNIRRSEELSL--------LKAPDDPKKKKKKDKNKDQEED-----EIIDMDVISGTAGSSLYSKTMTATYDPENGTPASATSLWFGENSLTSSQPNV-------PPE--ELAKM-----------YQPLSMEDKSVINAGWLDSSSSLMEQGIQENDK--LLLRFKYHCFFDLNPKYDAVRITQLYEQARWAILLEEIECTEEEMLMFASLQYHICKLT--------MSTKPVDYSDEPDI--DEVEAALSHLETTLEGRNTDKILEDITDIPKLEDTLKLYRPKRL-LRTFKDYWFVFKDTSISYYKNKESASGEPIEQLHLRGCEVVPDVNVTEKKFGIKLLLPVADGMNEVYIRCDNETQYAKWKAACILASKGKTMAYSS-YGSEVRNIQSFLQMKSLAPPPGQAASDVESMEMNPECFVSPRYGKKYKNKQ-LSTRILDAHHNISQLSLMEAKMRFIQAWQSLPEFGIKYYIVRFRGCKKDEILGISYNRLIRIDTSTRLPVTTWRFSNMKQWNVNWEIRQVSIEFDQNVWVAFSCQSCDCRVVHEYIGGYIFLSTRSKDQNETLDEELFRKLTG 659          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt3a (fermitin family homolog 3 [Source:NCBI gene;Acc:103039629])

HSP 1 Score: 374.4 bits (960), Expect = 1.377e-117
Identity = 235/700 (33.57%), Postives = 382/700 (54.57%), Query Frame = 3
Query:   90 WELTISITDIQNE---VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKM-----PAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPT-DNVD-ANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKA-TKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            W+L++++ ++  E   +K+ V  D+HIGGV+ K VE  + K+DWSDH LWW  K  WL     TLD+ G+ ++++L L   H  L ++LP++  + + V FS+ +F  VI ICK   IR PEELSL  P+ +   K        + +++ I S+         P P                      TG++         L++ +P    +   E PE     KM     PA        +++P + + KA++N  WLDSSRSL++QG+    K  L  RFK++ F+DL  ++DAVR+ QL+EQAKW ++   +D TE+EM++F ALQ       ++ST +Q +   P  D++D A    E +++   S  EEM          + +  P L   L+++R  K  +K  K+ W   +   +++Y SK+E   +PI ++ +  C++  +V+V+A KF I++     E   E   + DN+  YS WMAA RL ++ KTL +   +  E+++I   L +Q  TP  + V + E +N      +  +  +  KK K K  L  RI E+H NV  LS+ +A  K++Q WQ L +FG++Y +V+F  C K+E++GIA NR++ I+ +  DV  T  ++ MR WN+NWD ++V ++F     + F  ++ +CK V E+IGGY+F++ R+ ++N  LN +LFHKLTG
Sbjct:    4 WDLSVNVEELGEEAPPLKISVTSDLHIGGVILKIVEKTEIKKDWSDHALWWEQKQQWLLKPAWTLDKCGIHADARLYLTPQHKPLRLVLPNLLTLRLRVCFSSPVFRTVIGICKLLNIRHPEELSLLRPVEE---KKKKKQKGDEEEVYDITSA---------PLP----------------------TGSII-------KLANGMP----AFFAESPEMESVYKMLSVSQPAPPPETITKMYRPTSKVDKAQVNGRWLDSSRSLLQQGVKEGDK--LILRFKYYSFHDLAPQFDAVRLTQLYEQAKWAILLEEIDCTEEEMMLFAALQYHI---GKVSTTEQLVASCPAMDDLDSALQCLEVKMEAETSA-EEML---------ETMTAPELHDYLKLFRPKKQTLKKYKQFWFTFKDTSISYYKSKEESCKEPIQQMNLKGCEVAPDVSVAAQKFCIRLLIPEPEGMNEVYLRCDNEQQYSKWMAASRLASKGKTLADAS-YSSEVQSIQSFLAMQKTTPGNKTVQSDESINT-----HSLVSPRYQKKYKPKQ-LTPRILEAHQNVAQLSLTEAILKFLQIWQALPDFGLSYFVVRFKGCRKDEVLGIANNRLIRIDLSVEDVVKTWRYNTMRQWNVNWDIKQVAIEFNGNVNIAFSCVTADCKIVHEYIGGYIFMSTRSREQNDTLNEELFHKLTG 636          
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Match: fermt3a (fermitin family homolog 3 [Source:NCBI gene;Acc:103039629])

HSP 1 Score: 365.925 bits (938), Expect = 2.640e-114
Identity = 230/698 (32.95%), Postives = 379/698 (54.30%), Query Frame = 3
Query:   90 WELTISITDIQNE---VKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKM-----PAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKA-TKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            W+L++++ ++  E   +K+ V  D+HIGGV+ K VE  + K+DWSDH LWW  K  WL     TLD+ G+ ++++L L   H  L ++LP++  + + V FS+ +F  VI ICK   IR PEELSL  P+ +   K        + +++ I S+         P P                      TG++         L++ +P    +   E PE     KM     PA        +++P + + KA++N  WLDSSRSL++QG+    K  L  RFK++ F+DL  ++DAVR+ QL+EQAKW ++   +D TE+EM++F ALQ       ++ST +Q +   P           D++D  +  LE + +  ++  +  L  +P    +  ++R  K  +K  K+ W   +   +++Y SK+E   +PI ++ +  C++  +V+V+A KF I++     E   E   + DN+  YS WMAA RL ++ KTL +   +  E+++I   L +Q  TP  + V + E +N      +  +  +  KK K K  L  RI E+H NV  LS+ +A  K++Q WQ L +FG++Y +V+F  C K+E++GIA NR++ I+ +  DV  T  ++ MR WN+NWD ++V ++F     + F  ++ +CK V E+IGGY+F++ R+ ++N  LN +LFHKLTG
Sbjct:   16 WDLSVNVEELGEEAPPLKISVTSDLHIGGVILKIVEKTEIKKDWSDHALWWEQKQQWLLKPAWTLDKCGIHADARLYLTPQHKPLRLVLPNLLTLRLRVCFSSPVFRTVIGICKLLNIRHPEELSLLRPVEE---KKKKKQKGDEEEVYDITSA---------PLP----------------------TGSII-------KLANGMP----AFFAESPEMESVYKMLSVSQPAPPPETITKMYRPTSKVDKAQVNGRWLDSSRSLLQQGVKEGDK--LILRFKYYSFHDLAPQFDAVRLTQLYEQAKWAILLEEIDCTEEEMMLFAALQYHI---GKVSTTEQLVASCPA---------MDDLDSALQCLE-VKMEAETSAEEMLSVKP----NSYLHRPKKQTLKKYKQFWFTFKDTSISYYKSKEESCKEPIQQMNLKGCEVAPDVSVAAQKFCIRLLIPEPEGMNEVYLRCDNEQQYSKWMAASRLASKGKTLADAS-YSSEVQSIQSFLAMQKTTPGNKTVQSDESINT-----HSLVSPRYQKKYKPKQ-LTPRILEAHQNVAQLSLTEAILKFLQIWQALPDFGLSYFVVRFKGCRKDEVLGIANNRLIRIDLSVEDVVKTWRYNTMRQWNVNWDIKQVAIEFNGNVNIAFSCVTADCKIVHEYIGGYIFMSTRSREQNDTLNEELFHKLTG 642          
BLAST of PH domain-containing protein vs. Ensembl Sea Lamprey
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:553051])

HSP 1 Score: 444.121 bits (1141), Expect = 2.020e-144
Identity = 257/709 (36.25%), Postives = 412/709 (58.11%), Query Frame = 3
Query:   45 ETIQMLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPM--STFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQ-LVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPA--PQAVLTKEDLNNRLKDLN--DYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            E I+M  +    DG+WEL I +TD+Q EV +RV G++HIGGVM + VE L+ K+DWSDH LWW  K  WL  T  TLD+YG+Q+++ L     H  + + LPSM  V V VNFS  +F  V+ ICK F IR PEELS    L+++   S+        +        N     EL  P  ++PT++      PF +    + T++P   +     LS       +S + EG   +    +P  S      +++P+ L+ KAR+N  WLDSSRSLMEQGI  +    L  RFK++ F+DLN KYDA+RI+QL+EQAKW ++   ++ TE+EM++F ALQ               +++    + + +    DEVD  +S+LE    G +S    + +++ P L   L+++R  KL +K  K+ W V +   +++Y +KD+  +P+ +I +  C++  +VN++A KF IK+    T    E   + +++  Y+ WMAA RL ++ KT+ +   +  E+ +I+  L++Q  +  PQ++  +      + D+N   ++  + +KK K+K  L +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ +V+F    KEE++GIA+NR++ ++ ++GD   T+ FS+M+ WN+NW+  +V ++F    ++ F     +CK V EFIGGY+FL+ R  D+N+ L+ +LFHKLTG
Sbjct:    3 EGIRM-PDGHYADGTWELRILVTDLQQEVMMRVTGELHIGGVMLRLVERLEMKKDWSDHALWWERKTTWLLKTHWTLDKYGIQADATLHFTPQHKLMRLQLPSMKYVRVKVNFSDLVFKAVVDICKTFNIRHPEELS----LIRKPQDSSKKKKKKGGE------ENNHEEVTELEGPL-ITPTASPGG---PFSSPGWYSKTMTPTYDARDGSPLSPTTAWFGDSPLAEGNPSALAAALPNTSPEVLARMYRPQTLLDKARINGGWLDSSRSLMEQGIKDN--DILMLRFKYYSFFDLNPKYDAIRINQLYEQAKWAILLEDIECTEEEMMMFAALQYHI----------NKLSLMTEGHANHSEQEVDEVDAALSDLEIALEGGRSSSGLRDIMKIPELSDYLKMFRPKKLTLKGYKQYWFVFKDTAISYYRNKDD-PRPVQQITLRGCEVIPDVNIAAQKFNIKLLVPVTEGMTEVWLRCESEKQYAEWMAACRLASKGKTMADSS-YAGEVNSILTFLKMQNVSLEPQSISPQ-----NVPDINPESFVCPRYMKKYKAKQ-LTARILEAHQNVSHMSLVEAKMRFIQAWQSLPEFGITHFVVRFRGAKKEEMMGIAYNRLIRMDLSTGDAIKTYRFSNMKQWNVNWEVRQVAVEFDDEMQIAFHCSDADCKVVHEFIGGYIFLSTRAKDQNEALDEELFHKLTG 676          
BLAST of PH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002438.1 (pep scaffold:Pmarinus_7.0:GL480979:127958:159017:1 gene:ENSPMAG00000002171.1 transcript:ENSPMAT00000002438.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 395.586 bits (1015), Expect = 8.268e-126
Identity = 236/721 (32.73%), Postives = 394/721 (54.65%), Query Frame = 3
Query:   63 SENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVE--NLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQI---------------------PLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSK-DELNQPINEILVSSCQMKAEVNVSANKFFIKITTSNRE---EFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            ++    DGSWEL+++ITD++  V VR++GD+HIGG++ + V+      ++DWSDH LWW  + +WL     TLD+YGVQ+N+ L     H  L + LPS  +V V V+FS  +F  V  IC+   IR PEELSL                       PL++   K   T  +    +  +  +++ +         PL+ T+ +      FG      G LS ++T   +                         PA  +      ++ ++L  KAR+N  WLDSSRSLMEQG+    K  L  R+K+  F+D+N KYDA+RI+QL+EQA+W ++   +D TE+EM++F ALQ      +++S   +   V+   +VDA       VD  +S+LE  + + + S   G L   P+L   ++V++  +L +K  K  WCV +   +  Y +K D    P+  + +  C++  +VN+S  +F IK+     E   E   + DN++ Y  WMAA RL ++ KT+ +   +  E+++I+  LR++  +P   ++ + ++        ++  +  KK K+K  L +RI E+H NV  L++++AK K+IQAW  L +FGI + +V+F    K++ +GIA+NRI+  + N+G+   T  F++M+ WN+NW+ ++VI++F +  K+ F  +S +CK V E+IGGY+F++ R+ +++  L+ +LFHKLTG
Sbjct:   12 ADGHLADGSWELSVNITDLERPVTVRLKGDLHIGGLILRIVQAAGADEQRDWSDHALWWEHRKLWLLKHPWTLDKYGVQANAVLVFTPQHKLLRLQLPSSKRVRVTVSFSDPVFRAVADICRTCNIRHPEELSLLRKPEDPTKKKKKDKETTDDLLEPLIQASGKGAGTQGLYSKTMTPMYDTKDGT---------PLASTAQW------FGNDGLTDGGLSVLATSEAA-------------------------PADVLARR---YRQESLADKARINGGWLDSSRSLMEQGVKE--KDSLMLRYKYFCFFDINPKYDAIRINQLYEQARWGILLEKVDCTEEEMMMFAALQYHI---SKLSASPEIRKVESEPDVDA-------VDSALSDLEVALEVNNPSVPLGDLTSIPQLNDYIKVFKPKRLTLKGYKLYWCVFKDTCITCYKNKEDSTGVPLQTMNLKGCEVAPDVNISGQRFNIKLMIPVPEGMNEIWLRCDNEEQYGRWMAACRLASKGKTMADSS-YHGEVDSILSFLRMKQISPDVQISSQSISAADMTPECFVSPRYAKKIKTKQ-LAARIMEAHQNVANLALVEAKMKFIQAWS-LPDFGIAHFVVRFRGSKKDDALGIAYNRIIRQDVNTGEPIKTWRFNNMKQWNVNWEVKQVIIEFDEEVKIGFNCISADCKVVHEYIGGYIFMSTRSKEQDDNLDEELFHKLTG 674          
BLAST of PH domain-containing protein vs. Ensembl Nematostella
Match: EDO36565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIB3])

HSP 1 Score: 347.821 bits (891), Expect = 5.821e-108
Identity = 231/701 (32.95%), Postives = 366/701 (52.21%), Query Frame = 3
Query:   84 GSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQ------SKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDE-LNQPINEILVSSCQMKAEVNVSANKFFIKITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ------TP-APQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKF--DTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
             +W L++ IT +  E  V V G  HIG +M   VE L    DWSDH LWWP +  WL   R TLD  GVQ ++KL    +H  + V LP +  V + ++FS  +F  V  +C E GIR PEELSL  P  K  LK +   +M   K    + S +  SP    +  P SP  +    + PF TL +     SP++   ++L                                N L +PK++ +KA LNS WLDSSRSLMEQ +  +F   +Y R+K++ F+DLN K D +RI+QL+EQAKW +++  ++ TE+EM+ F A+Q Q ++          ++  P  N+  ++   D++D  +S+L+    G        +KV+  L   P +   L +     +     K          L  Y S++E   QP+  + +  C++  +VNVS +K+ I++   + EE +     +  Y+ WMAA R+ ++ KT+ + + ++ E   I   L +Q      TP +P  +  + +         D++ ++++KK K K  + +RI ESH  +   S++++K  YI+ WQ L  FG+++ IV+F  D   KEEI+GIAFNRIM I+ ++ +   T  +S MR+WN+NW+  ++I+  +   + F  +S + K V EFIGGY+FL+ R  D NQ  + +LF+KLTG
Sbjct:    8 ANWNLSVFITSLSTEKPVEVTGQTHIGKLMLDLVEGLDISADWSDHGLWWPQRRQWLLKPRITLDTCGVQGDAKLHFTPIHKKVRVQLPDLQFVELSMDFSKKVFVAVQELCAELGIRHPEELSLMKPNNK--LKKDARRSMKGKKK---RHSGSGISPG---SASPGSPAYSNFGPEGPFSTLENTNLNQSPLTPSQEAL--------------------------------NTLCKPKSIQEKAYLNSGWLDSSRSLMEQEVQ-EFDT-IYLRYKYYTFFDLNPKVDEIRINQLYEQAKWSILTEEVECTEEEMMSFAAIQFQVKI----------LSASPQSNIPEDD---DDIDAALSDLQLTLEGSSHSTTSPAKVNS-LNTVPEIMDYLNLVNNCDV-----KHFLSADSDTTLTVYKSQEEAFGQPVQRMNLRGCEVTTDVNVSKDKYQIRMRLQDNEEIELACSTESQYAKWMAACRMASKGKTMAD-ISYESEKAGIQAFLSMQHDKGDGTPLSPGQIHIQPE---------DFVGQRMLKKYKPKQ-IAARILESHTALHKASLVESKMMYIRQWQSLPEFGVSHFIVRFRSDKPKKEEILGIAFNRIMRIDASTREAIKTWRYSVMRAWNVNWETREMIVQCEDEMIAFNCVSADIKAVHEFIGGYIFLSMRK-DVNQPPSDELFYKLTG 635          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 409.838 bits (1052), Expect = 1.586e-130
Identity = 263/722 (36.43%), Postives = 400/722 (55.40%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL----QIPLVKEDLKSNHTLT-------MMKSKIFAIQSSENKSSPKELPTPE-----PLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F IR PEELSL    + P  K+                ++     +I SS    S    PT +     PLSPTS +      FG         SP+S  N S L+   P S   ++++                    L++P++L+ KA++N  W+DSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  TDN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E +  P  ++ +  C++  +VN+S  KF IK+         E   + D +  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    KEE+IGI +NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELEGPLLTPGSGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------FGD--------SPLSEGNPSILAVSQPISSPDILVK--------------------LYKPQSLLDKAKINQGWMDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSTDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPSYQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQFI---EPITT---DIN---PECLVSPRYLKKYKNKQPGYIRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKEELIGITYNRLIRMDAHTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 680          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 407.912 bits (1047), Expect = 8.772e-130
Identity = 261/728 (35.85%), Postives = 397/728 (54.53%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL------------------------QIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPE-----PLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDY----LRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F IR PEELSL                        + PL+     S   +  +     +I SS    S    PT +     PLSPTS +      FG         SP+S  N S L+   P S   ++++                    L++P++L+ KA++N  W+DSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  TDN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E +  P  ++ +  C++  +VN+S  KF IK+         E   + D +  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     K Y    + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    KEE+IGI +NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELEGPLLTPG--SASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------FGD--------SPLSEGNPSILAVSQPISSPDILVK--------------------LYKPQSLLDKAKINQGWMDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSTDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPSYQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQFI---EPITT---DIN---PECLVSPRYLKKYKNKQISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKEELIGITYNRLIRMDAHTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 684          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt2 (fermitin family member 2 [Source:NCBI gene;Acc:101155069])

HSP 1 Score: 407.142 bits (1045), Expect = 2.440e-129
Identity = 264/735 (35.92%), Postives = 401/735 (54.56%), Query Frame = 3
Query:   81 DGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL------------------------QIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPE-----PLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKS-LSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTE-DEVDLMISELE-EMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELN-QPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQ--TPAPQAVLTKEDLNNRLKDLNDYMPEKLI-----KKAKSK------DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFK-ATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLT 2135
            DG+WEL + +TD+  +V +RV G++HIGGVM K VE L  K+DWSDH LWW  K  WL  T  TLD+YG+Q++++L     H  L + LP+M  + V VNFS  +F  V  ICK F IR PEELSL                        + PL+     S   +  +     +I SS    S    PT +     PLSPTS +      FG         SP+S  N S L+   P S   ++++                    L++P++L+ KA++N  W+DSSRSLMEQ +  +  + L  RFK+H F+DLN KYDA+R++QL+EQAKW ++   ++ TE+EM++F ALQ               +++  TDN   N+  E DEVD  +S+LE  +  G  S   G +   P L   ++V++  KL +K  K+ WC  +   ++ Y SK+E +  P  ++ +  C++  +VN+S  KF IK+         E   + D +  Y++WMAA RL ++ KT+ +   +  E++NI+  L++Q   P PQ +   E +     D+N   PE L+     KK K+K      D + +RI E+H NV  +S+++AK ++IQAWQ L  FGIT+ + KF    KEE+IGI +NR++ ++ ++GD   T  FS+M+ WN+NW+ + V ++F     L F     +CK V EFIGGY+FL+ R  D+N+ L+ ++F+KLT
Sbjct:   15 DGTWELKMHVTDLHRDVSLRVTGEIHIGGVMLKLVEKLDVKKDWSDHALWWEKKKTWLLKTHWTLDKYGIQADARLLFTPQHKVLRLQLPNMKHMKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPKKKKKKLEEAEEDDLELEGPLLTPG--SASEIIYIGPVKGSIYSSPGLYSKTMTPTYDSRDGSPLSPTSAW------FGD--------SPLSEGNPSILAVSQPISSPDILVK--------------------LYKPQSLLDKAKINQGWMDSSRSLMEQDVKEN--EVLLLRFKYHSFFDLNPKYDAIRVNQLYEQAKWAILLEEIECTEEEMMMFAALQYHI----------NKLSIMSTDNHMNNSEKEVDEVDAALSDLEITLEGGKTSNTLGDITSIPELADYVKVFKPKKLTLKGYKQYWCTFKDITISCYKSKEEAHGTPSYQMNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDTEKQYAHWMAACRLASKGKTMADSS-YNLEVQNILSFLKMQHMNPDPQFI---EPITT---DIN---PECLVSPRYLKKYKNKQPGYIRDLISARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFLAKFQGGKKEELIGITYNRLIRMDAHTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEPSLAFICAEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLT 691          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:101160280])

HSP 1 Score: 401.749 bits (1031), Expect = 1.322e-127
Identity = 243/705 (34.47%), Postives = 391/705 (55.46%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQN----EVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL-QIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQS-KVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKD-ELNQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            M++  +  + SWEL + + + +     + K+RV GD+H+GG+M K VE ++  QDWSDH LWW  +  WL  T  TLD+YG+Q+++ L     H  L++ LP+M  + + V FS+ +F  V  IC++  IR PEELSL + P      K        +  IF I  S N                        P GT    + T++  +T++++    +P S  SL       ++C   P     E   +F+P +L+ KA  N+ WLDSSRSLMEQ + +  +  L  RFK+++F+DLN KYDAVRI QL+EQA+W ++   +D TE+EM++F +LQ      T        M+ +P DN  AN    DEV+  +S LE    G  + K    +   P+L  +LR++R   L ++  K  W V +   +++Y +K+    +PI +  +  C++  +VNV+  KF IK+         E   + DN+  Y+ W AA  L ++ KT+     ++ E++NI   L++++ AP       D++    +   ++  +  KK K+K  L +RI E+H N+  LS++DAK ++I+AWQ L  FGI Y IV+F    K+EI+GI++NR++ I+ ++G    T  F++M+ WN+NW+  +V+++F ++  + F  LS +CK V EFIGGY+FL+ R+ D+N+ L+  LF KLTG
Sbjct:    1 MITPAQYGETSWELGVQVDEKEGVESMKFKLRVAGDLHVGGLMLKLVEKIKAPQDWSDHALWWEQRKCWLLKTHWTLDKYGIQADADLRYTPQHKPLLLQLPNMKTIKINVCFSSMVFKTVSDICRQLNIRRPEELSLLKPPDDPSKKKKKKDKNSPQDDIFDIWDSANGG----------------------PGGTGPMYSKTMT--ATYDEN---GMPMSATSLWFGENPLAKCQ--PNLPPAELAKMFEPLSLVDKATNNAGWLDSSRSLMEQDVQSSDR--LLLRFKYNVFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHICKLT--------MSSEPRDN--ANEPEVDEVEAALSNLEVTLEGSHTDKFLEDITDIPQLADTLRLFRPKWLTLRPYKEYWFVFKDTNISYYKNKEASSGEPIEQFHLRGCEVVPDVNVTDKKFGIKLLIPVADGMNEVYIRCDNEMQYAKWKAACILASKGKTMAYSS-YKSEVKNIHSFLQMKSLAPPPGHATPDVDAMEMNAESFVSPRYAKKQKTKQ-LTTRILEAHQNIAHLSLMDAKMRFIKAWQSLPEFGIKYYIVRFKGSKKDEILGISYNRLIRIDMSTGLPVTTWRFANMKQWNVNWEVRQVMIEFDQSVSIAFCCLSCDCKVVHEFIGGYIFLSTRSKDQNETLDEDLFVKLTG 662          
BLAST of PH domain-containing protein vs. Ensembl Medaka
Match: fermt1 (fermitin family member 1 [Source:NCBI gene;Acc:101160280])

HSP 1 Score: 401.749 bits (1031), Expect = 1.322e-127
Identity = 243/705 (34.47%), Postives = 391/705 (55.46%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQN----EVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSL-QIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQS-KVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKD-ELNQPINEILVSSCQMKAEVNVSANKFFIKI---TTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDF-KATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
            M++  +  + SWEL + + + +     + K+RV GD+H+GG+M K VE ++  QDWSDH LWW  +  WL  T  TLD+YG+Q+++ L     H  L++ LP+M  + + V FS+ +F  V  IC++  IR PEELSL + P      K        +  IF I  S N                        P GT    + T++  +T++++    +P S  SL       ++C   P     E   +F+P +L+ KA  N+ WLDSSRSLMEQ + +  +  L  RFK+++F+DLN KYDAVRI QL+EQA+W ++   +D TE+EM++F +LQ      T        M+ +P DN  AN    DEV+  +S LE    G  + K    +   P+L  +LR++R   L ++  K  W V +   +++Y +K+    +PI +  +  C++  +VNV+  KF IK+         E   + DN+  Y+ W AA  L ++ KT+     ++ E++NI   L++++ AP       D++    +   ++  +  KK K+K  L +RI E+H N+  LS++DAK ++I+AWQ L  FGI Y IV+F    K+EI+GI++NR++ I+ ++G    T  F++M+ WN+NW+  +V+++F ++  + F  LS +CK V EFIGGY+FL+ R+ D+N+ L+  LF KLTG
Sbjct:    1 MITPAQYGETSWELGVQVDEKEGVESMKFKLRVAGDLHVGGLMLKLVEKIKAPQDWSDHALWWEQRKCWLLKTHWTLDKYGIQADADLRYTPQHKPLLLQLPNMKTIKINVCFSSMVFKTVSDICRQLNIRRPEELSLLKPPDDPSKKKKKKDKNSPQDDIFDIWDSANGG----------------------PGGTGPMYSKTMT--ATYDEN---GMPMSATSLWFGENPLAKCQ--PNLPPAELAKMFEPLSLVDKATNNAGWLDSSRSLMEQDVQSSDR--LLLRFKYNVFFDLNPKYDAVRITQLYEQARWAILLEEIDCTEEEMLMFASLQYHICKLT--------MSSEPRDN--ANEPEVDEVEAALSNLEVTLEGSHTDKFLEDITDIPQLADTLRLFRPKWLTLRPYKEYWFVFKDTNISYYKNKEASSGEPIEQFHLRGCEVVPDVNVTDKKFGIKLLIPVADGMNEVYIRCDNEMQYAKWKAACILASKGKTMAYSS-YKSEVKNIHSFLQMKSLAPPPGHATPDVDAMEMNAESFVSPRYAKKQKTKQ-LTTRILEAHQNIAHLSLMDAKMRFIKAWQSLPEFGIKYYIVRFKGSKKDEILGISYNRLIRIDMSTGLPVTTWRFANMKQWNVNWEVRQVMIEFDQSVSIAFCCLSCDCKVVHEFIGGYIFLSTRSKDQNETLDEDLFVKLTG 662          
BLAST of PH domain-containing protein vs. Planmine SMEST
Match: SMESG000020711.1 (SMESG000020711.1)

HSP 1 Score: 1442.94 bits (3734), Expect = 0.000e+0
Identity = 697/697 (100.00%), Postives = 697/697 (100.00%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFIKITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTGVIS 2147
            MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFIKITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTGVIS
Sbjct:    1 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFIKITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTGVIS 697          
BLAST of PH domain-containing protein vs. Planmine SMEST
Match: SMESG000025860.1 (SMESG000025860.1)

HSP 1 Score: 197.593 bits (501), Expect = 1.097e-52
Identity = 184/740 (24.86%), Postives = 324/740 (43.78%), Query Frame = 3
Query:   84 GSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQ----------IPL--------------VKEDLKSNHTLTMMKS-------KIFAIQSSENKSSPKELPTPEP---LSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNST--WLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFI-----------------KITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKEEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKAT--KLVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTG 2138
             S+ ++I I ++     +RV     I  V    +  +  K DWS+   W P + +WL      + Q+ +Q  SK+  ++  N L + LP +    + ++FS  +F     ICK+FGIR  EELSLQ           P+              V++    N   T+          K F       ++S  +L  P P   +SP S ++     F  L+ N   LS   +F  S  +  P+           FSE +K     +++            K R NS   W+ S  +LMEQ +       L  R+K+H +Y  N KYD +RI+Q+F Q+ W +IS   D + DE  +   +        ++ST D N     T N+  N++ + E+D M+  L    +G     D   ++   + G++ + +  +  +   K+   VL  + +N   + +      ++I +   +++  V +   K FI                   T+ + E  K +F N+ ++  W  ALRL+++    T    F+ E + +  ++ +++P     + K +      +L D +     K  KSK+ L+ ++     +   LS ++AK  YI+ W  L N G  Y+ V  +  ++ +IIGI ++R+++ +  +G V      + + SW  NW+    +L F  T  K+ FK  S  C+   E++GGY+F+  RN +K  +LN  +F  LTG
Sbjct:   12 SSFVISIFIKELNTTHNIRVDPTATISKVATDLINKIHLKYDWSEFWFWNPTEKLWLLPKSNIVSQFKLQPYSKINFVRRFNVLNIQLPDLQIRQLLLDFSKTVFQTNQIICKQFGIRHHEELSLQWKELKKLDSNTPVPNRRRISQSVSQQNVRQSSNRNRDSTLTSGLNTTGHRKRFTKPIYLTRNSQNDLEEPSPFNLVSPVSFFSI----FDDLSLNETDLSYYESFENSKLTNSPKKS---------FSEALKQQDIVIYKT----------YKDRANSPFHWMISELTLMEQAVGDYNNVLLRLRYKYHNYYWFNEKYDEIRINQIFHQSYWSVISGETDCSADETYLLAGILHHI---NKLSTNDTN---SETANLSPNDL-DKEIDSMLDRLHFDLIGKSCNEDE--MEHIEIAGNIELIKYPRNILSLYKKHSAVLSNEGINIIKTTN----VSSKIPIKGNEIRLNVKIRDKKIFIIEIILLKNNQNNKNELNNKTSKSFERVKIRFYNQQEFIKWATALRLLSKSIDFTLLSNFKYEYQMVTNIVEMKSPQFNLKMLKTNKEVDSVNLVDIIGSIHNKPFKSKEILQ-KVLYFAKSFSHLSKIEAKIAYIKCWLTLNNSGFHYMTVHVNQNSELQIIGIGYDRLILADIETGMVTNLVEMNKLISWKTNWELNNTLLMFSETFWKINFKN-SWECQIFHEYLGGYLFILMRNSEKFSDLNETIFRSLTG 713          
BLAST of PH domain-containing protein vs. Planmine SMEST
Match: SMESG000005290.1 (SMESG000005290.1)

HSP 1 Score: 100.908 bits (250), Expect = 1.601e-21
Identity = 153/711 (21.52%), Postives = 295/711 (41.49%), Query Frame = 3
Query:   57 MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVE--NLQRKQDWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSMHQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLTMMKSKIFAIQSSEN----------------KSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTLSPMSTFNKSLSSQIPQSCNSLV--IEGPEFSECMKMPAKSVFENNMLFQPKNLIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAVRIHQ-----LFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTVKPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQL-VQEPRLEGSLRVYRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEVNVSANKFFIK-ITTSNREEFKFQ---FDNKDDYSNWMAALRLVARRK----TLTNKVLFQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSKDYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNKE---EIIGIAFNRIMIINPNSGDVNGTHY-FSDMRSWNINWDAEKVILDFKATKLVFKPLSTNCKTVIEFIGGYVFL 2075
            M+S    IDGSW+L I   D+   V + V  +  +G +  K  +  N+++ Q   +  LW  +KNIWL  T  TL Q  + +NS L   K + ++ + L +     + V+FS     V+  IC EF I      +  I  +    +    +T +K K F+ + S++                K   K   +  P +PTS Y +L     +L +  G+   ++T     +     + N L   I    FS    + +KS F+            +++LN  W++ S+SLMEQ IN      L F+ K      L   +D   I       L+EQ K  ++S  +++  +  ++  ALQ    L  + S  + N  +      +     ++E+D M+  LE+  L    + D    ++     G  ++      G   + +L  +  + K+     +++ + P  E  + +C+      V +N+  I  +   N+   K +   F+++D +S + +A   VA       +L      ++    ++E+ R  +  P+  +     N    +L + +  ++ KK +S  YL++ I + +   + LS   +K +YI+       F   Y  VK     +E    ++ +     ++ +PN   +      ++ ++SW  N +  ++ L FK   + F     +     EFI  +++ 
Sbjct:    1 MISNYGYIDGSWKLKIVSEDLNGVVLLTVFNNTILGEIYMKIAQYFNMEKNQ-MKNFGLWCRNKNIWLLKTELTLHQLSLNANSTLFFTKKYKEINIQLTNKLNRKIVVDFSVQFLHVIKDICMEFEIE-----NFHIYSLLRYRRIYDGVTSIKPKTFSNKLSKSHLTASLRNLTSNFPNQKRISKNFGSNCPWTPTSGYGSLSSNVNSLENFHGSCLSINTQANHYTYDHHNNANKLNNDIHLTTFSNHQPIKSKSNFD------------RSKLNRDWINLSKSLMEQNINES--SSLIFKIK-----SLTINFDEENISDDLLDLLYEQFKDFVLSGEIELELNLGLILAALQYNIYLVEKQSYGNNNGNIHRNPRTNIPLSFDEEIDKMLFSLEKELLNISDEFDKSFSIRTDYFVGVHQIIPIKSSGKFLRMKLKLIKNQIKI---FKENDFSNPKYEFCLKNCKFFTNFGVDSNENIISWMFECNKRLLKIEMKFFNDEDFFSLYSSA---VAHSNFWWPSLKQIFDCERVARKLVEIFR-SSDEPEYNI----FNMPRVELVNLLGCRIGKKEQSGKYLKT-ILQYNQCFKTLSRRKSKIQYIRFCLNFPRFNYHYFFVKIHEPPEEMGLTVVAVNEEMFIVFDPNYYSITRLVLPWAVLKSWKFNTELNQLDLYFKNLFISFTTQDCSAICFHEFISTFIWF 674          
The following BLAST results are available for this feature:
BLAST of PH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FERMT22.979e-13536.86fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT22.979e-13536.86fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT23.216e-13536.92fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT23.216e-13536.92fermitin family member 2 [Source:HGNC Symbol;Acc:H... [more]
FERMT14.161e-12935.71fermitin family member 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
unc-1122.588e-13533.65pep chromosome:WBcel235:V:14691854:14697107:-1 gen... [more]
unc-1122.588e-13533.65pep chromosome:WBcel235:V:14691857:14696654:-1 gen... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fit19.871e-13937.41gene:FBgn0035498 transcript:FBtr0073209[more]
Fit19.871e-13937.41gene:FBgn0035498 transcript:FBtr0073210[more]
Fit26.104e-13534.81gene:FBgn0036688 transcript:FBtr0075275[more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt16.378e-13535.59fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
fermt16.378e-13535.59fermitin family member 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
fermt22.234e-12936.19fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt21.446e-12835.30fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt22.632e-12835.37fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3bgrl32.703e-12837.20SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl34.728e-12837.21SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl32.665e-12737.12SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl36.482e-12736.60SH3 domain binding glutamate-rich protein like 3 [... [more]
sh3bgrl31.019e-12636.73SH3 domain binding glutamate-rich protein like 3 [... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fermt23.151e-13236.80fermitin family member 2 [Source:MGI Symbol;Acc:MG... [more]
Fermt11.848e-13036.16fermitin family member 1 [Source:MGI Symbol;Acc:MG... [more]
Fermt31.804e-8436.09fermitin family member 3 [Source:MGI Symbol;Acc:MG... [more]
Fermt24.018e-3753.17fermitin family member 2 [Source:MGI Symbol;Acc:MG... [more]
Fermt39.618e-3734.65fermitin family member 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of PH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VZI3|UN112_DROME9.895e-13837.41Unc-112-related protein OS=Drosophila melanogaster... [more]
sp|Q96AC1|FERM2_HUMAN1.431e-13436.86Fermitin family homolog 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q18685|UN112_CAEEL3.292e-13433.65Protein unc-112 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|Q8CIB5|FERM2_MOUSE2.204e-13136.80Fermitin family homolog 2 OS=Mus musculus OX=10090... [more]
sp|P59113|FERM1_MOUSE1.292e-12936.16Fermitin family homolog 1 OS=Mus musculus OX=10090... [more]
back to top
BLAST of PH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UBB83.942e-17139.66Uncharacterized protein OS=Capitella teleta OX=283... [more]
V3ZRW45.427e-16738.45B41 domain-containing protein OS=Lottia gigantea O... [more]
A0A0L8GYE54.328e-16639.31Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A4D5R9Q11.365e-16138.73Unc-112-related protein OS=Scolopendra viridis OX=... [more]
A0A2C9JQH75.092e-15939.14Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt21.249e-12335.19fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt22.097e-12335.27fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
fermt13.366e-11834.60fermitin family member 1 [Source:NCBI gene;Acc:103... [more]
fermt3a1.377e-11733.57fermitin family homolog 3 [Source:NCBI gene;Acc:10... [more]
fermt3a2.640e-11432.95fermitin family homolog 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fermt22.020e-14436.25fermitin family member 2 [Source:NCBI gene;Acc:553... [more]
ENSPMAT00000002438.18.268e-12632.73pep scaffold:Pmarinus_7.0:GL480979:127958:159017:1... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO365655.821e-10832.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fermt21.586e-13036.43fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt28.772e-13035.85fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt22.440e-12935.92fermitin family member 2 [Source:NCBI gene;Acc:101... [more]
fermt11.322e-12734.47fermitin family member 1 [Source:NCBI gene;Acc:101... [more]
fermt11.322e-12734.47fermitin family member 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of PH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000020711.10.000e+0100.00SMESG000020711.1[more]
SMESG000025860.11.097e-5224.86SMESG000025860.1[more]
SMESG000005290.11.601e-2121.52SMESG000005290.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034934 ID=SMED30034934|Name=PH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2865bp
GTGACGTCATAAATTTATTCATTCACTTTTAATTTGTATTTTTTGAAACT
ATACAAATGCTGTCAGAAAATGAGCGCATTGATGGCTCATGGGAGCTAAC
AATTTCTATTACAGATATTCAAAACGAAGTTAAAGTTCGAGTTCGAGGCG
ATGTTCACATTGGAGGGGTTATGCATAAAGCTGTGGAAAATCTACAAAGA
AAGCAAGATTGGTCAGATCACATGCTCTGGTGGCCAGATAAAAATATTTG
GCTCTCACATACTCGAACTACTTTAGACCAATATGGAGTTCAGTCTAATT
CAAAATTGGAATTAATCAAAGTTCATAATGATCTCATTGTAATGCTGCCA
TCAATGCATCAAGTTACAGTTCCAGTAAATTTTTCCGCTGATATTTTTTC
TGTTGTTATCAGAATTTGCAAAGAATTTGGTATTCGATTTCCGGAAGAAT
TATCTTTACAAATACCTTTAGTTAAAGAAGACTTAAAATCTAATCATACC
TTAACTATGATGAAAAGCAAAATTTTCGCTATTCAAAGTAGTGAAAATAA
ATCCTCACCCAAAGAATTACCGACTCCAGAGCCTTTGTCTCCAACGAGTA
ATTACAATACTTTGAAATATCCATTTGGTACTTTAAATCATAACACGGGA
ACTTTATCACCAATGAGCACGTTTAATAAAAGTCTATCTTCCCAAATTCC
ACAGTCCTGCAATTCTTTAGTCATAGAAGGACCAGAATTTTCTGAATGCA
TGAAAATGCCAGCTAAATCGGTGTTTGAAAATAATATGCTATTCCAGCCG
AAAAATTTGATACAAAAAGCCAGGTTAAATTCTACTTGGCTTGATTCATC
AAGATCATTAATGGAACAAGGAATAAATGCAGACTTCAAAAAGCCGCTGT
ATTTTCGATTTAAATTTCATCTTTTTTACGATCTTAATACTAAATATGAT
GCCGTTAGAATTCATCAACTTTTCGAGCAAGCCAAATGGGATTTGATTTC
CTCGAGTTTAGATGTCACAGAAGATGAGATGGTCGTTTTCGTTGCTTTGC
AGCTACAAGCAGAATTACAGACTGAGATTTCCACAGAAGATCAAAATATG
ACAGTTAAACCTACTGACAATGTCGATGCTAACAACGTTACCGAAGACGA
AGTGGATTTAATGATATCTGAATTAGAAGAAATGTGTTTAGGAGACCAAT
CGAAAGTCGATGGTCAATTAGTTCAAGAACCACGATTAGAAGGAAGTCTT
CGAGTATATAGGACGAACAAATTGGGAATGAAAAGCCAGAAACGATTGTG
GTGTGTCTTACAAAAACAGAAATTGAATTTCTATGTCAGCAAAGACGAAC
TCAATCAACCAATCAATGAGATTCTCGTGTCCAGTTGTCAAATGAAAGCA
GAGGTGAATGTTTCAGCGAATAAGTTCTTCATTAAAATCACCACTTCTAA
TCGAGAGGAATTCAAATTTCAATTCGATAATAAAGATGACTACTCGAACT
GGATGGCAGCATTAAGATTGGTTGCTCGCAGGAAAACTCTAACAAATAAA
GTCTTATTCCAAAAGGAAATCGAAAACATAATGGAAGTACTCAGATTACA
AACTCCAGCACCGCAGGCGGTATTAACAAAAGAAGACCTAAATAACCGAT
TGAAAGACCTGAATGATTACATGCCTGAAAAGCTCATTAAAAAAGCCAAA
TCCAAAGATTACCTTCGTAGCCGTATTGGTGAATCGCATGCCAATGTTCG
GTTGTTGAGTGTTCTCGACGCAAAGCACAAATATATTCAAGCCTGGCAAA
GATTGGAGAATTTCGGAATAACTTATGTGATTGTGAAATTCGATACCTGC
AATAAAGAGGAAATCATTGGGATCGCTTTCAACAGAATTATGATTATCAA
TCCGAACTCCGGCGATGTCAATGGGACGCATTATTTCAGCGACATGAGAA
GTTGGAATATTAATTGGGATGCGGAAAAAGTCATTTTGGATTTCAAAGCC
ACCAAACTGGTTTTCAAGCCCCTGTCGACAAATTGCAAAACGGTTATCGA
GTTTATCGGTGGATATGTCTTCCTTAATCAAAGAAATCCTGATAAGAATC
AGGAATTGAACGTGAAACTTTTCCACAAATTAACCGGAGTTATTTCATAG
GGATTAAGGCAGTGGAGACTTGAGAAAAGTTTATCAGTCATTTATATATA
TAATTAATAGAGTTATTATAATAATCAATTTGTTTTATAACAGTTTTTTT
TAATTGAAAATAAATGAATATTTCTGTCTCAACAATGTAGGATTTTATAT
GAGAGGGACTAATCACTTTTTTTGTTGTTTTTTTAGTTTTATATTGACTT
TTAATAACTGAATGGGAAATGCATGCTTTGAGATGTTTTGTATATTTTAC
GGGCAATAATTTTTTATATTCATGGACATTTTTTATTGTTTAACTATTCT
GATAGAGATCGCTTCTGTTTTTGGTCGTGCATAATTACGTCATATTATTC
AAGTCACATATATTTGTTTGTCAGTATACATAAGTAATATAAATAAATGA
GCTGTTGATTTGTGTGTGTGTACAAATGTATACAAAATTTGATTACAGAC
CAAAATATTTTTGGTTTTTATTTTTGCTTTTAATTCAAATATAAACAATA
TTTTATTATTAAGTTTTCATTTAAGTCTGTCGATTTTACTTAGTTTGAAT
TATTTTTGTAGAATTAAATGTGCTTTTATGGTGGAGGTAAAATTACTAGA
TGAATTTTAAGTGGAATCAGAAATTTCGATTTTTATTTGAATTTTATTTT
GATATTGTATGCTACTCAAATTAATGAGTAGTAAATTCAATTCGCAATTT
TTTGTTAAATATATC
back to top

protein sequence of SMED30034934-orf-1

>SMED30034934-orf-1 ID=SMED30034934-orf-1|Name=SMED30034934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=698bp
MLSENERIDGSWELTISITDIQNEVKVRVRGDVHIGGVMHKAVENLQRKQ
DWSDHMLWWPDKNIWLSHTRTTLDQYGVQSNSKLELIKVHNDLIVMLPSM
HQVTVPVNFSADIFSVVIRICKEFGIRFPEELSLQIPLVKEDLKSNHTLT
MMKSKIFAIQSSENKSSPKELPTPEPLSPTSNYNTLKYPFGTLNHNTGTL
SPMSTFNKSLSSQIPQSCNSLVIEGPEFSECMKMPAKSVFENNMLFQPKN
LIQKARLNSTWLDSSRSLMEQGINADFKKPLYFRFKFHLFYDLNTKYDAV
RIHQLFEQAKWDLISSSLDVTEDEMVVFVALQLQAELQTEISTEDQNMTV
KPTDNVDANNVTEDEVDLMISELEEMCLGDQSKVDGQLVQEPRLEGSLRV
YRTNKLGMKSQKRLWCVLQKQKLNFYVSKDELNQPINEILVSSCQMKAEV
NVSANKFFIKITTSNREEFKFQFDNKDDYSNWMAALRLVARRKTLTNKVL
FQKEIENIMEVLRLQTPAPQAVLTKEDLNNRLKDLNDYMPEKLIKKAKSK
DYLRSRIGESHANVRLLSVLDAKHKYIQAWQRLENFGITYVIVKFDTCNK
EEIIGIAFNRIMIINPNSGDVNGTHYFSDMRSWNINWDAEKVILDFKATK
LVFKPLSTNCKTVIEFIGGYVFLNQRNPDKNQELNVKLFHKLTGVIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040790Kindlin_2_N
IPR037843Kindlin/fermitin
IPR035963FERM_2
IPR001849PH_domain
IPR019749Band_41_domain
IPR011993PH-like_dom_sf
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019748FERM_central
IPR019747FERM_CS
Vocabulary: cellular component
TermDefinition
GO:0001725stress fiber
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0005938cell cortex
GO:0009986cell surface
GO:0016020membrane
GO:0030054cell junction
GO:0031234extrinsic component of cytoplasmic side of plasma membrane
GO:0031258lamellipodium membrane
GO:0031674I band
GO:0031941filamentous actin
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005547phosphatidylinositol-3,4,5-trisphosphate binding
GO:0008289lipid binding
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007160cell-matrix adhesion
GO:0007179transforming growth factor beta receptor signaling pathway
GO:0007229integrin-mediated signaling pathway
GO:0008360regulation of cell shape
GO:0016055Wnt signaling pathway
GO:0033622integrin activation
GO:0034329cell junction assembly
GO:0034446substrate adhesion-dependent cell spreading
GO:0048041focal adhesion assembly
GO:0072657protein localization to membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 392..493
e-value: 2.0E-12
score: 57.3
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 395..489
e-value: 5.6E-11
score: 42.9
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 391..491
score: 11.372
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 87..591
e-value: 6.4E-26
score: 102.1
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..86
e-value: 1.9E-32
score: 113.4
NoneNo IPR availablePANTHERPTHR16160:SF13FERMITIN 2-RELATEDcoord: 4..694
NoneNo IPR availableCDDcd17096FERM_F1_kindlinscoord: 91..288
e-value: 2.30458E-20
score: 83.8692
NoneNo IPR availableCDDcd17185FERM_F1_KIND3coord: 196..288
e-value: 2.72839E-10
score: 55.2577
NoneNo IPR availableCDDcd17095FERM_F0_kindlinscoord: 11..90
e-value: 2.49493E-41
score: 142.827
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 389..494
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 587..674
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 292..591
e-value: 6.6E-31
score: 108.6
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 302..337
e-value: 1.08711E-4
score: 39.5371
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 586..678
e-value: 4.1E-6
score: 29.1
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 392..526
e-value: 1.5E-32
score: 114.3
IPR040790Kindlin-2, N-terminalPFAMPF18124Kindlin_2_Ncoord: 9..90
e-value: 3.2E-29
score: 101.0
IPR037843Kindlin/fermitinPANTHERPTHR16160FAMILY NOT NAMEDcoord: 4..694
IPR019747FERM conserved sitePROSITEPS00661FERM_2coord: 561..590
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 295..586