VWFD domain-containing protein

Overview
NameVWFD domain-containing protein
Smed IDSMED30034930
Length (bp)12236
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of VWFD domain-containing protein (SMED30034930) t-SNE clustered cells

Violin plots show distribution of expression levels for VWFD domain-containing protein (SMED30034930) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of VWFD domain-containing protein (SMED30034930) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for VWFD domain-containing protein (SMED30034930) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034930

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30034930SMESG000040823.1 dd_Smed_v4_91_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30034930SMESG000040823.1 dd_Smed_v4_91_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034930SMESG000040823.1 dd_Smed_v4_91_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30034930SMESG000040823.1 dd_Smed_v4_91_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034930SMESG000040823.1 dd_Smed_v4_91_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034930SMESG000040823.1 Contig54117uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30034930SMESG000040823.1 Contig54117newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30034930SMESG000040823.1 dd_91dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30034930SMESG000040823.1 OX_Smed_1.0.06223ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
parapharyngeal cellSMED30034930SMESG000040823.1 dd_Smed_v4_91_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of VWFD domain-containing protein vs. Ensembl Human
Match: ZAN (zonadhesin (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:12857])

HSP 1 Score: 139.813 bits (351), Expect = 1.013e-31
Identity = 109/367 (29.70%), Postives = 163/367 (44.41%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTK-SGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKEL 1324
            C   GDPHY T+DG+   F G C Y L Q         F +  +NE +G       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   +V VS  YS K+ G+CG+ +G  D+   K  G    +K      +GNS+   +     C+K + ++  S C      S+     CG L++ + PF  C    +V   +FF  C++DMC  +      Q + C   S +   C +AG     WR    CP+ C  N+ +S  A PCP TC + F G    C D    E C CN G++  G  C+    C C++        +   +W + G CKEL
Sbjct: 1156 CLVYGDPHYVTFDGRHFGFMGKCTYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPESTVTLLKGRRTL-VGGQQVTLPAIPSKGVFLGASGRFVE-LQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKLDGSPAGDKEE----LGNSWQTDQDEDQECQKYQVVNSPS-CDSSLQSSMSGPGFCGRLVDTHGPFETCLL--HVKAASFFDSCMLDMCGFQG----LQHLLCTHMSTMTTTCQDAGHAVKPWREPHFCPMACPPNSKYSLCAKPCPDTCHSGFSGMF--CSDRCV-EACECNPGFVLSGLECIPRSQCGCLHPA--GSYFKVGERWYKPG-CKEL 1503          

HSP 2 Score: 113.235 bits (282), Expect = 9.815e-24
Identity = 101/374 (27.01%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKD-WIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPC-YDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C P+R + Q  C  +   +         C+A GDPHY T+DG + HF G C Y LT+   +R  D   F +   NE RG     +Y K+V + +F     L +   + +NG    +P   +      +    L  +     ++V +DG     V V   Y  ++ G+CG+ N    D   +  R ++    +          S+PG      K  S       D W       K+C +L+ P  PFS+C +   V  ++ F  CV   C  K   +      C      A +C++AG +   WR++  CP++C   + +S  ++PCP TC +      R C   LP  E C C +G+I  G  CV    C C +
Sbjct: 1514 CQPWRCRAQEFCGQQDGIYGCHAQGAATCTASGDPHYLTFDGALHHFMGTCTYVLTRPCWSRSQDS-YFVVSATNENRGGILEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWLAQGRVTIRLSSNLVLLYTNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAW------NKNCAILINPQGPFSQCHQV--VPPQSSFASCVHGQCGTKGDTT----ALCRSLQAYASLCAQAG-QAPAWRNRTFCPMRCPPGSSYSPCSSPCPDTCSS--INNPRDCPKALPCAESCECQKGHILSGTSCVPLGQCGCTD 1871          

HSP 3 Score: 79.337 bits (194), Expect = 2.079e-13
Identity = 82/323 (25.39%), Postives = 136/323 (42.11%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIE---VQNEYRGDN-KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSK-----------PGHHCKKAKDISYH-----SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQ 1072
            C      +  NC S + +  +CS  GDP Y T+DG      G   Y L    +  D     +E   V+   + D  +   + + VI  ++    +L     L VN Q   VPY  ++ +R+    + L  V     + V+F G  NA + +   Y   ++G+CG+ +  R +D    SG    N     +  GNS+ V             P     +  ++        S C  + + S  + + C VL +P  PF+ C +   V    F + CV+D+C  ++ P   +++RC++ SG A +C EAG     WR +  C  Q
Sbjct: 2312 CQLTSDNSNSNCVSDKSE--QCSVYGDPRYLTFDGFSYRLQGRMTYVLI---KTVDVLPEGVEPLLVEGRNKMDPPRSSIFLQEVITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLWGQRLYLVTD-FELVVSFGGRKNAVISLPSMYEGLVSGLCGNYDKNRKNDMMLPSGALTQN----LNTFGNSWEVKTEDALLRFPRAIPAEEEGQGAELGLRTGLQVSECSPEQLAS-NSTQACRVLADPQGPFAACHQ--TVAPEPFQEHCVLDLCSAQD-PREQEELRCQVLSGYAILCQEAGAALAGWRDRTLCAGQ 2620          
BLAST of VWFD domain-containing protein vs. Ensembl Human
Match: ZAN (zonadhesin (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:12857])

HSP 1 Score: 139.813 bits (351), Expect = 1.071e-31
Identity = 109/367 (29.70%), Postives = 163/367 (44.41%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTK-SGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKEL 1324
            C   GDPHY T+DG+   F G C Y L Q         F +  +NE +G       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   +V VS  YS K+ G+CG+ +G  D+   K  G    +K      +GNS+   +     C+K + ++  S C      S+     CG L++ + PF  C    +V   +FF  C++DMC  +      Q + C   S +   C +AG     WR    CP+ C  N+ +S  A PCP TC + F G    C D    E C CN G++  G  C+    C C++        +   +W + G CKEL
Sbjct: 1156 CLVYGDPHYVTFDGRHFGFMGKCTYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPESTVTLLKGRRTL-VGGQQVTLPAIPSKGVFLGASGRFVE-LQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKLDGSPAGDKEE----LGNSWQTDQDEDQECQKYQVVNSPS-CDSSLQSSMSGPGFCGRLVDTHGPFETCLL--HVKAASFFDSCMLDMCGFQG----LQHLLCTHMSTMTTTCQDAGHAVKPWREPHFCPMACPPNSKYSLCAKPCPDTCHSGFSGMF--CSDRCV-EACECNPGFVLSGLECIPRSQCGCLHPA--GSYFKVGERWYKPG-CKEL 1503          

HSP 2 Score: 113.235 bits (282), Expect = 1.021e-23
Identity = 101/374 (27.01%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKD-WIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPC-YDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C P+R + Q  C  +   +         C+A GDPHY T+DG + HF G C Y LT+   +R  D   F +   NE RG     +Y K+V + +F     L +   + +NG    +P   +      +    L  +     ++V +DG     V V   Y  ++ G+CG+ N    D   +  R ++    +          S+PG      K  S       D W       K+C +L+ P  PFS+C +   V  ++ F  CV   C  K   +      C      A +C++AG +   WR++  CP++C   + +S  ++PCP TC +      R C   LP  E C C +G+I  G  CV    C C +
Sbjct: 1514 CQPWRCRAQEFCGQQDGIYGCHAQGAATCTASGDPHYLTFDGALHHFMGTCTYVLTRPCWSRSQDS-YFVVSATNENRGGILEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWLAQGRVTIRLSSNLVLLYTNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAW------NKNCAILINPQGPFSQCHQV--VPPQSSFASCVHGQCGTKGDTT----ALCRSLQAYASLCAQAG-QAPAWRNRTFCPMRCPPGSSYSPCSSPCPDTCSS--INNPRDCPKALPCAESCECQKGHILSGTSCVPLGQCGCTD 1871          

HSP 3 Score: 66.6254 bits (161), Expect = 1.505e-9
Identity = 74/301 (24.58%), Postives = 126/301 (41.86%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIE---VQNEYRGD-NKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSK-----------PGHHCKKAKDISYH-----SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLA 1006
            C      +  NC S + +  +CS  GDP Y T+DG      G   Y L    +  D     +E   V+   + D  +   + + VI  ++    +L     L VN Q   VPY  ++ +R+    + L  V     + V+F G  NA + +   Y   ++G+CG+ +  R +D    SG    N     +  GNS+ V             P     +  ++        S C  + + S  + + C VL +P  PF+ C +   V    F + CV+D+C  ++ P   +++RC++ SG A
Sbjct: 2312 CQLTSDNSNSNCVSDKSE--QCSVYGDPRYLTFDGFSYRLQGRMTYVLI---KTVDVLPEGVEPLLVEGRNKMDPPRSSIFLQEVITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLWGQRLYLVTD-FELVVSFGGRKNAVISLPSMYEGLVSGLCGNYDKNRKNDMMLPSGALTQN----LNTFGNSWEVKTEDALLRFPRAIPAEEEGQGAELGLRTGLQVSECSPEQLAS-NSTQACRVLADPQGPFAACHQ--TVAPEPFQEHCVLDLCSAQD-PREQEELRCQVLSGWA 2598          
BLAST of VWFD domain-containing protein vs. Ensembl Human
Match: ZAN (zonadhesin (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:12857])

HSP 1 Score: 139.428 bits (350), Expect = 1.335e-31
Identity = 109/367 (29.70%), Postives = 163/367 (44.41%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTK-SGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKEL 1324
            C   GDPHY T+DG+   F G C Y L Q         F +  +NE +G       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   +V VS  YS K+ G+CG+ +G  D+   K  G    +K      +GNS+   +     C+K + ++  S C      S+     CG L++ + PF  C    +V   +FF  C++DMC  +      Q + C   S +   C +AG     WR    CP+ C  N+ +S  A PCP TC + F G    C D    E C CN G++  G  C+    C C++        +   +W + G CKEL
Sbjct: 1156 CLVYGDPHYVTFDGRHFGFMGKCTYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPESTVTLLKGRRTL-VGGQQVTLPAIPSKGVFLGASGRFVE-LQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKLDGSPAGDKEE----LGNSWQTDQDEDQECQKYQVVNSPS-CDSSLQSSMSGPGFCGRLVDTHGPFETCLL--HVKAASFFDSCMLDMCGFQG----LQHLLCTHMSTMTTTCQDAGHAVKPWREPHFCPMACPPNSKYSLCAKPCPDTCHSGFSGMF--CSDRCV-EACECNPGFVLSGLECIPRSQCGCLHPA--GSYFKVGERWYKPG-CKEL 1503          

HSP 2 Score: 113.235 bits (282), Expect = 1.187e-23
Identity = 101/374 (27.01%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKD-WIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPC-YDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C P+R + Q  C  +   +         C+A GDPHY T+DG + HF G C Y LT+   +R  D   F +   NE RG     +Y K+V + +F     L +   + +NG    +P   +      +    L  +     ++V +DG     V V   Y  ++ G+CG+ N    D   +  R ++    +          S+PG      K  S       D W       K+C +L+ P  PFS+C +   V  ++ F  CV   C  K   +      C      A +C++AG +   WR++  CP++C   + +S  ++PCP TC +      R C   LP  E C C +G+I  G  CV    C C +
Sbjct: 1514 CQPWRCRAQEFCGQQDGIYGCHAQGAATCTASGDPHYLTFDGALHHFMGTCTYVLTRPCWSRSQDS-YFVVSATNENRGGILEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWLAQGRVTIRLSSNLVLLYTNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAW------NKNCAILINPQGPFSQCHQV--VPPQSSFASCVHGQCGTKGDTT----ALCRSLQAYASLCAQAG-QAPAWRNRTFCPMRCPPGSSYSPCSSPCPDTCSS--INNPRDCPKALPCAESCECQKGHILSGTSCVPLGQCGCTD 1871          

HSP 3 Score: 98.5969 bits (244), Expect = 3.243e-19
Identity = 96/371 (25.88%), Postives = 155/371 (41.78%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIE---VQNEYRGDN-KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSK-----------PGHHCKKAKDISYH-----SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDG 1216
            C      +  NC S + +  +CS  GDP Y T+DG      G   Y L    +  D     +E   V+   + D  +   + + VI  ++    +L     L VN Q   VPY  ++ +R+    + L  V     + V+F G  NA + +   Y   ++G+CG+ +  R +D    SG    N     +  GNS+ V             P     +  ++        S C  + + S  + + C VL +P  PF+ C +   V    F + CV+D+C  ++ P   +++RC++ SG A +C EAG     WR +  C ++C     +     PCP +C N        C + P  EGCA   GY   G
Sbjct: 2312 CQLTSDNSNSNCVSDKSE--QCSVYGDPRYLTFDGFSYRLQGRMTYVLI---KTVDVLPEGVEPLLVEGRNKMDPPRSSIFLQEVITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLWGQRLYLVTD-FELVVSFGGRKNAVISLPSMYEGLVSGLCGNYDKNRKNDMMLPSGALTQN----LNTFGNSWEVKTEDALLRFPRAIPAEEEGQGAELGLRTGLQVSECSPEQLAS-NSTQACRVLADPQGPFAACHQ--TVAPEPFQEHCVLDLCSAQD-PREQEELRCQVLSGYAILCQEAGAALAGWRDRTLCAMECPAGTIYQSCMTPCPASCAN--LADPGDC-EGPCVEGCASIPGYAYSG 2665          
BLAST of VWFD domain-containing protein vs. Ensembl Human
Match: ZAN (zonadhesin (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:12857])

HSP 1 Score: 139.043 bits (349), Expect = 1.666e-31
Identity = 103/344 (29.94%), Postives = 154/344 (44.77%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTK-SGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG+   F G C Y L Q         F +  +NE +G       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   +V VS  YS K+ G+CG+ +G  D+   K  G    +K      +GNS+   +     C+K + ++  S C      S+     CG L++ + PF  C    +V   +FF  C++DMC  +      Q + C   S +   C +AG     WR    CP+ C  N+ +S  A PCP TC + F G    C D    E C CN G++  G  C+    C C++
Sbjct: 1156 CLVYGDPHYVTFDGRHFGFMGKCTYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPESTVTLLKGRRTL-VGGQQVTLPAIPSKGVFLGASGRFVE-LQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKLDGSPAGDKEE----LGNSWQTDQDEDQECQKYQVVNSPS-CDSSLQSSMSGPGFCGRLVDTHGPFETCLL--HVKAASFFDSCMLDMCGFQG----LQHLLCTHMSTMTTTCQDAGHAVKPWREPHFCPMACPPNSKYSLCAKPCPDTCHSGFSGMF--CSDRCV-EACECNPGFVLSGLECIPRSQCGCLH 1483          

HSP 2 Score: 112.849 bits (281), Expect = 1.432e-23
Identity = 101/374 (27.01%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKD-WIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPC-YDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C P+R + Q  C  +   +         C+A GDPHY T+DG + HF G C Y LT+   +R  D   F +   NE RG     +Y K+V + +F     L +   + +NG    +P   +      +    L  +     ++V +DG     V V   Y  ++ G+CG+ N    D   +  R ++    +          S+PG      K  S       D W       K+C +L+ P  PFS+C +   V  ++ F  CV   C  K   +      C      A +C++AG +   WR++  CP++C   + +S  ++PCP TC +      R C   LP  E C C +G+I  G  CV    C C +
Sbjct: 1514 CQPWRCRAQEFCGQQDGIYGCHAQGAATCTASGDPHYLTFDGALHHFMGTCTYVLTRPCWSRSQDS-YFVVSATNENRGGILEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWLAQGRVTIRLSSNLVLLYTNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAW------NKNCAILINPQGPFSQCHQV--VPPQSSFASCVHGQCGTKGDTT----ALCRSLQAYASLCAQAG-QAPAWRNRTFCPMRCPPGSSYSPCSSPCPDTCSS--INNPRDCPKALPCAESCECQKGHILSGTSCVPLGQCGCTD 1871          

HSP 3 Score: 85.5001 bits (210), Expect = 2.605e-15
Identity = 94/377 (24.93%), Postives = 153/377 (40.58%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIE---VQNEYRGDN-KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSK-----------PGHHCKKAKDISYH-----SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKP 1234
            C      +  NC S + +  +CS  GDP Y T+DG      G   Y L    +  D     +E   V+   + D  +   + + VI  ++    +L     L VN Q   VPY  ++ +R+    + L  V     + V+F G  NA + +   Y   ++G+CG+ +  R +D    SG    N     +  GNS+ V             P     +  ++        S C  + + S  + + C VL +P  PF+ C +   V    F + CV+D+C  ++ P   +++RC++ SG A +C EAG     WR +  C   C +        NPC    +         C +      C C  GY   G LC++P
Sbjct: 2312 CQLTSDNSNSNCVSDKSE--QCSVYGDPRYLTFDGFSYRLQGRMTYVLI---KTVDVLPEGVEPLLVEGRNKMDPPRSSIFLQEVITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLWGQRLYLVTD-FELVVSFGGRKNAVISLPSMYEGLVSGLCGNYDKNRKNDMMLPSGALTQN----LNTFGNSWEVKTEDALLRFPRAIPAEEEGQGAELGLRTGLQVSECSPEQLAS-NSTQACRVLADPQGPFAACHQ--TVAPEPFQEHCVLDLCSAQD-PREQEELRCQVLSGYAILCQEAGAALAGWRDRTLCESPCLQ--------NPCQNDGQ---------CREQGATFTCECEVGY--GGGLCMEP 2655          
BLAST of VWFD domain-containing protein vs. Ensembl Human
Match: ZAN (zonadhesin (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:12857])

HSP 1 Score: 139.043 bits (349), Expect = 1.666e-31
Identity = 103/344 (29.94%), Postives = 154/344 (44.77%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTK-SGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG+   F G C Y L Q         F +  +NE +G       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   +V VS  YS K+ G+CG+ +G  D+   K  G    +K      +GNS+   +     C+K + ++  S C      S+     CG L++ + PF  C    +V   +FF  C++DMC  +      Q + C   S +   C +AG     WR    CP+ C  N+ +S  A PCP TC + F G    C D    E C CN G++  G  C+    C C++
Sbjct: 1156 CLVYGDPHYVTFDGRHFGFMGKCTYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPESTVTLLKGRRTL-VGGQQVTLPAIPSKGVFLGASGRFVE-LQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKLDGSPAGDKEE----LGNSWQTDQDEDQECQKYQVVNSPS-CDSSLQSSMSGPGFCGRLVDTHGPFETCLL--HVKAASFFDSCMLDMCGFQG----LQHLLCTHMSTMTTTCQDAGHAVKPWREPHFCPMACPPNSKYSLCAKPCPDTCHSGFSGMF--CSDRCV-EACECNPGFVLSGLECIPRSQCGCLH 1483          

HSP 2 Score: 112.849 bits (281), Expect = 1.432e-23
Identity = 101/374 (27.01%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKD-WIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPC-YDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C P+R + Q  C  +   +         C+A GDPHY T+DG + HF G C Y LT+   +R  D   F +   NE RG     +Y K+V + +F     L +   + +NG    +P   +      +    L  +     ++V +DG     V V   Y  ++ G+CG+ N    D   +  R ++    +          S+PG      K  S       D W       K+C +L+ P  PFS+C +   V  ++ F  CV   C  K   +      C      A +C++AG +   WR++  CP++C   + +S  ++PCP TC +      R C   LP  E C C +G+I  G  CV    C C +
Sbjct: 1514 CQPWRCRAQEFCGQQDGIYGCHAQGAATCTASGDPHYLTFDGALHHFMGTCTYVLTRPCWSRSQDS-YFVVSATNENRGGILEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWLAQGRVTIRLSSNLVLLYTNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAW------NKNCAILINPQGPFSQCHQV--VPPQSSFASCVHGQCGTKGDTT----ALCRSLQAYASLCAQAG-QAPAWRNRTFCPMRCPPGSSYSPCSSPCPDTCSS--INNPRDCPKALPCAESCECQKGHILSGTSCVPLGQCGCTD 1871          

HSP 3 Score: 85.5001 bits (210), Expect = 2.605e-15
Identity = 94/377 (24.93%), Postives = 153/377 (40.58%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIE---VQNEYRGDN-KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSK-----------PGHHCKKAKDISYH-----SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKP 1234
            C      +  NC S + +  +CS  GDP Y T+DG      G   Y L    +  D     +E   V+   + D  +   + + VI  ++    +L     L VN Q   VPY  ++ +R+    + L  V     + V+F G  NA + +   Y   ++G+CG+ +  R +D    SG    N     +  GNS+ V             P     +  ++        S C  + + S  + + C VL +P  PF+ C +   V    F + CV+D+C  ++ P   +++RC++ SG A +C EAG     WR +  C   C +        NPC    +         C +      C C  GY   G LC++P
Sbjct: 2312 CQLTSDNSNSNCVSDKSE--QCSVYGDPRYLTFDGFSYRLQGRMTYVLI---KTVDVLPEGVEPLLVEGRNKMDPPRSSIFLQEVITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLWGQRLYLVTD-FELVVSFGGRKNAVISLPSMYEGLVSGLCGNYDKNRKNDMMLPSGALTQN----LNTFGNSWEVKTEDALLRFPRAIPAEEEGQGAELGLRTGLQVSECSPEQLAS-NSTQACRVLADPQGPFAACHQ--TVAPEPFQEHCVLDLCSAQD-PREQEELRCQVLSGYAILCQEAGAALAGWRDRTLCESPCLQ--------NPCQNDGQ---------CREQGATFTCECEVGY--GGGLCMEP 2655          
BLAST of VWFD domain-containing protein vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716824:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 86.2705 bits (212), Expect = 4.550e-16
Identity = 101/431 (23.43%), Postives = 173/431 (40.14%), Query Frame = 2
Query:  158 NGVCTPFRT--KTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS--------FNIEVQNEYRGDNKYFTYTKSVIIHMFR-EVYELGQKGVLKVNGQLSRVPY----EKSDDVRI-FKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSK----RYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKY--------------SLIGNSYHVSKPGH-HCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPN---NPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFE---GIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPEREGCACNRGYIRDGAL-----CVKPMHCKCINLCVDRESSEKCRKWKQQ 1306
            N +C P  T  +   +C+ K +  C     GDPHY TYDG    + G C Y  +Q      PC+        +++  +NE  G   + +    V + +    ++  G+     VNG     P+    + +  VR+ F    F   +     V V F   ++  V+V        +  + G+ G+ +G + DD   K+G  ++ K ++               + I + + + +PG  +C   + +  ++ C         A + C  + +       F  C   GN  L +F+ +C+ D+C N          +C  F+   + C  A  +      WR+Q NCPL C  NAH S   + CP TC   F     P Y D    +GC C+ GY+ D  +     C++   C C++   D  +    + W  Q
Sbjct:  165 NCICKPGYTARRNGRDCDMKVQQAC---MSGDPHYVTYDGLRFDYQGTCPYVFSQ------PCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFT--IENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNC-----DVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICRNP-------AFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPF-----PEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGCVD--SDGNAHRPGKPWVTQ 565          
BLAST of VWFD domain-containing protein vs. Ensembl Celegans
Match: T01D3.6 (pep chromosome:WBcel235:V:13716849:13720402:1 gene:WBGene00011330.1 transcript:T01D3.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T01D3.6)

HSP 1 Score: 65.4698 bits (158), Expect = 9.865e-10
Identity = 86/394 (21.83%), Postives = 154/394 (39.09%), Query Frame = 2
Query:  284 FYGDCRYTLTQHNREDDPCS--------FNIEVQNEYRGDNKYFTYTKSVIIHMFR-EVYELGQKGVLKVNGQLSRVPY----EKSDDVRI-FKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSK----RYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKY--------------SLIGNSYHVSKPGH-HCKKAKDISYHSICGKDWIRSLK-------AKKHCGVLLEPN---NPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFE---GIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPEREGCACNRGYIRDGAL-----CVKPMHCKCINLCVDRESSEKCRKWKQQ 1306
            + G C Y  +Q      PC+        +++  +NE  G   + +    V + +    ++  G+     VNG     P+    + +  VR+ F    F   +     V V F   ++  V+V        +  + G+ G+ +G + DD   K+G  ++ K ++               + I + + + +PG  +C   + +  ++ C    I   +       A + C  + +       F  C   GN  L +F+ +C+ D+C N          +C  F+   + C  A  +      WR+Q NCPL C  NAH S   + CP TC   F     P Y D    +GC C+ GY+ D  +     C++   C C++   D  +    + W  Q
Sbjct:  206 YQGTCPYVFSQ------PCTTLPAPYLWYSVRAKNELPGKGYHISQVSEVEVDLHNLTIHVDGRSKTALVNGVQVLTPWYFPNKNTWTVRVRFSGSTFT--IENDQGVVVTFTTYNSLCVQVPDIPEFNGATTLCGLAGNIDGKKLDDVVNKNGSVLAIKSSRQPENNNHADFMKTEDTWITDKFLILRPGQENCINGQTLDNNTNCVSTSISLAQSCADVATASQTCYPIQQAEMGLGTFGACQGLGNDTLEDFYYNCIYDICRNP-------AFKCTEFTYFLQYCQLALPQVAMNQNWRAQINCPLACPLNAHPSTCTSSCPSTCAEPF-----PEYCDQGCVDGCECDPGYVIDNTVTGSIKCIRLDQCGCVD--SDGNAHRPGKPWVTQ 577          
BLAST of VWFD domain-containing protein vs. Ensembl Fly
Match: cv-2 (gene:FBgn0000395 transcript:FBtr0071610)

HSP 1 Score: 99.3673 bits (246), Expect = 4.646e-20
Identity = 85/295 (28.81%), Postives = 136/295 (46.10%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPY---EKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVS--KRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFS 1096
            C+  GDPH+RT+DG+   F G C+Y L          +F+I + NE RG  +  ++ K+V + +      LGQ+  +KVNG    +PY       +V I +       V  R  + +  + +   F++VS   ++ K++ G+CG+ NG  RDD   K GR  S+  ++     NS+ V  P    +K + ++    C K      K+  +C  L  P   F +C  + N +  N+   C +D+C     PS      C+ F+  A  C   G +   WRS  NCP    +NA  S
Sbjct:  383 CTVFGDPHFRTFDGKFFSFQGSCKYLLASDCMGK---TFHIRLTNEGRGTRRA-SWAKTVTLSLRNLKVNLGQRMRVKVNGTRVTLPYFVVAGGQNVTIERLANG-GAVMLRSEMGLTLEWNGAGFLQVSVPAKFKKRLCGLCGNFNGSSRDDLTGKDGR--SHGDDEVWHFANSWKVGGPKSCSRKREFLAATPTCDKR-----KSNFYCHPLSVPAL-FGECNERLNPE--NYKAACRMDVC---ECPS--GDCHCDSFAAYAHECRRLGVQLPDWRSATNCPAGWRRNATLS 657          
BLAST of VWFD domain-containing protein vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0333020)

HSP 1 Score: 83.9593 bits (206), Expect = 4.147e-15
Identity = 96/368 (26.09%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTL-----TQHNREDDPCSFNI-EVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKS----------DDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQF-NCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER--------EGCACNRG-YIRDGALCVKPMHCKC 1249
            +C AVGDPHY+T+DG+   F G C Y L     T    E+  CS  + E  N    D+   + TK+V I   R +   G   V+K++  L+ +  +K            +V I ++      V     +RV +DG S  +++       +  G+CG  N   +DDF T  G DV      ++    +    +      KA+       C  +  +  +A+K C  +L+  + F  C     V+   F++DC+ D C  K+  S   K  C I S     C   G +   WR     C ++C     F E  + C  +C+           DLP +        EGC C  G Y+ +   CV    C C
Sbjct:  849 RCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDP--SCTKAVTI---RFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEG-DVETAVEPFADKWRTKDTCQ-----FKAETHQGPHPCTLNPEKKAQAEKFCDWILQ--DIFQDCHFL--VEPEQFYEDCLYDTCACKDEMS---KCFCPILSAYGTECMRQGVK-TGWRMSVKECAVKCPLGQVFDECGDGCALSCD-----------DLPSKGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHC 1186          

HSP 2 Score: 72.0182 bits (175), Expect = 1.575e-11
Identity = 78/297 (26.26%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYE-LGQKGVLKVNGQLSRVPYEKSDD---------VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKS-GRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFE---GIKWRSQFNCPLQC 1075
            CS  GD H+ T+DG    F G C Y L +    D+   F+I +QN   G     T +KS+ I +     E L        +   ++ P +K  D           I+K+  F+        ++V +D  +  +V++   + +K++G+CG+ NG   DD +T S G + S       L G+++ +     HC  +  ++    C K   R   A+  CG L   ++ F +C     V L  F++ C+ D C         Q   CE         ++A  +    I+WRSQ  CP+QC
Sbjct: 1337 CSVWGDSHFTTFDGHDFDFQGACDYVLAK-GVFDNGDGFSITIQNVLCG-TMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPM-----LFGHAWKLQP---HC--SAPVAPIDACKKHPERETWAQLKCGALK--SDLFKEC--HAEVPLERFWKRCIFDTCACD------QGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQC 1611          

HSP 3 Score: 63.929 bits (154), Expect = 5.055e-9
Identity = 85/386 (22.02%), Postives = 131/386 (33.94%), Query Frame = 2
Query:  224 CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSV----------------IIHMFREVYELGQKGVLKVNGQLSRVPYEKS--DDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDF-----KTKSGRDV----SNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCEN------------------HFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHC 1243
            C C+++G   Y TYD +   F G+C Y L++        +F + V  +   D K       V                +IH+ R   +     VL    ++ ++PY+ S     ++      L        +  +F+    +    S +Y  KM G+CGDCNG   +D      K K+G DV         K  L+        P  HC                   L  +K   +       F KC     VD   +   C  D+C    +P   Q+  C   +  A+ C++ G     WR    CP +C  +  +      C + C+                   H   T   C      EGC C  G + DG  CV  + C
Sbjct: 3032 CVCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMD---DCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHC-----------------IPLPPEKDPCLQFYNAELFGKCPLA--VDPIAYVSACQQDIC----KPGNTQQGVCVALAAYAKECNQHGI-CTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIAC 3388          

HSP 4 Score: 54.6842 bits (130), Expect = 2.703e-6
Identity = 69/350 (19.71%), Postives = 134/350 (38.29%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRD-DFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVL--LEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIK----WRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+  G  + +T+DG V      C +TL          +F+I ++    G      +T  ++       +E    G +++   + ++P   +   +++    + +Q       +++ +D      V+   +   K+ G+CG  +G  + D  +++G+ ++  +       +++ V      C+           G D     K +K   V   L  N     C +  N D     + C+ D C   NR    +   C+  + LA+ C+   F+GIK    WR+   CP+ CG    +         TC++      +K  C      EGC C  G ++    C+    C C
Sbjct:  484 CTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSG---TFDIILKACPYGSGYGCAHTLKILWQSVLYTFE-NLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVK----AFADAWRVEDRSELCQVENSAEMEF--GMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDA--LIRTCMADYCNCANR-EHPESCNCDAIAMLAKECA---FKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGAC-----NEGCFCPEGTVQYKEACITRELCPC 812          
BLAST of VWFD domain-containing protein vs. Ensembl Fly
Match: Hml (gene:FBgn0029167 transcript:FBtr0075753)

HSP 1 Score: 83.9593 bits (206), Expect = 4.586e-15
Identity = 96/368 (26.09%), Postives = 149/368 (40.49%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTL-----TQHNREDDPCSFNI-EVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKS----------DDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQF-NCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER--------EGCACNRG-YIRDGALCVKPMHCKC 1249
            +C AVGDPHY+T+DG+   F G C Y L     T    E+  CS  + E  N    D+   + TK+V I   R +   G   V+K++  L+ +  +K            +V I ++      V     +RV +DG S  +++       +  G+CG  N   +DDF T  G DV      ++    +    +      KA+       C  +  +  +A+K C  +L+  + F  C     V+   F++DC+ D C  K+  S   K  C I S     C   G +   WR     C ++C     F E  + C  +C+           DLP +        EGC C  G Y+ +   CV    C C
Sbjct:  850 RCGAVGDPHYQTFDGKRYDFMGKCSYHLLKTQNTSVEAENVACSGAVSESMNFAAPDDP--SCTKAVTI---RFILRDGTPSVIKLDQGLTTIVNDKPIAKLPKMLGLGEVLIRRASSTFLTVEFADGIRVWWDGVSRVYIDAPPSLRGQTQGLCGTFNSNTQDDFLTPEG-DVETAVEPFADKWRTKDTCQ-----FKAETHQGPHPCTLNPEKKAQAEKFCDWILQ--DIFQDCHFL--VEPEQFYEDCLYDTCACKDEMS---KCFCPILSAYGTECMRQGVK-TGWRMSVKECAVKCPLGQVFDECGDGCALSCD-----------DLPSKGSCKRECVEGCRCPHGEYVNEDGECVPKKMCHC 1187          

HSP 2 Score: 72.0182 bits (175), Expect = 1.671e-11
Identity = 78/297 (26.26%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYE-LGQKGVLKVNGQLSRVPYEKSDD---------VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKS-GRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFE---GIKWRSQFNCPLQC 1075
            CS  GD H+ T+DG    F G C Y L +    D+   F+I +QN   G     T +KS+ I +     E L        +   ++ P +K  D           I+K+  F+        ++V +D  +  +V++   + +K++G+CG+ NG   DD +T S G + S       L G+++ +     HC  +  ++    C K   R   A+  CG L   ++ F +C     V L  F++ C+ D C         Q   CE         ++A  +    I+WRSQ  CP+QC
Sbjct: 1338 CSVWGDSHFTTFDGHDFDFQGACDYVLAK-GVFDNGDGFSITIQNVLCG-TMGVTCSKSLEIALTGHAEESLLLSADSAYSTDPNKTPIKKLRDSVNSKGHNAFHIYKAGVFVVVEVIPLKLQVKWDEGTRVYVKLGNEWRQKVSGLCGNYNGNSLDDMQTPSMGLETSPM-----LFGHAWKLQP---HC--SAPVAPIDACKKHPERETWAQLKCGALK--SDLFKEC--HAEVPLERFWKRCIFDTCACD------QGGDCECLCTAVAAYADACAQKGINIRWRSQHFCPMQC 1612          

HSP 3 Score: 63.5438 bits (153), Expect = 5.732e-9
Identity = 85/386 (22.02%), Postives = 131/386 (33.94%), Query Frame = 2
Query:  224 CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSV----------------IIHMFREVYELGQKGVLKVNGQLSRVPYEKS--DDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDF-----KTKSGRDV----SNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCEN------------------HFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHC 1243
            C C+++G   Y TYD +   F G+C Y L++        +F + V  +   D K       V                +IH+ R   +     VL    ++ ++PY+ S     ++      L        +  +F+    +    S +Y  KM G+CGDCNG   +D      K K+G DV         K  L+        P  HC                   L  +K   +       F KC     VD   +   C  D+C    +P   Q+  C   +  A+ C++ G     WR    CP +C  +  +      C + C+                   H   T   C      EGC C  G + DG  CV  + C
Sbjct: 3033 CVCNSLGASKYMTYDRKSFSFNGNCTYLLSRDVVLPGVHTFQVYVSMD---DCKKLGQPTPVEGGSCAKSLHILNGDHVIHVQRVPQKPKSLQVLVDGFEVKKIPYKDSWISLRQVVGKELVLSLPESHVELTASFEDLIFSLGVPSIKYGSKMEGLCGDCNGNAGNDLQPNPAKKKAGVDVIQSWQADEPKLGLVEECLSEDVPKEHC-----------------IPLPPEKDPCLQFYNAELFGKCPLA--VDPIAYVSACQQDIC----KPGNTQQGVCVALAAYAKECNQHGI-CTNWRRPQLCPYECPSDMVYEPCG--CAKNCDTIKALSEFDAVSLKNEAVVHTVKTDEMCLSSERFEGCFCPPGKVMDGGQCVPEIAC 3389          

HSP 4 Score: 54.6842 bits (130), Expect = 2.915e-6
Identity = 69/350 (19.71%), Postives = 134/350 (38.29%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRD-DFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVL--LEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIK----WRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+  G  + +T+DG V      C +TL          +F+I ++    G      +T  ++       +E    G +++   + ++P   +   +++    + +Q       +++ +D      V+   +   K+ G+CG  +G  + D  +++G+ ++  +       +++ V      C+           G D     K +K   V   L  N     C +  N D     + C+ D C   NR    +   C+  + LA+ C+   F+GIK    WR+   CP+ CG    +         TC++      +K  C      EGC C  G ++    C+    C C
Sbjct:  485 CTTWGGINMKTFDGLVFKAPLSCSHTLITDKVSG---TFDIILKACPYGSGYGCAHTLKILWQSVLYTFE-NLNGTMQLTTPIKKLPMPVQVMGMKVMPVAQHVQIDLESVGLKLDWDHRQYVSVQAGPQMWGKVGGLCGTLDGDPNTDLTSRTGKKLATVK----AFADAWRVEDRSELCQVENSAEMEF--GMDSCEQSKLQKAVSVCERLLANEKLGDCIKPFNYDA--LIRTCMADYCNCANR-EHPESCNCDAIAMLAKECA---FKGIKLEHGWRNLEICPISCGFGRVYQACGPNVEPTCDSDLALPASKGAC-----NEGCFCPEGTVQYKEACITRELCPC 813          
BLAST of VWFD domain-containing protein vs. Ensembl Zebrafish
Match: zanl (zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-2])

HSP 1 Score: 161.384 bits (407), Expect = 2.401e-38
Identity = 108/344 (31.40%), Postives = 169/344 (49.13%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKK-HCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            CS  GDPHY T+D +V HF G C YTLT+  N       F++E QNE+R +NK  +Y +SVI+ +      LG+   ++VNG     P   S+ ++IF S KF+  +     +RV FDG+ +A V +   Y+  + G+CG+ NG  +D   K     ++  N+   +G S+ V      C          I   D I+S   K   CG++ +PN  F  C     V    +F++CV D C             C+     A++C++AG   I WR+   CP++C   +H+    + CP +C++   G++  C + P  EGC C+ G++  G  CV    C C +
Sbjct: 3201 CSVSGDPHYTTFDDKVHHFMGACSYTLTKPCNETSGMPYFSVETQNEHRDNNKKVSYVRSVIVKVHNTTVILGKGRKIQVNGVQVTAPVTLSNGIKIFMSGKFV-VLETNFGLRVRFDGNHHADVTLPSSYNGLLCGLCGNFNGNPNDDNIKLDGKPTDSTNE---LGESWQVPDDRPDCTHGGG----DIECDDKIQSEAQKPTSCGMITDPNGIFKPC--HAVVPPDPYFENCVFDQCGTGGA----AVALCQAIQSYADLCAQAGVP-INWRNNTFCPIKCPVGSHYEHCGSACPASCQDP--GSESTCTE-PCVEGCVCDPGFVLSGDECVPFRECGCTD 3526          

HSP 2 Score: 152.14 bits (383), Expect = 1.507e-35
Identity = 104/342 (30.41%), Postives = 157/342 (45.91%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+D +   F G+C Y +++     D   F +   NE R +N + +Y K+V +H       + + G ++VNG    +P      V IF S K    VA    V V +DG+ +  ++V K Y  K+ G+CGD NG  +DDF+T +G  V +  +     G+S++       C K  ++  +  C        +   +CG++L+   PF+ C  K  V+   +FQ+C+ D+C             CE        C + G     WR+   CPL+C  N+HF   A  C  +C+    G    PC      EGC C+ GYI     CVK   C C
Sbjct:  680 CIASGDPHYTTFDKRNYDFMGNCSYLMSEPCNSTDVPYFAVYTDNENRYNNLHISYVKAVHVHALGVKVSILKGGTVQVNGTNVNIPLSPVAGVDIFMSGKHYT-VALNFGVTVRYDGNHHMDIKVIKDYEDKLCGLCGDYNGDPQDDFQTPTGELVQSPSD----FGHSWNTDP---DCNK-PEVGPNPGCTDAEQELYEGPAYCGIILDNKGPFAVCHPK--VNPNGYFQNCLFDVCELDGA----HSALCEAIESYVNECQDRGVTIGPWRNSTFCPLKCPPNSHFESCAPVCQPSCKPIPPGQCTGPC-----SEGCVCDPGYILSAGQCVKENTCGC 1001          

HSP 3 Score: 149.058 bits (375), Expect = 1.070e-34
Identity = 103/343 (30.03%), Postives = 157/343 (45.77%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDL--PEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+D +   F G+C Y +++     D   F +   NE R +N + +Y K+V +H       + + G ++VNG    +P      V IF S K    VA    V V +DG+ +  ++V K Y  K+ G+CGD NG  +DDF+T +G  V +  +     G+S++      +C K  ++  +  C        +   +CG++L+   PF+ C  K  V+   +FQ+C+ D+C             CE        C + G     WR+   CPL+C  N+H+   A  C  +C      T  P      P  EGC C+ GYI     CVK   C C
Sbjct: 2436 CIASGDPHYTTFDKRNYDFMGNCSYLMSERCNSTDVPYFAVYTDNENRYNNLHISYVKAVHVHALGVKVSILKGGTVQVNGTNVNIPLSPVAGVDIFMSGKHYT-VALNFGVTVRYDGNHHMDIKVIKDYEDKLCGLCGDYNGDPQDDFQTPTGELVQSPSD----FGHSWNTDP---NCNK-PEVGPNPGCTDAEQELYEGPAYCGIILDNKGPFAVCHPK--VNPNGYFQNCLFDVCELDGA----HSALCEAIESYVNECQDRGVTIGPWRNSTFCPLKCPPNSHYDSCAPVCQPSC------TPVPPSQCTGPCSEGCVCDPGYILSAGQCVKENTCGC 2757          

HSP 4 Score: 148.673 bits (374), Expect = 1.496e-34
Identity = 103/343 (30.03%), Postives = 157/343 (45.77%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDL--PEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+D +   F G+C Y +++     D   F +   NE R +N + +Y K+V +H       + + G ++VNG    +P      V IF S K    VA    V V +DG+ +  ++V K Y  K+ G+CGD NG  +DDF+T +G  V +  +     G+S++      +C K  ++  +  C        +   +CG++L+   PF+ C  K  V+   +FQ+C+ D+C             CE        C + G     WR+   CPL+C  N+H+   A  C  +C      T  P      P  EGC C+ GYI     CVK   C C
Sbjct: 1558 CIASGDPHYTTFDKRRYDFMGNCSYLMSEPCNSTDVPYFAVYTDNENRYNNLHISYVKAVHVHALGVKVSILKGGTVQVNGTNVNIPLSPVAGVDIFMSGKHYT-VALNFGVTVRYDGNHHMDIKVIKDYEDKLCGLCGDYNGDPQDDFQTPTGELVQSPSD----FGHSWNTDP---NCNK-PEVGPNPGCTDAEQELYEGPAYCGIILDNKGPFAVCHPK--VNPNGYFQNCLFDVCELDGA----HSALCEAIESYVNECQDRGVTIGPWRNSTFCPLKCPPNSHYDSCAPVCQPSC------TPIPPSQCTGPCSEGCVCDPGYILSAGQCVKEDTCGC 1879          

HSP 5 Score: 138.658 bits (348), Expect = 1.819e-31
Identity = 100/350 (28.57%), Postives = 156/350 (44.57%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDN------KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG+   + G C YTL +  + +    F+IE +NE RG +      K +     + + M ++   L       VNG    +P+  S  + +  + +++    P   ++V +DG+  A + V   Y  +M G+CGD +G  ++  TK   + +N  N++   G+S+          K  D      C       +   ++CG + + N PF  C +   V+   FFQ CV DMC    R    Q+V C+      + C  AG    +WR    CPL C  N+H+S   + CP TC   N   G    C      EGC C+ G+I  G  CV    C C++
Sbjct: 1938 CVISGDPHYTTFDGKYYSYMGTCTYTLARTCKNNTRPWFSIEGKNEERGASGVSYLRKLYVTVDGITVTMMKDRTTL-------VNGLRVTLPHSPSPLISLSLAGQYVILTTPF-GLKVQWDGNHYAKISVPSSYYDQMCGLCGDYDGNPNNDFTKPDGNQTNSSNQF---GDSWKTDDDEDATCK-PDPGPQPPCDPVLEGEVSKPENCGKITDTNGPFRDCIKV--VNPLPFFQSCVFDMC----RYQGLQQVLCDQLQAYTDACLSAGAPVHQWREPDFCPLVCPPNSHYSMCVSSCPETCLGINGPPGCSEKCV-----EGCECDPGFILSGNKCVPVKDCGCVD 2264          

HSP 6 Score: 135.961 bits (341), Expect = 1.013e-30
Identity = 99/351 (28.21%), Postives = 153/351 (43.59%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDN------KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG+   + G C YTL +  + +    F+IE +NE RG +      K +     + + M +    L       VNG    +P+  S  + +  + +++    P   ++V +DG+  A + V   Y  +M G+CGD +G   +DF    G  V + +    L G+S+  +K         D      C       +   ++CG + + N PF  C +   V+   FFQ CV DMC  +      Q+V C+      + C  AG    +WR    CPL C  N+H+S   + CP TC   N   G    C      EGC C+ G+I     CV    C C++
Sbjct: 2816 CVVSGDPHYNTFDGKFYSYMGTCTYTLARTCKNNTGPWFSIEGKNEERGASGVSYLRKLYVTVDGITVTMMKNKRTL-------VNGLRVTLPHSPSPLISLSLAGQYVILTTPF-GLKVQWDGNHYAKISVPSSYYDQMCGLCGDYDGNPNNDFTKPDGTQVDSSK----LFGDSWQ-TKEDEDATCKPDPGPQPPCDPVLEGEVSKPENCGKITDTNGPFRDCIKV--VNPLPFFQSCVFDMCHYQG----LQQVLCDQLQAYTDACLSAGAPVHQWREPDFCPLVCPPNSHYSICVSSCPETCLGINGPPGCSEKCV-----EGCECDPGFILSDNKCVPVKDCGCVD 3142          

HSP 7 Score: 135.961 bits (341), Expect = 1.021e-30
Identity = 96/369 (26.02%), Postives = 154/369 (41.73%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKA----KDISYH--------------SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            K + F  C+  GDPHYRT+D    H+ G   Y L+Q +N       F +  +N+ +G     +  + V + ++     + Q   + VN +   +PY     V I    +++        + V FDG S   V +   Y  ++ G+CG+ +G  ++  TK    V+   N   + G+S+ V+       +A    K +  H              + C    +  L   K CG L +P  PFS C     +D   + +DCV D+C  +      + +RCE ++  A  C + G    +WR    C LQCG N+ +     PCP +C +        C      EGC CN G++     CV    C C  L
Sbjct: 3966 KPEKFDDCTIAGDPHYRTFDKYNHHYQGAYTYVLSQDNNLPSHLTPFMVRGKNQRQGGISRVSLLREVFVDVYGITVRMQQNKKVLVNEEKVGLPYSPVQGVSIKTKSRYVMLTT-DFGLTVRFDGSSQGVVTLPSVYRTRVLGLCGNYDGRTNNEYTKPDGTVTRDLN---VFGDSWRVTDRSAAALRATSLPKMVHLHKREVEEDPDSGFETTGCTNAQLEDLNGNKQCGALSDPAGPFSAC--HAVIDPEIYMEDCVFDLCAEQGS----EVLRCENYAVYARACQDQGVTLGQWRQDLKCGLQCGANSTYFASMTPCPASCGD--LAAPSECEQTQLVEGCQCNAGFVLSDQDCVPYSQCGCTYL 4322          

HSP 8 Score: 135.191 bits (339), Expect = 1.851e-30
Identity = 101/351 (28.77%), Postives = 154/351 (43.87%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDN------KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG+   + G C YTL +  + +    F+IE +NE RG +      K +     + + M +    L       VNG    +P+  S  + +  + +++    P   ++V +DG+  A + V   Y  +M G+CGD +G   +DF    G  V + +    L G+S+  +K         D      C       +   ++CG + + N PF  C +   V+   FFQ CV DMC    R    Q+V C+      + C  AG    +WR    CPL C  N+H+S   + CP TC   N   G    C      EGC C+ G+I  G  CV    C C++
Sbjct: 1060 CIISGDPHYNTFDGKFYSYMGTCTYTLARTCKNNTGPWFSIEGKNEERGVSGVSYLRKLYVTVDGITVTMMKNQRTL-------VNGLRVTLPHSPSSLISLSLAGQYVILTTPF-GLKVQWDGNHYAKISVPSSYYDQMCGLCGDYDGNPNNDFTKPDGTQVDSSK----LFGDSWQ-TKEDEDATCKPDPGPQPPCDPVLEGEVSKPENCGKITDTNGPFRDCIKV--VNPLPFFQSCVFDMC----RYQGLQQVLCDQLQSYTDACLSAGAPVHQWREPDFCPLVCPPNSHYSMCVSSCPETCLGINGPPGCSEKCV-----EGCECDPGFILSGNKCVPVKDCGCVD 1386          

HSP 9 Score: 123.635 bits (309), Expect = 6.094e-27
Identity = 100/360 (27.78%), Postives = 149/360 (41.39%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFV----APRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPG----------HHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPER---EGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG +  + G C YTL +         F I  +NE RG  +  +Y +SV +++      + + G + +N +  + PY    D+ + KSR F   V         + V FDG  +  + V   Y  K+ G+CG+ NG   D   K     +N   ++     +   S PG           +C ++++  Y + C    +      K C  L+ P                 F  +CV DMC         Q   C+     A+ C  AG   I WR+   CPL C  N+H+SE   PCP TC + F     P +  LP     EGC CN G++     CV    C C++
Sbjct: 3586 CHIAGDPHYYTFDGIMHTYMGTCTYTLVEVCNTSMVTPFTIVAKNEERGQPEA-SYVRSVTVYLPTANITISKSGRVLLNERRVKTPY----DINVAKSRVFTSGVNTILDTDFGLIVKFDGVHHVEITVPGDYFNKVCGMCGNYNGDSSDDNLKPNGKPANNSIEFGDSWKAEGDSDPGCQPDPRPDDKPNCDESEEEIYKAQCASTILS--DRFKPCHSLIPP---------------EAFLGNCVYDMCEYNGM----QSTLCDNVEAYAQACHSAGVT-ISWRNSTFCPLPCPPNSHYSECTPPCPPTCADLF-----PIFCPLPPNSCVEGCQCNAGFVLSDGKCVPLSSCGCVD 3913          
BLAST of VWFD domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-239b22.1 (si:dkey-239b22.1 [Source:ZFIN;Acc:ZDB-GENE-131119-12])

HSP 1 Score: 150.599 bits (379), Expect = 4.566e-35
Identity = 113/412 (27.43%), Postives = 193/412 (46.84%), Query Frame = 2
Query:   41 SFYQFAKATRYGVCQNTKVE--KEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            SF+  A   +  +C N+ ++   EPC+                 C P     Q +C++  +  C  S  GDPHY T+D QV HF G C Y L++      P  + IE +NE+RG + + ++T+ V + ++ EV EL  G     +VNG  +  P+  ++  +++++S  F   ++    + V +D  S   + V   Y     G+CG+ N    DDF + SG  +S+  +      NS+ V   + P  H  +   ++  ++C  D         HCG+L +   PF+ C  +  +  + + ++CV D+C+ +     +Q + C+  +  A  C + G    +WR Q  C +QC +++HF  +   CP TC N       P   LP +E C C+ GYI    +CV   +C C
Sbjct: 3729 SFWSDATCQQKCICTNSGLQCSPEPCSYSQ-------------ACRP--AAFQYSCQNIPRQTCTVS--GDPHYYTFDNQVFHFQGTCTYVLSEACGIGLP-YYRIEGKNEHRG-STHVSWTRMVRVFVYDEVIELVRGHNYEARVNGSFAATPFSLRNGSIQVYQS-GFSLLISTDFGLLVTYDAFSYVRISVPYDYQNTTCGLCGNYNLQSDDDFHSPSGEILSSDVD----FANSWKVDSDTDPECHNVRCTGLAC-AVCTTDETNRYSDTNHCGILGDVAGPFAAC--QSILAPQTYMENCVYDLCLGEG----YQPILCQALNVYATQCQQQGVHLGQWRQQGFCEIQCPEHSHFEPQGTGCPATCSNPSAPMNCP---LPNQESCICDHGYILSAGVCVPEANCGC 4106          

HSP 2 Score: 143.28 bits (360), Expect = 6.944e-33
Identity = 110/412 (26.70%), Postives = 194/412 (47.09%), Query Frame = 2
Query:   41 SFYQFAKATRYGVCQNTKVE--KEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            SF+  A   +  +C N+ ++   EPC+  ++  R   +              Q +C++  +  C  S  GDPHY T+D QV HF G C Y L++      P  + IE +NE+RG + + ++T+ V + ++ EV EL        ++NG  +  P+  ++  +++++S  F   ++    + V +D  S   + V   Y     G+CG+ N    DDF++ SG  +S+  +      NS+ V   + P  H  +   ++  ++C  D         HCG+L +   PF+ C     +  + + ++CV D+C+ +     +Q + C+  +  A  C + G    +WR Q  C +QC +++HF  +   CP TC N       P   LP +E C C+ GYI    +CV   +C C
Sbjct: 2273 SFWSDATCQQKCICTNSGLQCSLEPCSY-SQACRAAVF--------------QYSCQNIPRQTCTIS--GDPHYYTFDYQVFHFQGTCTYVLSEACNNGLP-YYRIEGKNEHRG-STHVSWTRMVRVLVYDEVIELVRDHNYEARINGSFAATPFSLRNGSIQVYQS-GFSLAISTDFGLLVTYDAYSYVSISVPYDYQNATCGLCGNYNLRSDDDFRSPSGEILSSDVD----FANSWKVDSDTDPECHNVRCTGLAC-AVCTTDERNRYSDTNHCGILGDVAGPFAAC--HSVLAPQTYIENCVYDLCLGQG----YQPILCQALNVYATQCQQQGVHLGQWRQQGFCEIQCPEHSHFEPQGTGCPATCSNPSAPMNCP---LPNQESCICDPGYILSAGVCVPQANCGC 2650          

HSP 3 Score: 112.464 bits (280), Expect = 1.513e-23
Identity = 99/387 (25.58%), Postives = 162/387 (41.86%), Query Frame = 2
Query:  149 VKDNGVCTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTL-TQHNREDDPCSFNIEVQNE-YRGDNKYFTYTKSVII--HMFREVYELGQKGVLKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP-------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  N  CTP     +  C+    ++        +CSA GDPHY+++DG    F G CRY L T  N   +   F ++ +NE + G     T    V +  H+     ++     ++++G+   +P    S  V ++ S +++ +V+      V++ G     + +   YS    G+CG+ NG   DDF T SG D+    +++   G S+ V          G++C   +D                A+  C ++     PFS C    +VD + ++ +CV D+C++ NR      V C      A  C         WR   +C + C  N+H+      C  TC +    +   C D    EGC CN G +R G  CV    C C
Sbjct: 3061 ITGNVQCTPSSCSEEEVCQVLDGEYGCHPRPQARCSASGDPHYKSFDGTFFDFQGTCRYVLATVCNDTTNLPHFQVDARNEPWHGLTVAITVEVFVNVSGHLVHMSQDMNGHSAVEIDGETRNLPILLDSGRVSVYSSGQYI-YVSTDFGFIVSYGGSWTLNIIIPAEYSNVTCGLCGNFNGQSSDDFMTPSG-DLVRSADQF---GASWKVEDGLSCNDGCGNNCPLCQD-------------QTTARSLCEIIRSSEGPFSFC--HVSVDPQAYYDNCVFDVCLSGNR----NNVLCRSIQTYASACQANNAVIYSWRESASCAMACSNNSHYELCGTDCGHTCASSIDAS---C-DHTCSEGCFCNDGLVRSGGQCVSVEQCGC 3419          

HSP 4 Score: 108.997 bits (271), Expect = 1.463e-22
Identity = 94/353 (26.63%), Postives = 150/353 (42.49%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTL-TQHNREDDPCSFNIEVQNE-YRGDNKYFTYTKSVII--HMFREVYELGQKGVLKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP-------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CSA GDPHY+++DG    F G CRY L T  N       F ++ +NE + G     T    V +  H+     ++     ++V+G+   +P    S  + ++ S +++ +V+      V++ G     + +   YS    G+CG+ NG   DDF T SG D+    +++   G S+ +          G++C   +D                A+  C ++     PFS C    +VD + ++ DCV D+C++ NR      V C      A  C         WR   +C + C  N+H+      C  TC +    +   C D    EGC CN G +R G  CV    C C
Sbjct: 4551 CSASGDPHYKSFDGTFFDFQGTCRYVLATVCNDTIGLPHFQVDARNEPWHGLTVAITVEVFVNVSGHLVHMSQDMSGHSAVEVDGETRNLPILLDSGGLSVYSSGQYI-YVSTDFGFVVSYGGSWTLNIIIPAEYSGVTCGLCGNFNGQSSDDFMTPSG-DLVRSADQF---GASWKIEDELPCNDGCGNNCPLCQD-------------QTTARSLCEIIRSSEGPFSFC--HVSVDPQAYYDDCVFDVCLSGNR----NNVLCRSIQTYASACQANNAVIYPWRESASCAMACSNNSHYELCGTDCGHTCASSIDAS---C-DHTCSEGCFCNDGLVRSGGQCVSVERCGC 4875          

HSP 5 Score: 98.2117 bits (243), Expect = 2.694e-19
Identity = 91/345 (26.38%), Postives = 146/345 (42.32%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  CS      Y T+DGQ+  + G C  TL +         F + V+   RG   +  + K     +   + ELG+   +KV+GQ+  +P    S  +RI+ S      +     V V  D      +     Y+  + G+CG+ NG + D+F T  G  +    N   L   S+       HC++  D     + G    RS +  + CG++   + PF++C+R  N   R    DCV  +     +    ++  CE   G   +C +       WR+  NC   C +N+H+      CP +C +  F  +  C  L  +EGC CN G + +G  CV PM C C
Sbjct: 2707 YATCSVEDLGSYHTFDGQIFRYAGACGLTLARVMGPSSLPHFVLTVEKIPRGLQDFARFLKFEAGGIQVSI-ELGEGSNVKVDGQMVGLPVSVDSGQIRIYHSSVRGFVLETNFGVTVRADWPHIVRITAPSTYNGTLGGLCGNLNGDIADEFYTPDGVLL----NDTQLFAGSWRDGSLSAHCEEPFD---SWVPGHFQSRS-QFSQQCGIMALLDGPFAECSRTFNPQQR--IADCVQLL----EQTQGAKEALCEALRGYTLLCQQNRIAVEDWRNVTNCEPTCPENSHYEVCGTSCPASCPSLSFPFQ--C-SLQCQEGCQCNDGNVLNGDHCVPPMGCGC 3033          

HSP 6 Score: 97.8265 bits (242), Expect = 3.463e-19
Identity = 91/345 (26.38%), Postives = 147/345 (42.61%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  CS      Y T+DGQ+  + G C  TL +         F + V+   RG   +  + K     +   + E+G+   +KV+GQ+  +P    S  +RI+ S      +     V V  D      +     Y+  + G+CG+ NG + D+F T  G  +    N   L   S+       HC+   D S+    G+   RS +  + CG++   + PF++C+R  N   R    DCV  +     +    ++  CE   G   +C + G     WR+  NC   C +N H+      CP +C +  F  +  C  L  +EGC CN G + +G  CV P+ C C
Sbjct: 4163 YATCSVEDLGSYHTFDGQIFRYAGACGLTLARVMGPSSLPHFVLTVEKVPRGLQDFSRFLKFEAGGIQVSI-EMGEGSNVKVDGQMVGLPVSVGSGQIRIYHSSVRGFVLETNFGVTVRADWPHIVRITAPSTYNGTLGGLCGNLNGDIADEFYTPDGVLL----NDTQLFAGSWRDGSLSAHCEDPFD-SWEP--GQFQSRS-QFSQQCGIMALLDGPFAECSRTFNPQQR--IADCVQLL----EQTQGAKEALCEALRGYTLLCQQNGVAVEDWRNVTNCEPTCPENTHYEVCGTSCPASCPSLSFPFQ--C-SLQCQEGCQCNDGNVLNGDHCVPPLGCGC 4489          
BLAST of VWFD domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-39f2.3 (si:ch211-39f2.3 [Source:ZFIN;Acc:ZDB-GENE-131126-52])

HSP 1 Score: 147.132 bits (370), Expect = 4.147e-34
Identity = 111/413 (26.88%), Postives = 197/413 (47.70%), Query Frame = 2
Query:   41 SFYQFAKATRYGVCQNTKVE--KEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR--DDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            SF+  A   +  +C N+ ++  ++PC+                 C P     Q +C++  +  C  S  GDPHY T+D QV HF G C Y L++      P  + IE +NE+RG + + ++T+ V + ++ +V EL  G     ++NG  +  P+  ++  +++++S  F   ++    + V +D  S   + V   Y     G+CG+ N +R  DDF++ SG  +S+  +      NS+ V   + P  H  +   ++  ++C  D         HCG+L +   PF+ C     +  + + ++CV D+C+ +     +Q + C+  +  A  C + G    +WR Q  C +QC +++HF  +   CP TC N       P   LP +E C C+ GYI+   +CV   +C C
Sbjct:  255 SFWSDATCRQKCICTNSGLQCSQKPCSYSQ-------------ACRP--AAFQFSCQNIPRQTCTIS--GDPHYYTFDNQVFHFQGTCTYVLSEACGIGLP-YYRIEGKNEHRG-STHVSWTRMVRVFVYNKVIELVRGHNYEARINGSFAATPFSLRNGSIQVYQS-GFSLAISTDFGLLVTYDAYSYVRISVPYDYQNATCGLCGN-NNLRSDDDFRSPSGEILSSDVD----FANSWKVDSDTDPECHNVRCTGLAC-AVCTTDETNRYSDTNHCGILGDVAGPFAAC--HSVLAPQTYMENCVYDLCLGEG----YQPILCQALNVYATQCQQQGVHLGQWRQQGFCEIQCPEHSHFEPQGTGCPATCNNPSAPMNCP---LPNQESCICDPGYIQSAGVCVPQANCGC 632          

HSP 2 Score: 146.362 bits (368), Expect = 7.394e-34
Identity = 112/412 (27.18%), Postives = 192/412 (46.60%), Query Frame = 2
Query:   41 SFYQFAKATRYGVCQNTKVE--KEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            SF+  A   +  +C N+ ++   EPC+                 C P     Q +C++  +  C  S  GDPHY T+D QV HF G C Y L++      P  + IE +NE+RG + + ++T+ V + ++ EV EL  G     ++NG  +  P+   +  +++++S  F   ++    + V +D  S   + V   Y     G+CG+ N    DDF++ SG  +S+  +      NS+ V   + P  H  +   ++  ++C  D         HCG+L +   PF+ C     +  + + ++CV D+C+ +     +Q + C+  +  A  C + G    +WR Q  C +QC +++HF  +   CP TC N       P   LP +E C C+ GYI    +CV   +C C
Sbjct: 1711 SFWSDATCRQKCICTNSGLQCSPEPCSYSQ-------------ACRP--AAFQYSCQNIPRQTCTVS--GDPHYYTFDNQVFHFQGTCTYVLSEACGIGLP-YYRIEGKNEHRG-STHVSWTRMVRVFVYDEVIELVRGHNYEARINGSFAATPFSLHNGSIQVYQS-GFSLLISTDFGLLVTYDAYSYVRISVPYDYQNVTCGLCGNYNLQSDDDFRSPSGEILSSDVD----FANSWKVDSDTDPECHNVRCTGLAC-AVCTTDERNRYSDTNHCGILGDVAGPFAAC--HSVLAPQTYMENCVYDLCLGEG----YQPILCQALNVYATQCQQQGVHLGQWRQQGFCEIQCPEHSHFEPQGTGCPATCSNPSAPMNCP---LPNQESCICDYGYILSAGVCVPQANCGC 2088          

HSP 3 Score: 107.457 bits (267), Expect = 4.378e-22
Identity = 99/388 (25.52%), Postives = 161/388 (41.49%), Query Frame = 2
Query:  149 VKDNGVCTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTL-TQHNREDDPCSFNIEVQNE-YRGDNKYFTYTKSVII--HMFREVYELGQKGVLKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP-------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            +  N  CTP   + +  C+    ++        +CSA GDPHY ++D     F G CRY L T  N       F ++ +NE + G     T    V +  H+     +L     ++V+G+   +P    S  + ++ S +++ +V+      V++ G     + +   YS    G+CG+ NG   DDF T SG D+    +++   G S+ +          G++C   +D                A+  C ++     PFS C    +VD + ++ DCV D+C++ NR      V C      A  C         WR   +C + C  N+H+      C  TC +    +   C D    EGC CN G +R G  CV    C C+
Sbjct: 2499 ITGNVQCTPSSCREEEVCQVLDGEYGCHPRPQARCSASGDPHYMSFDRTFFDFQGTCRYVLATVCNDTIGLPHFQVDARNEPWHGLTVAITVEVFVNVSGHLVHMSQDLNGHSAVEVDGETRNLPILLNSGGLSVYSSGQYI-YVSTDFGFIVSYGGSWTLNIIIPAEYSGVTCGLCGNFNGQSSDDFMTPSG-DLVRSADQF---GASWKIEDGLPCNDGCGNNCPLCQD-------------QTTARSLCEIIRSNEGPFSFC--HVSVDPQAYYDDCVFDVCLSGNR----NNVLCRSIQTYASACQANNAVIYPWRESASCAMSCSNNSHYELCGTDCGHTCASSIDAS---C-DHTCSEGCFCNDGLVRSGGQCVSVEQCGCL 2858          

HSP 4 Score: 107.071 bits (266), Expect = 4.841e-22
Identity = 101/387 (26.10%), Postives = 159/387 (41.09%), Query Frame = 2
Query:  149 VKDNGVCTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTL-TQHNREDDPCSFNIEVQNE-YRGDNKYFTYTKSVII--HMFREVYELGQKGVLKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP-------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  N  CTP   + +  C+    ++        +CSA GDPHY ++D     F G CRY L T  N       F ++ +NE + G     T    V +  H+     +L     ++V+G+   +P    S  V ++ S +++ +V+      V++ G     + +   YS    G+CG+ NG   DDF T SG D+    +++   G S+ V          G++C   +D                A+  C ++     PFS C    +VD + ++ DCV D+C++ NR      V C      A  C         WR   +C + C  N+H+      C  TC +    +   C D    EGC CN G  R G  CV    C C
Sbjct: 1043 ITGNVQCTPASCREEEVCQVLDGEYGCHPRPQARCSASGDPHYMSFDRTFFDFQGTCRYVLATVCNDTIGLPHFQVDARNEPWHGLTVAITVEVFVNVSGHLVHMSQDLNGHSAVEVDGETRNLPVLLNSGRVSVYSSGQYI-YVSTDFGFVVSYGGSWTLNIIIPAEYSGVTCGLCGNFNGQSSDDFMTPSG-DLVRSADQF---GASWKVEDGLSCNDGCGNNCPLCQD-------------QTTARSLCEIIRSSEGPFSFC--HVSVDPQAYYDDCVFDVCLSGNR----NNVLCRSIQTYASACQANNAVIYPWRESASCAMACSNNSHYELCGTDCGHTCASSIDAS---C-DHTCSEGCFCNDGLARSGGQCVSVEQCGC 1401          

HSP 5 Score: 100.523 bits (249), Expect = 5.154e-20
Identity = 102/395 (25.82%), Postives = 163/395 (41.27%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDE 1399
            +  CS      Y T+DGQ+  + G C  TL +   +     F + V+   RG   +  + K     +   + E+G+   +KV+GQ+  +P    S  +RI+ S      +     V V  D      +     Y+  + G+CG+ NG + D+F T  G  +    N   L   S+       HC+   D     + G+   RS +  + CG++   + PF++C+R  N   R    DCV  +     +    ++  CE   G   +C +       WR+  NC   C +N H+      CP +C +  F  +  C  L  +EGC CN G + +G  CV PM C C      R    + R W  QG C+ L      +C    G  + T   C +E
Sbjct: 2145 YATCSVEDLGSYHTFDGQIFRYAGACGLTLARVMGQCSLPHFVLTVEKVPRGFQNFSRFLKFEAGGIQVSI-EMGEGSNVKVDGQMVGLPVSVGSGQIRIYHSSVRGFVLETNFGVTVRADWPHIVRITAPSTYNGTLGGLCGNLNGNIADEFYTPDGVLL----NDTQLFAGSWRDGSLSAHCEDPFD---SWVPGQFQSRS-QFSQQCGIMAMLDGPFAECSRTFNPQQR--IADCVQLL----EQTQGAKEALCEALRGYTLLCQQNRIAVEDWRNVTNCEPTCPENTHYEVCGTSCPASCPSLSFPFQ--C-SLQCQEGCQCNDGNVLNGDHCVPPMGCGC--HYSGRYYEARQRFWHGQG-CQFLC-----VCDGITGNVQCTPSSCREE 2513          

HSP 6 Score: 99.3673 bits (246), Expect = 1.087e-19
Identity = 100/395 (25.32%), Postives = 161/395 (40.76%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDE 1399
            +  CS      Y T+DGQ+  + G C  TL +   +     F + V+   RG   +  + K     +   + E+G+   +KV+GQ+  +P    S  +RI+ S      +     V V  D      +     Y+  + G+CG+ NG + D+F T  G  +    N   L   S+       HC++     ++S     +    +  + CG++   + PF++C+R  N   R    DCV  +     +    ++  CE   G   +C + G     WR+  NC   C  N H+      CP +C +  F  +  C  L  +EGC CN G +  G  CV PM C C      R    + R W  QG C+ L      +C    G  + T   C +E
Sbjct:  689 YATCSVEDLGSYHTFDGQIFRYAGACGLTLARVMGQCSLPHFVLTVEKVPRGFQNFSRFLKFEAGGIQVSI-EMGEGSNVKVDGQMVGLPVSVGSGQIRIYHSSVRGFVLETNFGVTVRADWPHIVRITAPSTYNGTLGGLCGNLNGNIADEFYTPDGVLL----NDTQLFAGSWRDGSLSAHCEEP----FNSWEPGHFQSRSQFSQQCGIMALLDGPFAECSRTFNPQQR--IADCVQLL----EQTQGAKEALCEALRGYTLLCQQNGVAVEDWRNVTNCEPICPNNTHYEVCGTSCPASCPSLSFPFQ--C-SLQCQEGCQCNDGNVLTGDHCVPPMGCGC--HYSGRYYQARQRFWHGQG-CQFLC-----VCDGITGNVQCTPASCREE 1057          
BLAST of VWFD domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-65b12.6 (si:dkey-65b12.6 [Source:ZFIN;Acc:ZDB-GENE-060526-329])

HSP 1 Score: 136.732 bits (343), Expect = 4.852e-31
Identity = 99/350 (28.29%), Postives = 152/350 (43.43%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  C   GDPH+RT+DG+   F G C Y L++     DP    F + V+NE RG N    YTKSV + ++     L ++  G +KVN    ++P+E  D  + IF S  F   +     + + F+ DS+  + +   Y   + G+CG+ N  + D+F T +    +      S+ G S+ V   PG  C  A      + C           K C  + +   PF  C  K N +L  F++DCV DMC+     +      C   +     C  A      WR+   CP  C  ++H+   A  CP+TC        + C      EGC C++G++     CV    C C
Sbjct:  797 YSTCQGAGDPHFRTFDGKAFDFQGTCTYYLSKLLNTADPTLIPFEVLVKNENRGRNLAVAYTKSVSLTVYGYTIVLSKESPGKVKVNDLFVKLPFELEDGRLSIFYSGYF-GMIKTDFGLTLKFNWDSHVALTLPSTYYGVLGGLCGNWNDNINDEFLTPNNTLAATA----SIFGTSWKVKDDPG--CSDACQGKACASCDVAERNKDTFTKPCSKITDKQGPFKGCHSKVNPNL--FYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGTVESWRTDSFCPTTCKAHSHYEVCAAGCPQTCSG--LTEPKSCKGTLCAEGCTCDKGFVLSDGECVAAQQCGC 1131          

HSP 2 Score: 132.494 bits (332), Expect = 8.192e-30
Identity = 98/347 (28.24%), Postives = 150/347 (43.23%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C   GDPH+RT+DG+   F G C Y L++     D     F + V+NE RG N    YTKSV + ++     L ++  G +KVN    ++P+E  D  + IF S  F   +     + + F+ DS+  + +   Y   + G+CG+ N  + D+F T +    +      S+ G S+ V   PG  C  A      + C           K C  + +   PF  C  K N +L  F++DCV DMC+     +      C   +     C  A      WR+   CP  C  ++H+   A  CP+TC        + C      EGC C++G++     CV    C C
Sbjct: 1197 CQGAGDPHFRTFDGKAFDFQGTCTYYLSKLLNTADLTLIPFEVLVKNENRGRNLAVAYTKSVSLTVYGYTIVLSKESPGKVKVNDLFVKLPFELEDGRLSIFYSGYF-GMIKTDFGLTLKFNWDSHVALTLPSTYYGVLGGLCGNWNDNINDEFLTPNNTLAATA----SIFGTSWKVKDDPG--CSDACQGKACASCDVAERNKDTFTKPCSKITDKQGPFKGCHSKVNPNL--FYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGAVESWRTDSFCPTTCKAHSHYEVCAAGCPQTCSG--LTEPKSCKGTLCTEGCTCDKGFVLSDGECVAAQQCGC 1528          

HSP 3 Score: 124.79 bits (312), Expect = 2.127e-27
Identity = 94/362 (25.97%), Postives = 156/362 (43.09%), Query Frame = 2
Query:  197 NCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKG---VLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLK-----AKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
             C    K  C C   GDPH+RT+DG+   F G C Y L++     DP    F + V+NE RG N    YTKSV + ++     L + G    ++V+   + +P    + +           V     +++ +D  S A +E+   +   + G+CG+ NG   DDF    G   S++ +       ++  +     C+          CG + ++  K     A+  C +L+    PFS C  K  +  + +F DCV D+    ++ +  + ++  + S     C   G   I WR+   CPL C KN+H+    + C  TC +     + P      +EGC C+ G++ DG  C     C C
Sbjct:  287 GCFPDGKAVCTCQGAGDPHFRTFDGKAFDFQGTCTYYLSKLLNTADPTLIPFEVLVKNENRGRNLAVAYTKSVSLTVYGYTIVLSKPGHIWEVQVDKVKTNLPVTVGEGLIQVYQSGINIVVETDFGLKLTYDTVSVAKIEIPSTFKNAVRGLCGNYNGNSADDFLLPGGIQASSEVD----FVEAWVSASDKMMCQTG--------CGANCLKPDKDKQTTAETACSLLITEKGPFSSCYDK--IPPQKYFDDCVKDVAQATDKTAHCRHIQNYVAS-----CQAIGISIIVWRNTTFCPLTCFKNSHYELCTDTCSSTCASLTKSQRCPLC----QEGCQCDDGFLFDGGECKALQDCGC 625          

HSP 4 Score: 73.9442 bits (180), Expect = 4.473e-12
Identity = 64/248 (25.81%), Postives = 94/248 (37.90%), Query Frame = 2
Query:  512 RIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
             IF+S  F   V     + + F+ DS+  + +   Y   + G+CG+ N  + DDF T             S+ G S+ V   PG  C  A        C           K C  + +   PF  C  K  V+   F++DCV DMC+     +      C   +     C  A      WR+   CP  C  N+H+   A  C +TC  H     + C      E C C+ G++    +CV    C C
Sbjct:    2 SIFRSGYF-GVVKTDFDLTMKFNWDSHVALTLPSTYYGVVGGLCGNWNDNINDDFLTPD----KTLGATASIFGTSWKVQDDPG--CSDACQGKACPKCDVAERNKDTFTKPCSKITDKQGPFKGCHSK--VNPNQFYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGAVESWRTDSFCPASCMDNSHYEVCAAGCSQTC--HGLTEPKACVGTSCVESCICDEGFVLSDGVCVSMEQCGC 234          
BLAST of VWFD domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-65b12.6 (si:dkey-65b12.6 [Source:ZFIN;Acc:ZDB-GENE-060526-329])

HSP 1 Score: 135.191 bits (339), Expect = 1.849e-30
Identity = 110/382 (28.80%), Postives = 161/382 (42.15%), Query Frame = 2
Query:  146 YVKDNGVCTPFRTKTQVNCESKR--KD-----FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            Y K N  C P +    + C  +   KD     +  C   GDPH+RT+DG+   F G C Y L++     DP    F + V+NE RG N    YTKSV + ++     L ++  G +KVN    ++P+E  D  + IF S  F   +     + + F+ DS+  + +   Y   + G+CG+ N  + D+F T +    +      S+ G S+ V   PG  C  A      + C           K C  + +   PF  C  K N +L  F++DCV DMC+     +      C   +     C  A      WR+   C   C  N H+      C  TC N     K     LP  EGC CN G++R G  C+    C C
Sbjct: 1593 YSKRNVECAPAKCMNSLVCGVRNGVKDCYPLSYSTCQGAGDPHFRTFDGKAFDFQGTCTYYLSKLLNTADPTLIPFEVLVKNENRGRNLAVAYTKSVSLTVYGYTIVLSKESPGKVKVNDLFVKLPFELEDGRLSIFYSGYF-GMIKTDFGLTLKFNWDSHVALTLPSTYYGVLGGLCGNWNDNINDEFLTPNNTLAATA----SIFGTSWKVKDDPG--CSDACQGKACASCDVAERNKDTFTKPCSKITDKQGPFKGCHSKVNPNL--FYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGTVESWRTDSFCQTYCPVNMHYEACGTACAPTCANRDGPEKCA---LPCVEGCQCNAGFVRSGDECIPVKQCGC 1958          

HSP 2 Score: 134.42 bits (337), Expect = 2.836e-30
Identity = 106/375 (28.27%), Postives = 158/375 (42.13%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKR--KD-----FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKG--VLKVNGQLSRVPYEKSDDV-RIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CTP + K    C+++   KD     +  C A GDPH+RT+DG+   F G C Y L++     DP    F + V+NE RG N    YTK+V + ++     L +     +KVN     +P+E+ D +  IF+S  F   V     + + F+ DS+  + +   Y   + G+CG+ N  + DDF T             S+ G S+ V   PG  C  A        C           K C  + +   PF  C  K  V+   F++DCV DMC+     +      C   +     C  A      WR+   CP  C  N+H+   A  C +TC  H     + C      E C C+ G++    +CV    C C
Sbjct:  789 CTPTKCKKSQMCDTRNGVKDCYPLSYSTCQAAGDPHFRTFDGKAFDFQGTCTYYLSKLLNTADPTLIPFEVLVKNENRGRNLAVAYTKTVSLKVYNYTIVLSKDDPFTVKVNNLFVNLPFEQKDGLFSIFRSGYF-GVVKTDFDLTMKFNWDSHVALTLPSTYYGVVGGLCGNWNDNINDDFLTPD----KTLGATASIFGTSWKVQDDPG--CSDACQGKACPKCDVAERNKDTFTKPCSKITDKQGPFKGCHSK--VNPNQFYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGAVESWRTDSFCPASCMDNSHYEVCAAGCSQTC--HGLTEPKACVGTSCVESCICDEGFVLSDGVCVSMEQCGC 1148          

HSP 3 Score: 132.109 bits (331), Expect = 1.327e-29
Identity = 98/350 (28.00%), Postives = 151/350 (43.14%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  C   GDPH+RT+DG+   F G C Y L++     D     F + V+NE RG N    YTKSV + ++     L ++  G +KVN    ++P+E  D  + IF S  F   +     + + F+ DS+  + +   Y   + G+CG+ N  + D+F T +    +      S+ G S+ V   PG  C  A      + C           K C  + +   PF  C  K N +L  F++DCV DMC+     +      C   +     C  A      WR+   CP  C  ++H+   A  CP+TC        + C      EGC C++G++     CV    C C
Sbjct: 2017 YSTCQGAGDPHFRTFDGKAFDFQGTCTYYLSKLLNTADLTLIPFEVLVKNENRGRNLAVAYTKSVSLTVYGYTIVLSKESPGKVKVNDLFVKLPFELEDGRLSIFYSGYF-GMIKTDFGLTLKFNWDSHVALTLPSTYYGVLGGLCGNWNDNINDEFLTPNNTLAATA----SIFGTSWKVKDDPG--CSDACQGKACASCDVAERNKDTFTKPCSKITDKQGPFKGCHSKVNPNL--FYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGAVESWRTDSFCPTTCKAHSHYEVCAAGCPQTCSG--LTEPKSCKGTLCTEGCTCDKGFVLSDGECVAAQQCGC 2351          

HSP 4 Score: 130.183 bits (326), Expect = 5.907e-29
Identity = 92/344 (26.74%), Postives = 152/344 (44.19%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNR-EDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELG-QKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGV-RDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGI-KWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C AVGDPH++T+DG++  F G C Y +    + +     F+I  +N +RG  +   Y +SV + ++     +G QKGV++ +G+ + +P            R     ++    + V +D +   ++     Y + + G+CG+ NG  RD++    G  +S+  +       ++ V      C    +    S C        K + +CGV+ + + PF  C     VD R +  +CV D+C+N       +   C       + C  AG +    WR+  NCPL C  N H+      C  +C +     K     LP  EGC CN G++R GA CV    C C
Sbjct:  427 CHAVGDPHFKTFDGKLFDFQGTCTYVMVNSTKTQKGLIPFSILTKNNHRGSTR-VAYVRSVSVLVYTHTIVVGSQKGVVEFDGENTYLPLSIDGGKIKVNQRGLNVIISTDFGLEVKYDWNMMLYITAPSSYFQTVGGLCGNYNGDRRDEYIDPKGNTLSSIID----FAKTWKVPDNDLFCNDDCNGQCPS-CTVSLQEEYKKESNCGVIAKSDGPFVLC--HNTVDPRMYVDNCVYDVCINNGI----RNFLCNNIQSYVDACMSAGIKITGNWRTLANCPLSCPVNMHYEFCGTACAASCADRSAPDK---CTLPCVEGCHCNTGFVRSGAECVPMNKCGC 755          

HSP 5 Score: 91.6633 bits (226), Expect = 2.312e-17
Identity = 81/350 (23.14%), Postives = 147/350 (42.00%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNR-EDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLK-----AKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CS  G   Y+++DG+     GDC Y L +  + +D   SF++ ++ +    +    +T+ V I + +    L  G    ++V+   + +P    +  +++++S   +  V     +++ +D  S A +E+   +   + G+CG+ NG   DDF    G   S+          ++        C+          CG + ++  K     A+  C +L+    PFS C  K  +  + +F DCV D+    ++ +      C         C   G   I WR+   CP+ C  N+H+    + C  TC +     K P    P +EGC C+ G++ DG  C     C C
Sbjct: 2413 CSVSGFGLYQSFDGKSFSVQGDCEYRLVEAVQIQDVKSSFSVLIKQQ----SSEMVFTRKVEIQLQQSTITLLPGHIWEVQVDKVKTNLPVTVGEGLIQVYQSGINI-VVETDFGLKLTYDTVSVAKIEIPSTFKNAVRGLCGNYNGNSADDFLLPDGIQTSSVE----YFAEAWVSPSDKMMCQTG--------CGANCLKPDKDKQTTAETACSLLITEKGPFSSCYDK--IPPQKYFDDCVKDVAQATDKTAH-----CRHMQNYVASCQAIGISIIVWRNITFCPIMCLANSHYELCTDTCSSTCASLTNSQKCP----PCQEGCQCDDGFLFDGGECKAFQDCGC 2734          

HSP 6 Score: 91.6633 bits (226), Expect = 2.734e-17
Identity = 83/353 (23.51%), Postives = 144/353 (40.79%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTL--TQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEP-------NNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CS  G   Y+++DG+     GDC Y L  T  + +DD   F++ ++ +    +    +T+ V + +      L  G    ++V    + +P    +  +++++S   +  V     +++ +D  S A +E+   +   + G+CG+ NG   DDF    G   S++ +       ++  +  G       +     ICG   +    A K      EP         PF  C  K  V+   F++DCV DMC+     +      C   +     C  A      WR+   CPL C KN+H+    + C  TC +     + P      +EGC C+ G++ DG  C     C C
Sbjct: 1210 CSVSGFGFYQSFDGRSFSVQGDCEYRLVETALDSDDDLSFFSVLIKQQ----SSEMVFTRRVELQIEESTITLLPGHIWEVQVGKVKTNLPVTVGEGLIQVYQSGINI-VVETDFGLKLTYDTVSVARIEIPSTFKNAVRGLCGNYNGNSADDFLLPGGIQASSEVD----FVEAWVSASAGVFTCVPMECKEEEICGN--VECAPANKLLHAQTEPCSKITDKQGPFKGCHSK--VNPNQFYEDCVYDMCMYGGHST----ALCSALTAYTAACQHALGAVESWRTDSFCPLTCFKNSHYELCTDTCSSTCASLTKSQRCPLC----QEGCQCDDGFLFDGGECKALQDCGC 1541          
BLAST of VWFD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000752.1 (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:100379885])

HSP 1 Score: 161.384 bits (407), Expect = 3.416e-38
Identity = 123/399 (30.83%), Postives = 178/399 (44.61%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKRK-------DFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKE 1321
            VCTP   K    C             F  CSA GDPHY T+DG+   F G C Y L      D   + F ++VQN  RG NK  +YTK V + ++  V  L       + V+G  + +P Y+ +D V  + S      +     + V +D  S   V V   Y+  +NG+CG+ N    DD   K+G    N        G+S+ V + PG      +  S   +C +   +  K++K+CG++ + N PFS+C+    +D   FF DCV D C  +  PS +    C         C  AG +  +WRS   CPL C  N+H+    N CP TC      +   C   P +E C+C+ G+I  G  CV    C C+      +S+E    +   GQC E
Sbjct: 2052 VCTPTSCKASEKCLVVNGVRGCHPISFSTCSAYGDPHYTTFDGRRFDFMGTCVYQLVGVTSSDASLTRFTVKVQNNNRG-NKAVSYTKVVTVEVYNMVLTLSMDFPRRILVDGVATALPWYDGTDRVSAYISGN-QGIIKTDFDLTVVYDWSSYVAVTVPSTYTNAVNGLCGNNNKNPNDDLTMKNGNAAGNAVQ----FGDSWKVGEVPGC---TPECTSNCPLCSEAQKQDYKSEKYCGIITKANGPFSQCSSV--IDPTPFFNDCVFDACQYRGHPSSF----CNAIGLYVSACQAAGVQIQEWRSATFCPLSCPLNSHYELCGNGCPVTCSG--LASPTGCV-APCKESCSCDNGFILSGHKCVPIASCGCVYQNKYYQSNE---VFYPNGQCSE 2429          

HSP 2 Score: 150.599 bits (379), Expect = 5.564e-35
Identity = 102/352 (28.98%), Postives = 170/352 (48.30%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELG--QKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C AVGDPH+RT+DG+   F G C YT+ + +  D     FNIE +NE RG+ +   Y   V + ++     L   + G ++VN Q  R+P   +D  VR+++S   +  +    S++V +D +S   V +S  + + ++G+CG+ NG   DD  T +G    N  +     G S+ V      C       +H+       C  D  +   +++ CG+L + + PF +C   G+VD + +  +CV D+C+N       +++ C+     A+ C     +  +WR    CP+QC +N+ +   +  CP TC +    T   C +    EGC C  GY+ D   C+    C CI
Sbjct:  499 CWAVGDPHFRTFDGRFYDFQGTCTYTIAKTSGSDSSLPVFNIEAKNENRGNTR-VAYVSFVTVQVYGFTMSLVRYENGFVRVNDQRQRLPMNLNDGQVRLYQSGSMV-VIETDFSMKVYYDWNSILKVSISSSFYESVSGMCGNYNGNPGDDLVTPAGTQAPNLVD----FGKSWKVEDGDRFC-------WHNCNGECKTCSLDLQKQYASEQTCGLLSKADGPFRQC--HGSVDPKVYVDNCVYDLCMNGGS----KQILCQSIKSYADACQRNKIQIAEWRQPSACPMQCPENSQYKLCSKGCPSTCNDD--ATPSTCSE-SCVEGCECKDGYVLDEGKCIPKSSCGCI 828          

HSP 3 Score: 143.28 bits (360), Expect = 9.763e-33
Identity = 107/346 (30.92%), Postives = 163/346 (47.11%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ--KGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHF--FGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+A GDPHY ++DG    F G C Y L     + +    F + VQNE RG +K   YT +V + +      + +  K  + VN  L+ +PY   +       + F   +     +RV ++ DS   V++   Y+  + G+CG+ +G +++  T     V+ K     L GNS+ V   PG + +   D S  +   +  +R   +K+ CG+L++ + PF  C  K  VD +  F+DCV D C    R    Q + C++ +G A  C  AG     WRS   CP+ CGKN+H+   A+ CP TC       G    C      EGC C+ G+I  G  CV    C C
Sbjct:  889 CTASGDPHYVSFDGVRYDFQGTCIYQLAGLCKKTEGLVDFTVNVQNENRG-SKVVAYTSAVNVTLCNLQIGITRQYKDRILVNQVLTNLPYSVENGKLSIYKQGFNAILQTSFGLRVVYNWDSYVEVKIPSTYAGAVCGLCGNYDGDKNNEFTMKNNQVATKP---LLFGNSWKVQNVPGCYEEDKGDCSNLA---ELELRHRASKESCGMLIDKSGPFRDCHAK--VDPQGAFKDCVYDSCFYAGR----QDILCKVIAGYAAACQRAGLNIEPWRSAKFCPV-CGKNSHYEVCASACPSTCLALAPPMGCSGEC-----SEGCECDDGFILSGGDCVPISQCGC 1215          

HSP 4 Score: 140.969 bits (354), Expect = 4.916e-32
Identity = 98/350 (28.00%), Postives = 148/350 (42.29%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDD-PCSFNIEVQNEYRGD-NKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHC-KKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRP------CYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +C A GDPHY ++DG    F G C YTL +   +D     F++ V+NE  G+ N   T    V ++ +    E G K   KV+G++ ++P    DD  +         +     ++V +D   +  V V   Y  KM G+CG+ NG + D      + V    N++   G ++ VS  G  C     D  +  +C    ++  K    CG++  P+ PF  C  K  +    +F  C  D C  + +        C+       VC   G     WR+   CPL C  N+H+      C RTC+    G   P      C+     EGC CN G++ DG  CV    C C
Sbjct: 2468 RCVAQGDPHYISFDGLTFDFQGTCTYTLAKVVDDDSRLVKFSVGVENESYGNGNVAVTRLVVVSVYGYSIAIERGMKWNAKVDGEILKLPLSLDDDSIVINQEGNNIVIQTDFGLKVLYDAVYHVVVNVPSSYRGKMGGLCGNFNGDKSDEFQLPNKQVVKNVNQF---GAAWKVSIAGAKCYDDCGDKCF--VCDPPKLQPFKGTASCGMITNPSGPFRACHSK--ISPTEYFDHCTYDSCAAEGK----DDFLCKSLQAYTAVCQTVGVAIENWRTASFCPLSCPANSHYEL----CTRTCDQTCTGISSPTKCTTRCF-----EGCECNAGFVSDGEKCVSMDKCGC 2797          

HSP 5 Score: 129.798 bits (325), Expect = 9.865e-29
Identity = 103/368 (27.99%), Postives = 156/368 (42.39%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKY-FTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK--AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI------NLCVDRESSEKC 1288
            F  CSA GDPHY + DG    F G C YTLT+      +   F + V+NE  GD K   T   S+ ++ +  + +   +G + VN  L  +P    D  VR ++       +     V+V++D   +  V V   Y  ++ G+CG+ N  R D+F+    R  ++     +  G+S+ V  PG  C +    + +    C        +   +CG L + + P S C   G ++   +F +C+ D+C             C        VC  AG     WRS   CPL C  N+ +   A+ C  TC      TK P       EGC C+ G+  DG  CV   +C C       N+ V  + SE C
Sbjct: 1273 FGTCSAAGDPHYMSLDGLAFDFQGTCTYTLTKSITSNANLVPFAVNVKNEKYGDGKVAVTKLVSLEVYGYTLILQYNTQGRILVNNVLYNLPLTLEDGKVRAYQ-HGIRTNIETDFGVKVSYDLVYHVIVTVPGNYKGQVGGLCGNFNDDRKDEFQLPDKRLTADA----TTFGSSWKVQIPGVSCDEGCGGNGNPCPACDAKKKEIFQTDNYCGFLKKKDGPLSAC--YGTINPDTYFNNCLFDVCAGAGD----GDTLCRSIQSYVAVCQAAGIAIQSWRSDSFCPLTCPANSKYKVCADVCSTTCAGVTDFTKCP---TTCSEGCECDDGFFFDGKNCVSMDNCGCFEDGRYYNVIVSNDCSEVC 1626          

HSP 6 Score: 111.309 bits (277), Expect = 4.034e-23
Identity = 100/392 (25.51%), Postives = 167/392 (42.60%), Query Frame = 2
Query:   95 VEKEPCTNGTRNIRITTYVKD-NGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDP-CSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS--ICGKDWIRSLKAKKHCGVLLEP-NNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            V K+PC +     + T  ++D N VC P  T T             C A GDPHY T+DG    F G C Y L+++   D     F IE +N+ RG ++   Y ++V I+M+     +  G+ G +++N  ++ +P    D             V     ++V ++ +    V +S  Y     G+CG+ N   +D        ++   +K + I +     K         D    +   C      +   ++ CG++ +  N PF +C  K N D  NFF +C+ D+C+N       ++  C+  +  A  C + G +   WR+   C L C +N+H+    N CP +C +    ++  C D    E C CN G++     CV    C C
Sbjct: 1657 VNKDPCKSMKCRTKETCKIQDGNAVCVPDYTGT-------------CWAWGDPHYHTFDGYNYDFQGTCTYILSKYIGNDPGLVPFTIEEKNDNRG-SQTVAYVRTVNIYMYGYKVSIVKGEFGKVRINDVVANLPVALLDGKISVSISGANAVVKTDFGLQVTYEYNWYVVVTLSSSYYGATGGLCGNFNQNSND------EMIAADGSKVTAIVDWAKTWKVNDRDPFCWDFCRGNCPTCDDSKKSTYGGEQFCGLISKAANGPFRECHPKINPD--NFFDNCLYDVCINGGA----KQFLCQALTAYANTCRKQGAKIYDWRTPSGCVLPCPENSHYEFCGNACPASCSDRTAPSR--CTDA-CVETCQCNDGFVLSADKCVPVKSCGC 2019          

HSP 7 Score: 98.9821 bits (245), Expect = 2.031e-19
Identity = 87/346 (25.14%), Postives = 138/346 (39.88%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAF--VEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            +  CS +GD +Y  +DGQ   F G C   +           +  E+  E  G + +   T +VI+ ++R    +        + +L  V +++   +++F+S      +     + V+FD  SN F  V V   Y+   N +CG C    D                            PG     A        CG     S ++  +CG++ +   PF  C  +  V+  ++FQ+C+ +MC    R +  Q   C+   G    C EAG     WR++  C   C  NA +    + CP TC         PC  LP +EGC CN GY + G +C  P  C C+
Sbjct: 3242 YLSCSVLGDLNYTAFDGQQYKFQGSCLAKMAGLCSSLPGLEY-FELYLEKEGKSNF---TTAVILKIYRTTVTISGYPQKTYSVRLPFVLHDRR--LQVFRSGLNAIVLQIDFGLVVSFD-SSNGFLLVRVPDSYT---NAVCGACAAPSDIV--------------------------PGVQACGASCTGDCIECGAAEKESYRSFNNCGIITDLQGPFRDCRTR--VNTESYFQNCLGNMC----RHNGSQVALCQSLGGFVAACQEAGGTVYSWRTEELCKPSCPANAQYELCVSSCPDTCNGSL---PLPC-PLPCKEGCPCNPGYTQSGDMCALPEDCGCL 3541          

HSP 8 Score: 97.0561 bits (240), Expect = 9.483e-19
Identity = 94/401 (23.44%), Postives = 166/401 (41.40%), Query Frame = 2
Query:  200 CESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ--KGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAF-----VEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI---------NLCVDRESSEKCR-KWKQQGQCKELSEAMNIIC 1348
            C + +   C  S   + HYR++DG   +   +C Y + +  + D+  + F + V  +   +N      K V+++++     L    +G+L VNG     P      + +   +           VR  F    +       +++   YS KM G+CG+ N   +D      ++++   +K+        +S+PG     +    + +    +  +   + ++C VL++P  PF  C    +V   +F++DC++    N N    + K  C    G A  C  AG     WR++  CP  C  N++++   +PC  TC + F  T  PC  +   EGC CN G+  DG  CV    C C           + +D +  + C      Q QC+ LS     IC
Sbjct: 3591 CSAPKSPICWVS--NNLHYRSFDGTTFNGNVNCSYVMAKVCKMDNLTTEFELHVTGDLD-ENSGMYQLKEVLLNVYGYTLSLSTETQGIL-VNGTAQYNP------IDLENGKISAISHISSILVRTDFGLSVSLSYSLLSIQIPSNYSGKMCGLCGNANQNAND-----DQNINATLSKW--------LSRPGQGMCDSPVQDFSNDFPNETAQFSNSSQYCAVLVDPEGPFMSCLV--SVSPVSFYEDCLM----NFNMGGGFNKYICSTIEGYARTCQLAGSTVYPWRNESFCPAGCPANSNYTICKDPCSPTCIDPFRYT--PCQSMCS-EGCECNSGFYEDGGRCVPTEACGCYVQGYYYPQGYVGIDEDCQQNCSCPQFNQWQCEPLSCPSESIC 3959          

HSP 9 Score: 63.5438 bits (153), Expect = 1.101e-8
Identity = 83/348 (23.85%), Postives = 125/348 (35.92%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDG-QVIHFYGDCRYTLTQHNR---EDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCV-NKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTC---ENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A G  +YRT+ G        DC   L  +     ED P  F++E   E      + TY  +V      EV E    G +K+NG+L  +P    D     K       V+    +RV         +++  RYS ++ G C D                    N YS I      S  G  C  A  ++    CG+    +    ++C ++ + +  F  C ++  +  + F   C+  +C  + NR        C      A  C+  G     WR+   C LQC   +H+    +  PR C   E +F+    PC      E C C  G       CV    C C
Sbjct: 2882 CMAWGSTYYRTFGGRHTFQPAQDCATLLIAYPGVMGEDWP--FSVERSPEEEFSLTFRTYGDTV------EVTE-DMSGRIKLNGELIYLPATLFDGRLTIKQWGLSTEVSYSFGLRVTIGVRGLLHLQLHNRYSTQVFGACADAGS-------------QGPLNAYSWIS-----SANGELCDPASPVTARD-CGR---MNSSVAQNCSLMAD-HAIFQACHKQ--ICPKPFIDSCLHALCTESGNR-------TCSALEAYALACAMEGVNLTTWRTIAKCDLQCPPQSHYETCPSAPPRACLVSEGYFY---SPCDGNNCIETCVCEEGLQLSMGACVPSNQCGC 3185          

HSP 10 Score: 54.6842 bits (130), Expect = 5.010e-6
Identity = 57/257 (22.18%), Postives = 92/257 (35.80%), Query Frame = 2
Query:  563 VRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKA-KDISYHSICGKDWIRSLKA----------KKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC-INLCVDRESSEKCRKW 1297
            + V F G    F+ +   Y   +N  CG C GV     T  G   +      + +  +  V+        A   ++  S   + +  +L +             C +LL+ + PF  C     +D   ++  C+   C      +      C+        C +       WR+   CP  C  N H+S   +PC  TC     GT     +L   EGC CN G  R+G  C+    C C  N    +  + +C +W
Sbjct: 3992 LTVLFKGGEYLFIMLPAGY---LNSTCGLCAGVNMTMVTTPGAVATAAATPMTPVAAATLVTPVAAATSSAIVAVATPSEGNQSFSDTLSSWNCSDSDHPGASLCMILLDNDGPFGACHEV--LDPYLYYDACLSSQCQKGGNIAG----VCQSLQNYTLSCQQQNQTIEPWRNDSFCPFACPMNKHYSICVDPCGETCTAP-NGTSS--CNLTCIEGCECNVGLYREGDKCIPIEACGCNANGTYFKVGALRCERW 4236          
BLAST of VWFD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000563.1 (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:100379885])

HSP 1 Score: 160.999 bits (406), Expect = 3.857e-38
Identity = 123/399 (30.83%), Postives = 178/399 (44.61%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKRK-------DFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKE 1321
            VCTP   K    C             F  CSA GDPHY T+DG+   F G C Y L      D   + F ++VQN  RG NK  +YTK V + ++  V  L       + V+G  + +P Y+ +D V  + S      +     + V +D  S   V V   Y+  +NG+CG+ N    DD   K+G    N        G+S+ V + PG      +  S   +C +   +  K++K+CG++ + N PFS+C+    +D   FF DCV D C  +  PS +    C         C  AG +  +WRS   CPL C  N+H+    N CP TC      +   C   P +E C+C+ G+I  G  CV    C C+      +S+E    +   GQC E
Sbjct: 1569 VCTPTSCKASEKCLVVNGVRGCHPISFSTCSAYGDPHYTTFDGRRFDFMGTCVYQLVGVTSSDASLTRFTVKVQNNNRG-NKAVSYTKVVTVEVYNMVLTLSMDFPRRILVDGVATALPWYDGTDRVSAYISGN-QGIIKTDFDLTVVYDWSSYVAVTVPSTYTNAVNGLCGNNNKNPNDDLTMKNGNAAGNAVQ----FGDSWKVGEVPGC---TPECTSNCPLCSEAQKQDYKSEKYCGIITKANGPFSQCSSV--IDPTPFFNDCVFDACQYRGHPSSF----CNAIGLYVSACQAAGVQIQEWRSATFCPLSCPLNSHYELCGNGCPVTCSG--LASPTGCV-APCKESCSCDNGFILSGHKCVPIASCGCVYQNKYYQSNE---VFYPNGQCSE 1946          

HSP 2 Score: 150.214 bits (378), Expect = 6.828e-35
Identity = 103/352 (29.26%), Postives = 169/352 (48.01%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELG--QKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C AVGDPH+RT+DG+   F G C YT+ + +  D     FNIE +NE RG N    Y   V + ++     L   + G ++VN Q  R+P   +D  VR+++S   +  +    S++V +D +S   V +S  + + ++G+CG+ NG   DD  T +G    N  +     G S+ V      C       +H+       C  D  +   +++ CG+L + + PF +C   G+VD + +  +CV D+C+N       +++ C+     A+ C     +  +WR    CP+QC +N+ +   +  CP TC +    T   C +    EGC C  GY+ D   C+    C CI
Sbjct:   16 CWAVGDPHFRTFDGRFYDFQGTCTYTIAKTSGSDSSLPVFNIEAKNENRG-NTRVAYVSFVTVQVYGFTMSLVRYENGFVRVNDQRQRLPMNLNDGQVRLYQSGSMV-VIETDFSMKVYYDWNSILKVSISSSFYESVSGMCGNYNGNPGDDLVTPAGTQAPNLVD----FGKSWKVEDGDRFC-------WHNCNGECKTCSLDLQKQYASEQTCGLLSKADGPFRQC--HGSVDPKVYVDNCVYDLCMNGGS----KQILCQSIKSYADACQRNKIQIAEWRQPSACPMQCPENSQYKLCSKGCPSTCNDD--ATPSTCSE-SCVEGCECKDGYVLDEGKCIPKSSCGCI 345          

HSP 3 Score: 143.28 bits (360), Expect = 8.372e-33
Identity = 107/346 (30.92%), Postives = 163/346 (47.11%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ--KGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHF--FGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+A GDPHY ++DG    F G C Y L     + +    F + VQNE RG +K   YT +V + +      + +  K  + VN  L+ +PY   +       + F   +     +RV ++ DS   V++   Y+  + G+CG+ +G +++  T     V+ K     L GNS+ V   PG + +   D S  +   +  +R   +K+ CG+L++ + PF  C  K  VD +  F+DCV D C    R    Q + C++ +G A  C  AG     WRS   CP+ CGKN+H+   A+ CP TC       G    C      EGC C+ G+I  G  CV    C C
Sbjct:  406 CTASGDPHYVSFDGVRYDFQGTCIYQLAGLCKKTEGLVDFTVNVQNENRG-SKVVAYTSAVNVTLCNLQIGITRQYKDRILVNQVLTNLPYSVENGKLSIYKQGFNAILQTSFGLRVVYNWDSYVEVKIPSTYAGAVCGLCGNYDGDKNNEFTMKNNQVATKP---LLFGNSWKVQNVPGCYEEDKGDCSNLA---ELELRHRASKESCGMLIDKSGPFRDCHAK--VDPQGAFKDCVYDSCFYAGR----QDILCKVIAGYAAACQRAGLNIEPWRSAKFCPV-CGKNSHYEVCASACPSTCLALAPPMGCSGEC-----SEGCECDDGFILSGGDCVPISQCGC 732          

HSP 4 Score: 136.732 bits (343), Expect = 7.522e-31
Identity = 94/349 (26.93%), Postives = 147/349 (42.12%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDD-PCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHC-KKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRP------CYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +C A GDPHY ++DG    F G C YTL +   +D     F++ V+NE  G N     T+ V++ ++     + +     V+G++ ++P    DD  +         +     ++V +D   +  V V   Y  KM G+CG+ NG + D      + V    N++   G ++ VS  G  C     D  +  +C    ++  K    CG++  P+ PF  C  K  +    +F  C  D C  + +        C+       VC   G     WR+   CPL C  N+H+      C RTC+    G   P      C+     EGC CN G++ DG  CV    C C
Sbjct: 1985 RCVAQGDPHYISFDGLTFDFQGTCTYTLAKVVDDDSRLVKFSVGVENESYG-NGNVAVTRLVVVSVYGYSIAIERGMKWNVDGEILKLPLSLDDDSIVINQEGNNIVIQTDFGLKVLYDAVYHVVVNVPSSYRGKMGGLCGNFNGDKSDEFQLPNKQVVKNVNQF---GAAWKVSIAGAKCYDDCGDKCF--VCDPPKLQPFKGTASCGMITNPSGPFRACHSK--ISPTEYFDHCTYDSCAAEGK----DDFLCKSLQAYTAVCQTVGVAIENWRTASFCPLSCPANSHYEL----CTRTCDQTCTGISSPTKCTTRCF-----EGCECNAGFVSDGEKCVSMDKCGC 2312          

HSP 5 Score: 130.183 bits (326), Expect = 6.987e-29
Identity = 110/397 (27.71%), Postives = 166/397 (41.81%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKY-FTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK--AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI------NLCVDRESSEKCRKWKQQGQ-CKELSEAMNIICPKTCGFCK 1372
            F  CSA GDPHY + DG    F G C YTLT+      +   F + V+NE  GD K   T   S+ ++ +  + +   +G + VN  L  +P    D  VR ++       +     V+V++D   +  V V   Y  ++ G+CG+ N  R D+F+    R  ++     +  G+S+ V  PG  C +    + +    C        +   +CG L + + P S C   G ++   +F +C+ D+C             C        VC  AG     WRS   CPL C  N+ +   A+ C  TC      TK P       EGC C+ G+  DG  CV   +C C       N+ V  + SE C      G  C++     + IC  T G  K
Sbjct:  790 FGTCSAAGDPHYMSLDGLAFDFQGTCTYTLTKSITSNANLVPFAVNVKNEKYGDGKVAVTKLVSLEVYGYTLILQYNTQGRILVNNVLYNLPLTLEDGKVRAYQ-HGIRTNIETDFGVKVSYDLVYHVIVTVPGNYKGQVGGLCGNFNDDRKDEFQLPDKRLTADA----TTFGSSWKVQIPGVSCDEGCGGNGNPCPACDAKKKEIFQTDNYCGFLKKKDGPLSAC--YGTINPDTYFNNCLFDVCAGAGD----GDTLCRSIQSYVAVCQAAGIAIQSWRSDSFCPLTCPANSKYKVCADVCSTTCAGVTDFTKCP---TTCSEGCECDDGFFFDGKNCVSMDNCGCFEDGRYYNVIVSNDCSEVCTCSPMGGLICEKTGCTSDEICKVTDGIVK 1172          

HSP 6 Score: 111.694 bits (278), Expect = 3.080e-23
Identity = 100/392 (25.51%), Postives = 167/392 (42.60%), Query Frame = 2
Query:   95 VEKEPCTNGTRNIRITTYVKD-NGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDP-CSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS--ICGKDWIRSLKAKKHCGVLLEP-NNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            V K+PC +     + T  ++D N VC P  T T             C A GDPHY T+DG    F G C Y L+++   D     F IE +N+ RG ++   Y ++V I+M+     +  G+ G +++N  ++ +P    D             V     ++V ++ +    V +S  Y     G+CG+ N   +D        ++   +K + I +     K         D    +   C      +   ++ CG++ +  N PF +C  K N D  NFF +C+ D+C+N       ++  C+  +  A  C + G +   WR+   C L C +N+H+    N CP +C +    ++  C D    E C CN G++     CV    C C
Sbjct: 1174 VNKDPCKSMKCRTKETCKIQDGNAVCVPDYTGT-------------CWAWGDPHYHTFDGYNYDFQGTCTYILSKYIGNDPGLVPFTIEEKNDNRG-SQTVAYVRTVNIYMYGYKVSIVKGEFGKVRINDVVANLPVALLDGKISVSISGANAVVKTDFGLQVTYEYNWYVVVTLSSSYYGATGGLCGNFNQNSND------EMIAADGSKVTAIVDWAKTWKVNDRDPFCWDFCRGNCPTCDDSKKSTYGGEQFCGLISKAANGPFRECHPKINPD--NFFDNCLYDVCINGGA----KQFLCQALTAYANTCRKQGAKIYDWRTPSGCVLPCPENSHYEFCGNACPASCSDRTAPSR--CTDAC-VETCQCNDGFVLSADKCVPVKSCGC 1536          
BLAST of VWFD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000615.1 (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:100379885])

HSP 1 Score: 160.999 bits (406), Expect = 4.004e-38
Identity = 123/399 (30.83%), Postives = 178/399 (44.61%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKRK-------DFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKE 1321
            VCTP   K    C             F  CSA GDPHY T+DG+   F G C Y L      D   + F ++VQN  RG NK  +YTK V + ++  V  L       + V+G  + +P Y+ +D V  + S      +     + V +D  S   V V   Y+  +NG+CG+ N    DD   K+G    N        G+S+ V + PG      +  S   +C +   +  K++K+CG++ + N PFS+C+    +D   FF DCV D C  +  PS +    C         C  AG +  +WRS   CPL C  N+H+    N CP TC      +   C   P +E C+C+ G+I  G  CV    C C+      +S+E    +   GQC E
Sbjct: 1984 VCTPTSCKASEKCLVVNGVRGCHPISFSTCSAYGDPHYTTFDGRRFDFMGTCVYQLVGVTSSDASLTRFTVKVQNNNRG-NKAVSYTKVVTVEVYNMVLTLSMDFPRRILVDGVATALPWYDGTDRVSAYISGN-QGIIKTDFDLTVVYDWSSYVAVTVPSTYTNAVNGLCGNNNKNPNDDLTMKNGNAAGNAVQ----FGDSWKVGEVPGC---TPECTSNCPLCSEAQKQDYKSEKYCGIITKANGPFSQCSSV--IDPTPFFNDCVFDACQYRGHPSSF----CNAIGLYVSACQAAGVQIQEWRSATFCPLSCPLNSHYELCGNGCPVTCSG--LASPTGCV-APCKESCSCDNGFILSGHKCVPIASCGCVYQNKYYQSNE---VFYPNGQCSE 2361          

HSP 2 Score: 154.836 bits (390), Expect = 2.960e-36
Identity = 121/424 (28.54%), Postives = 188/424 (44.34%), Query Frame = 2
Query:   23 LLIITLSFYQFAKATRYGVCQNTKV-EKEPC--TNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELG--QKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
             LI  L FY F        C+ TK   KE C  TNG              VC P                  C AVGDPH+RT+DG+   F G C YT+ + +  D     FNIE +NE RG N    Y   V + ++     L   + G ++VN Q  R+P   +D  VR+++S   +  +    S++V +D +S   V +S  + + ++G+CG+ NG   DD  T +G    N  +     G S+ V      C       +H+       C  D  +   +++ CG+L + + PF +C   G+VD + +  +CV D+C+N       +++ C+     A+ C     +  +WR    CP+QC +N+ +   +  CP TC +    T   C +    EGC C  GY+ D   C+    C CI
Sbjct:  384 FLINNLPFYIFPSGVAVASCETTKCRSKEKCQMTNGKP------------VCIPTSESI-------------CWAVGDPHFRTFDGRFYDFQGTCTYTIAKTSGSDSSLPVFNIEAKNENRG-NTRVAYVSFVTVQVYGFTMSLVRYENGFVRVNDQRQRLPMNLNDGQVRLYQSGSMV-VIETDFSMKVYYDWNSILKVSISSSFYESVSGMCGNYNGNPGDDLVTPAGTQAPNLVD----FGKSWKVEDGDRFC-------WHNCNGECKTCSLDLQKQYASEQTCGLLSKADGPFRQC--HGSVDPKVYVDNCVYDLCMNGGS----KQILCQSIKSYADACQRNKIQIAEWRQPSACPMQCPENSQYKLCSKGCPSTCNDD--ATPSTCSE-SCVEGCECKDGYVLDEGKCIPKSSCGCI 760          

HSP 3 Score: 142.895 bits (359), Expect = 9.856e-33
Identity = 107/349 (30.66%), Postives = 164/349 (46.99%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ--KGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHF--FGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  C+A GDPHY ++DG    F G C Y L     + +    F + VQNE RG +K   YT +V + +      + +  K  + VN  L+ +PY   +       + F   +     +RV ++ DS   V++   Y+  + G+CG+ +G +++  T     V+ K     L GNS+ V   PG + +   D S  +   +  +R   +K+ CG+L++ + PF  C  K  VD +  F+DCV D C    R    Q + C++ +G A  C  AG     WRS   CP+ CGKN+H+   A+ CP TC       G    C      EGC C+ G+I  G  CV    C C
Sbjct:  818 YGTCTASGDPHYVSFDGVRYDFQGTCIYQLAGLCKKTEGLVDFTVNVQNENRG-SKVVAYTSAVNVTLCNLQIGITRQYKDRILVNQVLTNLPYSVENGKLSIYKQGFNAILQTSFGLRVVYNWDSYVEVKIPSTYAGAVCGLCGNYDGDKNNEFTMKNNQVATKP---LLFGNSWKVQNVPGCYEEDKGDCSNLA---ELELRHRASKESCGMLIDKSGPFRDCHAK--VDPQGAFKDCVYDSCFYAGR----QDILCKVIAGYAAACQRAGLNIEPWRSAKFCPV-CGKNSHYEVCASACPSTCLALAPPMGCSGEC-----SEGCECDDGFILSGGDCVPISQCGC 1147          

HSP 4 Score: 130.183 bits (326), Expect = 8.110e-29
Identity = 110/397 (27.71%), Postives = 166/397 (41.81%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKY-FTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK--AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI------NLCVDRESSEKCRKWKQQGQ-CKELSEAMNIICPKTCGFCK 1372
            F  CSA GDPHY + DG    F G C YTLT+      +   F + V+NE  GD K   T   S+ ++ +  + +   +G + VN  L  +P    D  VR ++       +     V+V++D   +  V V   Y  ++ G+CG+ N  R D+F+    R  ++     +  G+S+ V  PG  C +    + +    C        +   +CG L + + P S C   G ++   +F +C+ D+C             C        VC  AG     WRS   CPL C  N+ +   A+ C  TC      TK P       EGC C+ G+  DG  CV   +C C       N+ V  + SE C      G  C++     + IC  T G  K
Sbjct: 1205 FGTCSAAGDPHYMSLDGLAFDFQGTCTYTLTKSITSNANLVPFAVNVKNEKYGDGKVAVTKLVSLEVYGYTLILQYNTQGRILVNNVLYNLPLTLEDGKVRAYQ-HGIRTNIETDFGVKVSYDLVYHVIVTVPGNYKGQVGGLCGNFNDDRKDEFQLPDKRLTADA----TTFGSSWKVQIPGVSCDEGCGGNGNPCPACDAKKKEIFQTDNYCGFLKKKDGPLSAC--YGTINPDTYFNNCLFDVCAGAGD----GDTLCRSIQSYVAVCQAAGIAIQSWRSDSFCPLTCPANSKYKVCADVCSTTCAGVTDFTKCP---TTCSEGCECDDGFFFDGKNCVSMDNCGCFEDGRYYNVIVSNDCSEVCTCSPMGGLICEKTGCTSDEICKVTDGIVK 1587          

HSP 5 Score: 125.946 bits (315), Expect = 1.357e-27
Identity = 93/350 (26.57%), Postives = 141/350 (40.29%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDD-PCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLK-VNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHC-KKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRP------CYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +C A GDPHY ++DG    F G C YTL +   +D     F++ V+NE  G+                     G   V + V+G++ ++P    DD  +         +     ++V +D   +  V V   Y  KM G+CG+ NG + D      + V    N++   G ++ VS  G  C     D  +  +C    ++  K    CG++  P+ PF  C  K  +    +F  C  D C  + +        C+       VC   G     WR+   CPL C  N+H+      C RTC+    G   P      C+     EGC CN G++ DG  CV    C C
Sbjct: 2400 RCVAQGDPHYISFDGLTFDFQGTCTYTLAKVVDDDSRLVKFSVGVENESYGN---------------------GNVAVTRLVDGEILKLPLSLDDDSIVINQEGNNIVIQTDFGLKVLYDAVYHVVVNVPSSYRGKMGGLCGNFNGDKSDEFQLPNKQVVKNVNQF---GAAWKVSIAGAKCYDDCGDKCF--VCDPPKLQPFKGTASCGMITNPSGPFRACHSK--ISPTEYFDHCTYDSCAAEGK----DDFLCKSLQAYTAVCQTVGVAIENWRTASFCPLSCPANSHYEL----CTRTCDQTCTGISSPTKCTTRCF-----EGCECNAGFVSDGEKCVSMDKCGC 2708          

HSP 6 Score: 111.309 bits (277), Expect = 4.196e-23
Identity = 100/392 (25.51%), Postives = 167/392 (42.60%), Query Frame = 2
Query:   95 VEKEPCTNGTRNIRITTYVKD-NGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDP-CSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS--ICGKDWIRSLKAKKHCGVLLEP-NNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            V K+PC +     + T  ++D N VC P  T T             C A GDPHY T+DG    F G C Y L+++   D     F IE +N+ RG ++   Y ++V I+M+     +  G+ G +++N  ++ +P    D             V     ++V ++ +    V +S  Y     G+CG+ N   +D        ++   +K + I +     K         D    +   C      +   ++ CG++ +  N PF +C  K N D  NFF +C+ D+C+N       ++  C+  +  A  C + G +   WR+   C L C +N+H+    N CP +C +    ++  C D    E C CN G++     CV    C C
Sbjct: 1589 VNKDPCKSMKCRTKETCKIQDGNAVCVPDYTGT-------------CWAWGDPHYHTFDGYNYDFQGTCTYILSKYIGNDPGLVPFTIEEKNDNRG-SQTVAYVRTVNIYMYGYKVSIVKGEFGKVRINDVVANLPVALLDGKISVSISGANAVVKTDFGLQVTYEYNWYVVVTLSSSYYGATGGLCGNFNQNSND------EMIAADGSKVTAIVDWAKTWKVNDRDPFCWDFCRGNCPTCDDSKKSTYGGEQFCGLISKAANGPFRECHPKINPD--NFFDNCLYDVCINGGA----KQFLCQALTAYANTCRKQGAKIYDWRTPSGCVLPCPENSHYEFCGNACPASCSDRTAPSR--CTDAC-VETCQCNDGFVLSADKCVPVKSCGC 1951          
BLAST of VWFD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000905.1 (IgGFc-binding protein-like [Source:NCBI gene;Acc:100492852])

HSP 1 Score: 150.599 bits (379), Expect = 4.983e-35
Identity = 107/347 (30.84%), Postives = 170/347 (48.99%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDN--KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +CSA GDPHY TYDG   +F G C+Y L+   +++   + F + V+N+ RG     Y T     I  M  ++       VL V+G LS +P   S   + +F+S +    +  +  +RVAFD D+   V +   Y+  + G+CG+ N    DD  T  G   ++        GNS+ V+  PG      ++ +  ++   + ++  K+K  CG++L+   PF +C     +   ++FQDC+ DMC    RP     + C + +G    C EAG     WRS+  C L C  N+H++   + CP TC +    +   C D+  +EGCAC+ GY+  G  CV    C C
Sbjct:  435 QCSASGDPHYITYDGLHYNFQGTCQYKLSGLCKQNKGLTDFQVNVRNQNRGSRAVSYVTAVNLTIYSMEIQIRRDYPDQVL-VDGLLSNLPLTLSSGRISVFRSGRHC-IIQSQLGLRVAFDWDARVAVTIPSSYAGSVCGLCGNFNNQPDDDLMTLDGSITTDSIE----FGNSWKVADLPGCSGGAPENCNLTAL---EKVQR-KSKTECGMILDKKGPFRECHSI--IPPEDYFQDCIFDMCAYGKRP----DISCRLINGYTSACQEAGANIYPWRSEEFCKLPCDDNSHYNVCTSACPSTCLS--LASHTTC-DIKCQEGCACDDGYVLSGGHCVPLSDCGC 762          

HSP 2 Score: 127.872 bits (320), Expect = 3.692e-28
Identity = 108/386 (27.98%), Postives = 173/386 (44.82%), Query Frame = 2
Query:  215 KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLK--VNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGH----HCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT--KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRES-SEKCRKWKQQGQCKELSEAM 1336
            +D+  C + GDPHY T+DG+  +F G C Y L      D   + F + VQNE RG  K  +YTK+V + ++ +   L +   L+  VNG L  +P+  +S+ ++ F  R    FV     V V F+ D+ A V +  RY   + G+CG+ N   +DD     G  V +       +G+    +   +     C +   + Y            K +K+CG+L + + PF +C   G +D   +  DCV D C  K     +    C+ F+  A  C E G     WR+   CP  C  N+H+    + C  TC         ++ C      EGC C+ G+++ G  CV    C C+     RE+  +K  ++   G CK+  + +
Sbjct: 1619 EDYTTCVSSGDPHYTTFDGRKYNFMGTCIYQLAGVCSTDPTLTPFQVNVQNEARG-KKTVSYTKAVTLQVYGQNITLTRNYPLQILVNGVLKSLPFSFRSNKIKAFM-RGEHCFVRTDFDVTVNFNWDNYARVVLPSRYIGAVCGLCGNNNKDPKDDVPVADGDQVPDSFGDAWKVGDVAGCTSGCNGKCPECSETDTLKY------------KDEKYCGILSKDDGPFKEC--YGVIDPTPYLTDCVYDSCQYKG----YYSAVCDAFALYASRCQEKGVNIEPWRTPTFCP-TCPPNSHYEMCGSGCQPTCSGLITSDDCQKSC-----TEGCYCDSGFLQSGGQCVPFAECGCLY----REAYYKKGEEFYPDGDCKQFCQCL 1974          

HSP 3 Score: 110.923 bits (276), Expect = 5.151e-23
Identity = 95/356 (26.69%), Postives = 146/356 (41.01%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDD----PCSFNIEVQNEYRGD---NKYFT---YTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQF--VAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS----ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CS VGD  Y T+D Q   FYG+C Y L++    D     P   +++ Q    G     K  T   Y  +V I++  E+  L       VNG L  +P+    D+   K R   Q   V  R    +    D +  V V   Y     G+CGD N +  D       D+S   +  +   +S+  S     C  ++     +    IC  +  + LK   +CG+L++ + PF+ C   G +D + +   CV  +C             C I      +C  +G +   WR+   CPL C +N+HF    + C  +C + +  +  P       EGC C+ GY+  G  CV P  C C
Sbjct:  823 CSVVGDGSYWTFDNQKYEFYGNCSYILSKSCLPDGSKLTPYVIHLQNQEVVTGGVTKRKVLTLEAYGYNVTIYIESEITML-------VNGILQNLPF----DLESGKLRGDHQGLGVVLRADFGLVITSDFSLHVTVPGNYHNYTCGLCGDYNEIPQD-------DISPADDVVTF-ADSWKDSNSDMFCGSSELCGGENQTCPICPSNKAKILKGNNYCGILVKSDGPFAAC--HGTIDPKMYRASCVNSLCDGTGD-------LCLILQNYVAICQASGVQMNSWRTPSFCPLTCPENSHFESCVDLCTTSCSSLYDTSICP---TSCSEGCECDEGYLFQGGQCVPPKQCGC 1147          

HSP 4 Score: 109.383 bits (272), Expect = 1.495e-22
Identity = 88/355 (24.79%), Postives = 140/355 (39.44%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDP-CSFNIEVQNEYRGDNKY-FTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRC------SVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEP-NNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER------EGCACNRGYIRDGALCVKPMHCKC 1249
            C A G PHY+TYD     F G C Y LT++  +D     F IE Q E RG     F     V ++ ++     G+ G ++VN ++   P      V +   +  + F            ++V +D ++   V +   Y     G+CG+ N   DD K  S         +++    S+ V+     C  A +    + C  + I        CG+L +  N PF +C     ++   FF +C+ D+C       +   + C      AE+C   G     WR+   CP  C +N+H+      CP +C +          + P R      E C C+ G+I     CV    C C
Sbjct: 1233 CWAWGAPHYQTYDNFNYQFEGTCTYVLTEYIGQDTTLVPFRIEEQKENRGSPIISFIRQIDVFVYGYKISVAKGEYGKVRVNDEIGNTP------VTLLNGKISVTFSGSEAILNTDFGLQVTYDYNTKVMVSIPSSYYASTGGLCGNFNQDPDDEKVSSDNKPVESVTEWA---KSWKVNVNDSFCWDACE-GNCTACDDNMISQYSQDNACGLLNKTINGPFRECLSI--INPERFFSNCLYDLC----NSGQALNIHCTTLQSYAEMCRSQGVTIYDWRTSSECPFPCPENSHYEVCGTSCPASCFDR---------NAPNRCTEACVETCQCDDGFILSAGKCVPIESCGC 1562          

HSP 5 Score: 105.145 bits (261), Expect = 3.037e-21
Identity = 87/358 (24.30%), Postives = 158/358 (44.13%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL----GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKS--GRDVSNKRNKYSLIGNSYHV-----SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVL-LEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTK--RPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C A GDPHY T+D +   F G C YT+++    + D   FNIE  NE RG +   +Y  + ++ ++   Y +     + G+++VN Q  ++P   K  ++ + +S   L  V     +RV +D +    + +   +S+ + G+CG+ N +  DD  ++     D       + + G+S        + P   C  +    Y                 CG++ L+ N PF  C     VD R +  +C+ D+C+N      +Q++ C+     ++ C     +  +WR+   C ++C  N+ +    + C  TCE+    +K   PC      E C CN G++     C+   +C C+
Sbjct:   45 CWAWGDPHYHTFDSRNYDFQGTCTYTMSKTCGTDPDLPPFNIETTNENRG-SSLVSYISNALVQVYG--YNITSYRAEIGIVRVNNQRVQLPVTLKGGNLTLQQSGSLLVLVTDF-GLRVFYDWNMLFKIYLPSSFSENVCGLCGNFNNIPGDDLYSQDHVSLDPIAYGQLWKVQGSSSSTCWDDCNGPCKTCSPSDKQKYAD------------PSSCGIIALKENGPFRLC--HAAVDPRIYLDNCIYDLCLNDG----FQQILCQTLKTYSDACRRENVQVFEWRNATGCNMECLPNSAYKFCGSACSPTCEDPDAPSKCTEPCI-----ETCECNAGFVMIEGKCMPKENCGCL 375          

HSP 6 Score: 100.138 bits (248), Expect = 9.228e-20
Identity = 92/349 (26.36%), Postives = 146/349 (41.83%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNRED-DPCSFNIEVQNEYRGDNKYF--TYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRS--LKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCEN-HFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C      HY ++DG   +F G C YTLT+  R D    +F+I V+N   G++K       +SV I+++     L +  +  +     R+  E S ++ +          +   SV+V   GD          Y + + G+CGD NG   DDF+  SG+   +  +       +   S  G+ CK   D       G D +R+      + CG +L    PF++C  K  V++  +F  C+ DMC +  +     +  C         C  AG     WR+   C   C +N+H+   A  C  +C      G+    C+     EGC C+ GY+ DG  CV    C C+
Sbjct: 2009 CGVSASTHYSSFDGLSYNFQGSCSYTLTEVCRGDLRLANFSIVVEN---GNDKQSNQAVLRSVSINVYGHEIVLTKDTLWTIQVSQIRITPEGS-NILLQTDFALTVLYSTLGSVQVTVPGD----------YQEALCGLCGDFNGQSNDDFRLPSGQLADSLEDFGEAWVTNQERSDCGNVCKANCD-------GCDPLRAAIFARDEACGQILLETGPFAEC--KALVNVTEYFDHCLFDMCASDGQ----NQALCASLQAFVAACQAAGANVQPWRTSTLCSPSCPRNSHYDVCAQTCDGSCAAIDLSGSCSERCF-----EGCECDDGYMFDGKNCVPMEKCGCV 2325          
BLAST of VWFD domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000951.1 (IgGFc-binding protein-like [Source:NCBI gene;Acc:100492852])

HSP 1 Score: 150.214 bits (378), Expect = 6.447e-35
Identity = 107/347 (30.84%), Postives = 170/347 (48.99%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDN--KYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +CSA GDPHY TYDG   +F G C+Y L+   +++   + F + V+N+ RG     Y T     I  M  ++       VL V+G LS +P   S   + +F+S +    +  +  +RVAFD D+   V +   Y+  + G+CG+ N    DD  T  G   ++        GNS+ V+  PG      ++ +  ++   + ++  K+K  CG++L+   PF +C     +   ++FQDC+ DMC    RP     + C + +G    C EAG     WRS+  C L C  N+H++   + CP TC +    +   C D+  +EGCAC+ GY+  G  CV    C C
Sbjct:  365 QCSASGDPHYITYDGLHYNFQGTCQYKLSGLCKQNKGLTDFQVNVRNQNRGSRAVSYVTAVNLTIYSMEIQIRRDYPDQVL-VDGLLSNLPLTLSSGRISVFRSGRHC-IIQSQLGLRVAFDWDARVAVTIPSSYAGSVCGLCGNFNNQPDDDLMTLDGSITTDSIE----FGNSWKVADLPGCSGGAPENCNLTAL---EKVQR-KSKTECGMILDKKGPFRECHSI--IPPEDYFQDCIFDMCAYGKRP----DISCRLINGYTSACQEAGANIYPWRSEEFCKLPCDDNSHYNVCTSACPSTCLS--LASHTTC-DIKCQEGCACDDGYVLSGGHCVPLSDCGC 692          

HSP 2 Score: 127.872 bits (320), Expect = 4.013e-28
Identity = 108/386 (27.98%), Postives = 173/386 (44.82%), Query Frame = 2
Query:  215 KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS-FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLK--VNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGH----HCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT--KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRES-SEKCRKWKQQGQCKELSEAM 1336
            +D+  C + GDPHY T+DG+  +F G C Y L      D   + F + VQNE RG  K  +YTK+V + ++ +   L +   L+  VNG L  +P+  +S+ ++ F  R    FV     V V F+ D+ A V +  RY   + G+CG+ N   +DD     G  V +       +G+    +   +     C +   + Y            K +K+CG+L + + PF +C   G +D   +  DCV D C  K     +    C+ F+  A  C E G     WR+   CP  C  N+H+    + C  TC         ++ C      EGC C+ G+++ G  CV    C C+     RE+  +K  ++   G CK+  + +
Sbjct: 1548 EDYTTCVSSGDPHYTTFDGRKYNFMGTCIYQLAGVCSTDPTLTPFQVNVQNEARG-KKTVSYTKAVTLQVYGQNITLTRNYPLQILVNGVLKSLPFSFRSNKIKAFM-RGEHCFVRTDFDVTVNFNWDNYARVVLPSRYIGAVCGLCGNNNKDPKDDVPVADGDQVPDSFGDAWKVGDVAGCTSGCNGKCPECSETDTLKY------------KDEKYCGILSKDDGPFKEC--YGVIDPTPYLTDCVYDSCQYKG----YYSAVCDAFALYASRCQEKGVNIEPWRTPTFCP-TCPPNSHYEMCGSGCQPTCSGLITSDDCQKSC-----TEGCYCDSGFLQSGGQCVPFAECGCLY----REAYYKKGEEFYPDGDCKQFCQCL 1903          

HSP 3 Score: 110.538 bits (275), Expect = 6.203e-23
Identity = 95/356 (26.69%), Postives = 146/356 (41.01%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDD----PCSFNIEVQNEYRGD---NKYFT---YTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQF--VAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS----ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CS VGD  Y T+D Q   FYG+C Y L++    D     P   +++ Q    G     K  T   Y  +V I++  E+  L       VNG L  +P+    D+   K R   Q   V  R    +    D +  V V   Y     G+CGD N +  D       D+S   +  +   +S+  S     C  ++     +    IC  +  + LK   +CG+L++ + PF+ C   G +D + +   CV  +C             C I      +C  +G +   WR+   CPL C +N+HF    + C  +C + +  +  P       EGC C+ GY+  G  CV P  C C
Sbjct:  753 CSVVGDGSYWTFDNQKYEFYGNCSYILSKSCLPDGSKLTPYVIHLQNQEVVTGGVTKRKVLTLEAYGYNVTIYIESEITML-------VNGILQNLPF----DLESGKLRGDHQGLGVVLRADFGLVITSDFSLHVTVPGNYHNYTCGLCGDYNEIPQD-------DISPADDVVTF-ADSWKDSNSDMFCGSSELCGGENQTCPICPSNKAKILKGNNYCGILVKSDGPFAAC--HGTIDPKMYRASCVNSLCDGTGD-------LCLILQNYVAICQASGVQMNSWRTPSFCPLTCPENSHFESCVDLCTTSCSSLYDTSICP---TSCSEGCECDEGYLFQGGQCVPPKQCGC 1077          

HSP 4 Score: 98.9821 bits (245), Expect = 2.069e-19
Identity = 88/358 (24.58%), Postives = 140/358 (39.11%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDP-CSFNIEVQNEYRGDNKY-FTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRC------SVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEP-NNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRS---QFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER------EGCACNRGYIRDGALCVKPMHCKC 1249
            C A G PHY+TYD     F G C Y LT++  +D     F IE Q E RG     F     V ++ ++     G+ G ++VN ++   P      V +   +  + F            ++V +D ++   V +   Y     G+CG+ N   DD K  S         +++    S+ V+     C  A +    + C  + I        CG+L +  N PF +C     ++   FF +C+ D+C       +   + C      AE+C   G     WR+    F CP    +N+H+      CP +C +          + P R      E C C+ G+I     CV    C C
Sbjct: 1163 CWAWGAPHYQTYDNFNYQFEGTCTYVLTEYIGQDTTLVPFRIEEQKENRGSPIISFIRQIDVFVYGYKISVAKGEYGKVRVNDEIGNTP------VTLLNGKISVTFSGSEAILNTDFGLQVTYDYNTKVMVSIPSSYYASTGGLCGNFNQDPDDEKVSSDNKPVESVTEWA---KSWKVNVNDSFCWDACE-GNCTACDDNMISQYSQDNACGLLNKTINGPFRECLSI--INPERFFSNCLYDLC----NSGQALNIHCTTLQSYAEMCRSQGVTIYDWRTSSESFPCP----ENSHYEVCGTSCPASCFDR---------NAPNRCTEACVETCQCDDGFILSAGKCVPIESCGC 1491          

HSP 5 Score: 97.4413 bits (241), Expect = 5.250e-19
Identity = 91/348 (26.15%), Postives = 148/348 (42.53%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNRED-DPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRS--LKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCEN-HFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C      HY ++DG   +F G C YTLT+  R D    +F+I V+N   G++K     ++V+   F            +VNG+ + +P   ++  +RI      +  +    ++ V +    +  V V   Y + + G+CGD NG   DDF+  SG+   +  +       +   S  G+ CK   D       G D +R+      + CG +L    PF++C  K  V++  +F  C+ DMC +  +     +  C         C  AG     WR+   C   C +N+H+   A  C  +C      G+    C+     EGC C+ GY+ DG  CV    C C+
Sbjct: 1938 CGVSASTHYSSFDGLSYNFQGSCSYTLTEVCRGDLRLANFSIVVEN---GNDK--QSNQAVLRLCFPP----------QVNGETNALPLTLENKKIRITPEGSNI-LLQTDFALTVLYSTLGSVQVTVPGDYQEALCGLCGDFNGQSNDDFRLPSGQLADSLEDFGEAWVTNQERSDCGNVCKANCD-------GCDPLRAAIFARDEACGQILLETGPFAEC--KALVNVTEYFDHCLFDMCASDGQ----NQALCASLQAFVAACQAAGANVQPWRTSTLCSPSCPRNSHYDVCAQTCDGSCAAIDLSGSCSERCF-----EGCECDDGYMFDGKNCVPMEKCGCV 2251          

HSP 6 Score: 78.9518 bits (193), Expect = 2.405e-13
Identity = 73/325 (22.46%), Postives = 139/325 (42.77%), Query Frame = 2
Query:  326 EDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL----GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKS--GRDVSNKRNKYSLIGNSYHV-----SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVL-LEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTK--RPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            + D   FNIE  NE RG +   +Y  + ++ ++   Y +     + G+++VN Q  ++P   K  ++ + +S   L  V     +RV +D +    + +   +S+ + G+CG+ N +  DD  ++     D       + + G+S        + P   C  +    Y                 CG++ L+ N PF  C     VD R +  +C+ D+C+N      +Q++ C+     ++ C     +  +WR+   C ++C  N+ +    + C  TCE+    +K   PC      E C CN G++     C+   +C C+
Sbjct:    8 DPDLPPFNIETTNENRG-SSLVSYISNALVQVYG--YNITSYRAEIGIVRVNNQRVQLPVTLKGGNLTLQQSGSLLVLVTDF-GLRVFYDWNMLFKIYLPSSFSENVCGLCGNFNNIPGDDLYSQDHVSLDPIAYGQLWKVQGSSSSTCWDDCNGPCKTCSPSDKQKYAD------------PSSCGIIALKENGPFRLC--HAAVDPRIYLDNCIYDLCLNDG----FQQILCQTLKTYSDACRRENVQVFEWRNATGCNMECLPNSAYKFCGSACSPTCEDPDAPSKCTEPCI-----ETCECNAGFVMIEGKCMPKENCGCL 305          
BLAST of VWFD domain-containing protein vs. Ensembl Mouse
Match: 9530053A07Rik (RIKEN cDNA 9530053A07 gene [Source:MGI Symbol;Acc:MGI:2442118])

HSP 1 Score: 150.984 bits (380), Expect = 3.093e-35
Identity = 104/350 (29.71%), Postives = 166/350 (47.43%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDV-RIFKS--RKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRP--CYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C A GDPHY T+DG      G C YT+ +  + +D   +F ++ +NE+R  NK  +Y + V +H +     L  G+ G+ K++ Q S +P   S+ + R+ +S  R  L+       + V +D D    + + KR+  +++G+CG+ NG   DDF T  G+   +  N       S+ V+     C      +  S C     +  K    CG+L  P+ PF+ C +   +D + F ++CV DMCV        +   C   +  A+ C + G    +WRS+ NCPL C  N+H+   +  CP +C +      RP  C   P  EGC C  G++    LC+    C CI
Sbjct:   56 CRAQGDPHYTTFDGHRYDMMGTCTYTMAELRSSKDSLLAFKVDAKNEHRSSNK-VSYVRLVTVHAYNHTVSLIYGEVGLAKIDYQYSSLPVSLSEGLLRVHQSGTRGVLEL---DFGLVVTYDWDGQLTLSLPKRFQDQVSGLCGNYNGDPADDFLTPDGKQAPDVLN----FTKSWKVNDQDLLCDDGCYGNCPS-CIPSQAQLFKKDLFCGMLTLPSGPFADCHQF--LDPKPFLEECVYDMCVTGGE----RLTLCRGLNAYAQACVDLGISVREWRSRTNCPLTCPANSHYELCSPACPPSCNSE----ARPTNCSSRPCVEGCVCLPGFVASRGLCMPVSSCGCI 386          

HSP 2 Score: 114.39 bits (285), Expect = 3.102e-24
Identity = 91/348 (26.15%), Postives = 148/348 (42.53%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ-KGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSL----KAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C   G  HY T+DG+   F G C + L Q          F I  +N  +G NK  + TK + I +     +L Q +  +KVNG   ++P    +D V+ F+    +  +  +  + V++D   +  V+V   Y K M G+CGD N   ++DF+   G   ++       +G+S+  + PG  C           C      +L    + K+ CG++  P  P + C +   +D +   Q CV D+C+        Q + C         C  AG     WR+Q  CP++C  ++H+   A+ C   C      T   C   P  EGC C+  +++    CV    C C
Sbjct:  834 CQVSGASHYTTFDGRHFDFMGTCVHVLAQTCWTRPGLKPFTILQENAVQG-NKQVSVTKKITIEVANYTLQLEQNQWKVKVNGVDMKLPVLLDEDRVQAFRHGTDM-VIETKFGLLVSYDLKYSVRVKVPHNYYKHMCGLCGDYNDDPKNDFQKSDGSQAASSNE----LGDSWEKAVPGSSCTPRPSCKPGQACSPKCYPTLEKKYRGKEFCGLITSPTGPLAACHKL--LDPQGPLQSCVFDLCLGGGN----QSILCSSIHAYVSACQAAGGTVKPWRNQTFCPMECPPHSHYEVCADTCSLDCSA--ITTPMQCL-TPCSEGCECDTDFLQSITTCVPMEKCGC 1166          

HSP 3 Score: 110.538 bits (275), Expect = 5.068e-23
Identity = 84/350 (24.00%), Postives = 144/350 (41.14%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            +C  +GDP Y T DG    F G C Y L+   H        FN+ V NE+R  ++  +YT+S+ + ++     L       L V+G++ ++P++    + +  S   L  V     + + FDG+S   + V   Y+  + G+CG+ N    DD     G+    K   +               C + +  +    C  +  +       CG++  P  P + C     V    +F+ C++D C  +          C   +     C +A     +WR    CPLQC  ++H+    + CP +C   +   G +  C     REGC C+ G++  G  CV    C C++
Sbjct: 1650 ECQILGDPTYITLDGHRFDFQGTCEYLLSAPCHAPPTGTEYFNVTVVNEHRC-SQAVSYTRSITLRIYGLSLTLSAHWPKNLLVDGEMVKLPFQLQSRLLVHLSGMGL-VVHTSWGLSLTFDGNSFMRLRVPAAYAGTLCGLCGNYNKNPNDDLTAVGGKPEGWKVGGFP-------------DCDQCQLRTCPKPCTPEERKRFGGPNACGIITAPEGPLAPC--HSFVPPTQYFEACLLDTCQVQGHSGG----LCPAIATYVAACQDARVRLREWRKPDFCPLQCPAHSHYQLCGDSCPVSCPSLSAPVGCETIC-----REGCVCDAGFVLSGDTCVPVGQCGCLH 1973          

HSP 4 Score: 97.8265 bits (242), Expect = 3.746e-19
Identity = 88/353 (24.93%), Postives = 156/353 (44.19%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLT----QHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ--KGVLKVNGQLSRVPYEK-SDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAK--KHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C A GDPHY + D ++ +F G C Y  T    QH    D   F + ++NE RG ++  ++ +SV +       E+ +  +G + V+G L  +P++     + +F+  K+   +    S+ V+++ D++   +V   Y   + G+CG+ NG  RDD   +   +  + R+     G  + VS    H     D  +  +C  D+ + L +   ++C +    +  F  C R    +  + + +C  D C    R     K  C+  +    +C  +G     WR++  CP+ C  ++H+      CP TC +     G    CY     E C C+ GY+  G  CV    C C+
Sbjct:  448 CRASGDPHYMSLDERIFNFMGTCTYLFTASCGQHPSLPD---FKVFIENERRG-SQSVSFVRSVKLEALGIKLEVRREYQGKVLVDGILHYLPFQALGGKLVVFRQGKY-AILRTNFSLSVSYNWDTHVTAKVPSNYFNSVCGLCGNFNGDPRDDLGKQIRAEAIDPRD----FGKKWLVSS---HLGCRTDEQH--LC-PDFNKGLVSNITQNCRIFTNISGHFKHCWRVPAYN--SAYIECAYDCC----RMPGQTKPLCDTLATYTAICQSSGVIVYPWRTETLCPMTCPPHSHYELCQRGCPLTCGDQPVPGGCGSDCY-----ESCVCDEGYVLSGEACVPLASCGCV 774          

HSP 5 Score: 87.0409 bits (214), Expect = 6.816e-16
Identity = 76/342 (22.22%), Postives = 138/342 (40.35%), Query Frame = 2
Query:  251 HYRTYDGQVIHFYGDCRYTLTQ-----HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            HY T DG V   YG C Y L Q     H  E    +F+I ++ +  G+ +    T +       +V  L +   + V+ ++  +P          ++R    F+  +  +++ FDGD +  + +   +  ++ G+CG+ NG + DDF   SG    N        G ++        C +        +C  +     +    CG + +P  PF+ C +   ++   +F  CV D+C +       +   C   +     C  AG     WR+   CP +C  ++H+S   + C  +C   + F G    C+     EGC C+  ++    +C+    C C 
Sbjct: 2039 HYATPDGLVYDLYGSCSYILAQVCFPKHGEE----AFSIVLEKDLAGNPQRVVVTVA------GQVVVLAKGPQVTVDSEVVALPMVVGSIYITAENRNV--FLQTKSGLKLLFDGDDHILISIPSPFRGRLCGLCGNFNGNQSDDFVLPSGVVAPNVE----AFGAAWRAPGSSLGCGEGCGPQGCPVCSAEKRELYEENDACGKIRDPQGPFAACHKA--LNHSEYFHQCVFDLCTHHGD----RDYLCRSLAAYTAACQAAGAAVKPWRTDSICPAECPAHSHYSICTHSCQGSCAAISGFTGCTTQCF-----EGCECDDHFLLSQGVCIPAQDCGCF 2353          

HSP 6 Score: 79.7221 bits (195), Expect = 1.080e-13
Identity = 98/394 (24.87%), Postives = 165/394 (41.88%), Query Frame = 2
Query:   89 TKVEKEPCTNGTRNIRITTYVKDN-GVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLT----QHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVP-YEKSDDVRIFK--SRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLI--GNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVL-LEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVK 1231
            T V K+PC   T   + T   KD  GVC       + N ESK      C   GDPHY ++DG   +F+G C Y +          +    F++  ++E + D K  +Y + V +  +     + +K  G ++VNG    +P Y     + +    S+  L+       ++V ++      V +   Y   + G+CG+      D   ++ +   N     S+   G S+ V      C      S  + C +D +   +    CG L  +   PF+ C    +V   +FF+ CV+D+C+      + + + C+  +  A  C  AG +   WR+Q  C + C  N+H+     PCP +C      T     D P  EGC C++G++     CV 
Sbjct: 1217 TCVTKDPCQGVTCRSQETCTEKDGKGVC-------RANYESK------CWVWGDPHYHSFDGLNTNFHGTCSYLMAGTGCPGTGAEGLTPFSVITKHESQSDPK-VSYVRKVTVKTYNTSITIHEKKTGRVQVNGVFMALPVYLAGGRISVINGGSKAVLET---NFGLQVTYNWKWRVHVTLPSSYYGAVCGLCGNM-----DKNPQNDQVFPNGTMAPSIPTWGGSWQVPGWDPLCWNECQGSCPT-CPEDRVEEYRGPGFCGPLDHDTVGPFTSC--HAHVPPESFFEGCVLDVCLG----GQVKDILCQALADYAAACQAAGIKIEDWRTQAGCEITCPVNSHYELCGPPCPASCPPPARHTAPTACDGPCVEGCQCDKGFVLSADQCVP 1581          
BLAST of VWFD domain-containing protein vs. Ensembl Mouse
Match: 9530053A07Rik (RIKEN cDNA 9530053A07 gene [Source:MGI Symbol;Acc:MGI:2442118])

HSP 1 Score: 150.984 bits (380), Expect = 3.093e-35
Identity = 104/350 (29.71%), Postives = 166/350 (47.43%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDV-RIFKS--RKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRP--CYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C A GDPHY T+DG      G C YT+ +  + +D   +F ++ +NE+R  NK  +Y + V +H +     L  G+ G+ K++ Q S +P   S+ + R+ +S  R  L+       + V +D D    + + KR+  +++G+CG+ NG   DDF T  G+   +  N       S+ V+     C      +  S C     +  K    CG+L  P+ PF+ C +   +D + F ++CV DMCV        +   C   +  A+ C + G    +WRS+ NCPL C  N+H+   +  CP +C +      RP  C   P  EGC C  G++    LC+    C CI
Sbjct:   56 CRAQGDPHYTTFDGHRYDMMGTCTYTMAELRSSKDSLLAFKVDAKNEHRSSNK-VSYVRLVTVHAYNHTVSLIYGEVGLAKIDYQYSSLPVSLSEGLLRVHQSGTRGVLEL---DFGLVVTYDWDGQLTLSLPKRFQDQVSGLCGNYNGDPADDFLTPDGKQAPDVLN----FTKSWKVNDQDLLCDDGCYGNCPS-CIPSQAQLFKKDLFCGMLTLPSGPFADCHQF--LDPKPFLEECVYDMCVTGGE----RLTLCRGLNAYAQACVDLGISVREWRSRTNCPLTCPANSHYELCSPACPPSCNSE----ARPTNCSSRPCVEGCVCLPGFVASRGLCMPVSSCGCI 386          

HSP 2 Score: 114.39 bits (285), Expect = 3.102e-24
Identity = 91/348 (26.15%), Postives = 148/348 (42.53%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ-KGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSL----KAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C   G  HY T+DG+   F G C + L Q          F I  +N  +G NK  + TK + I +     +L Q +  +KVNG   ++P    +D V+ F+    +  +  +  + V++D   +  V+V   Y K M G+CGD N   ++DF+   G   ++       +G+S+  + PG  C           C      +L    + K+ CG++  P  P + C +   +D +   Q CV D+C+        Q + C         C  AG     WR+Q  CP++C  ++H+   A+ C   C      T   C   P  EGC C+  +++    CV    C C
Sbjct:  834 CQVSGASHYTTFDGRHFDFMGTCVHVLAQTCWTRPGLKPFTILQENAVQG-NKQVSVTKKITIEVANYTLQLEQNQWKVKVNGVDMKLPVLLDEDRVQAFRHGTDM-VIETKFGLLVSYDLKYSVRVKVPHNYYKHMCGLCGDYNDDPKNDFQKSDGSQAASSNE----LGDSWEKAVPGSSCTPRPSCKPGQACSPKCYPTLEKKYRGKEFCGLITSPTGPLAACHKL--LDPQGPLQSCVFDLCLGGGN----QSILCSSIHAYVSACQAAGGTVKPWRNQTFCPMECPPHSHYEVCADTCSLDCSA--ITTPMQCL-TPCSEGCECDTDFLQSITTCVPMEKCGC 1166          

HSP 3 Score: 110.538 bits (275), Expect = 5.068e-23
Identity = 84/350 (24.00%), Postives = 144/350 (41.14%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            +C  +GDP Y T DG    F G C Y L+   H        FN+ V NE+R  ++  +YT+S+ + ++     L       L V+G++ ++P++    + +  S   L  V     + + FDG+S   + V   Y+  + G+CG+ N    DD     G+    K   +               C + +  +    C  +  +       CG++  P  P + C     V    +F+ C++D C  +          C   +     C +A     +WR    CPLQC  ++H+    + CP +C   +   G +  C     REGC C+ G++  G  CV    C C++
Sbjct: 1650 ECQILGDPTYITLDGHRFDFQGTCEYLLSAPCHAPPTGTEYFNVTVVNEHRC-SQAVSYTRSITLRIYGLSLTLSAHWPKNLLVDGEMVKLPFQLQSRLLVHLSGMGL-VVHTSWGLSLTFDGNSFMRLRVPAAYAGTLCGLCGNYNKNPNDDLTAVGGKPEGWKVGGFP-------------DCDQCQLRTCPKPCTPEERKRFGGPNACGIITAPEGPLAPC--HSFVPPTQYFEACLLDTCQVQGHSGG----LCPAIATYVAACQDARVRLREWRKPDFCPLQCPAHSHYQLCGDSCPVSCPSLSAPVGCETIC-----REGCVCDAGFVLSGDTCVPVGQCGCLH 1973          

HSP 4 Score: 97.8265 bits (242), Expect = 3.746e-19
Identity = 88/353 (24.93%), Postives = 156/353 (44.19%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLT----QHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ--KGVLKVNGQLSRVPYEK-SDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAK--KHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C A GDPHY + D ++ +F G C Y  T    QH    D   F + ++NE RG ++  ++ +SV +       E+ +  +G + V+G L  +P++     + +F+  K+   +    S+ V+++ D++   +V   Y   + G+CG+ NG  RDD   +   +  + R+     G  + VS    H     D  +  +C  D+ + L +   ++C +    +  F  C R    +  + + +C  D C    R     K  C+  +    +C  +G     WR++  CP+ C  ++H+      CP TC +     G    CY     E C C+ GY+  G  CV    C C+
Sbjct:  448 CRASGDPHYMSLDERIFNFMGTCTYLFTASCGQHPSLPD---FKVFIENERRG-SQSVSFVRSVKLEALGIKLEVRREYQGKVLVDGILHYLPFQALGGKLVVFRQGKY-AILRTNFSLSVSYNWDTHVTAKVPSNYFNSVCGLCGNFNGDPRDDLGKQIRAEAIDPRD----FGKKWLVSS---HLGCRTDEQH--LC-PDFNKGLVSNITQNCRIFTNISGHFKHCWRVPAYN--SAYIECAYDCC----RMPGQTKPLCDTLATYTAICQSSGVIVYPWRTETLCPMTCPPHSHYELCQRGCPLTCGDQPVPGGCGSDCY-----ESCVCDEGYVLSGEACVPLASCGCV 774          

HSP 5 Score: 87.0409 bits (214), Expect = 6.816e-16
Identity = 76/342 (22.22%), Postives = 138/342 (40.35%), Query Frame = 2
Query:  251 HYRTYDGQVIHFYGDCRYTLTQ-----HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            HY T DG V   YG C Y L Q     H  E    +F+I ++ +  G+ +    T +       +V  L +   + V+ ++  +P          ++R    F+  +  +++ FDGD +  + +   +  ++ G+CG+ NG + DDF   SG    N        G ++        C +        +C  +     +    CG + +P  PF+ C +   ++   +F  CV D+C +       +   C   +     C  AG     WR+   CP +C  ++H+S   + C  +C   + F G    C+     EGC C+  ++    +C+    C C 
Sbjct: 2039 HYATPDGLVYDLYGSCSYILAQVCFPKHGEE----AFSIVLEKDLAGNPQRVVVTVA------GQVVVLAKGPQVTVDSEVVALPMVVGSIYITAENRNV--FLQTKSGLKLLFDGDDHILISIPSPFRGRLCGLCGNFNGNQSDDFVLPSGVVAPNVE----AFGAAWRAPGSSLGCGEGCGPQGCPVCSAEKRELYEENDACGKIRDPQGPFAACHKA--LNHSEYFHQCVFDLCTHHGD----RDYLCRSLAAYTAACQAAGAAVKPWRTDSICPAECPAHSHYSICTHSCQGSCAAISGFTGCTTQCF-----EGCECDDHFLLSQGVCIPAQDCGCF 2353          

HSP 6 Score: 79.7221 bits (195), Expect = 1.080e-13
Identity = 98/394 (24.87%), Postives = 165/394 (41.88%), Query Frame = 2
Query:   89 TKVEKEPCTNGTRNIRITTYVKDN-GVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLT----QHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVP-YEKSDDVRIFK--SRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLI--GNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVL-LEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVK 1231
            T V K+PC   T   + T   KD  GVC       + N ESK      C   GDPHY ++DG   +F+G C Y +          +    F++  ++E + D K  +Y + V +  +     + +K  G ++VNG    +P Y     + +    S+  L+       ++V ++      V +   Y   + G+CG+      D   ++ +   N     S+   G S+ V      C      S  + C +D +   +    CG L  +   PF+ C    +V   +FF+ CV+D+C+      + + + C+  +  A  C  AG +   WR+Q  C + C  N+H+     PCP +C      T     D P  EGC C++G++     CV 
Sbjct: 1217 TCVTKDPCQGVTCRSQETCTEKDGKGVC-------RANYESK------CWVWGDPHYHSFDGLNTNFHGTCSYLMAGTGCPGTGAEGLTPFSVITKHESQSDPK-VSYVRKVTVKTYNTSITIHEKKTGRVQVNGVFMALPVYLAGGRISVINGGSKAVLET---NFGLQVTYNWKWRVHVTLPSSYYGAVCGLCGNM-----DKNPQNDQVFPNGTMAPSIPTWGGSWQVPGWDPLCWNECQGSCPT-CPEDRVEEYRGPGFCGPLDHDTVGPFTSC--HAHVPPESFFEGCVLDVCLG----GQVKDILCQALADYAAACQAAGIKIEDWRTQAGCEITCPVNSHYELCGPPCPASCPPPARHTAPTACDGPCVEGCQCDKGFVLSADQCVP 1581          
BLAST of VWFD domain-containing protein vs. Ensembl Mouse
Match: Zan (zonadhesin [Source:MGI Symbol;Acc:MGI:106656])

HSP 1 Score: 138.658 bits (348), Expect = 1.903e-31
Identity = 109/362 (30.11%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  191 QVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            Q  CE   K    C   GD H+ T+D + I F G C Y LTQ         F I    E RG        K VI      V  +  +  L +  Q   +P   SDD  +  S +F++       +RV +DGD   FV VS  +S K+ G CG+ +G   +   KS   +++   +  L   S+ V +          C+K K+      C      ++   K CG L+ P+ PF  C    ++   +F  +CV DMC  +      Q+  C   S +   C +AG+    WR    CPL C KN+ +S  A PCP TC  H   T + C D    EGC C+ G+I  G+ CV    C C + 
Sbjct: 1315 QYQCEPYGKA--TCLVYGDLHFVTFDERHIGFTGTCTYILTQTCSNSTDHFFRITANTEERGVEGVSCLDKVVISLPETTVTMISGRHTL-IGDQEVTLPAILSDDTYVGLSGRFVELRT-TFGLRVRWDGDQQLFVTVSSTFSGKLCGFCGNYDGDSSNDNLKSDGMMTHDEEELRL---SWQVEEDEDKDWVSSRCQKKKNPPS---CDAALGSTMSGPKLCGQLVNPSGPFEACLL--HLKASSFLDNCVTDMCSFQG----LQQKLCAHMSAMTATCQDAGYPVKPWREPQFCPLVCPKNSRYSLCAKPCPETC--HPISTTQHCSDK-CVEGCECDPGFILSGSECVPSSQCGCTSF 1657          

HSP 2 Score: 130.183 bits (326), Expect = 5.942e-29
Identity = 121/427 (28.34%), Postives = 174/427 (40.75%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKR-------KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH----NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDC--NGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKC--RKWKQQGQCKEL---SEAMNIICPKTCGFCKA 1375
            +C P++ K Q  C  K        +    C   GDPHY T+DG + HF G C Y LTQ     ++E++   F +   NE    N   +Y K+V + +F     +  GQK VL  N Q   +P   S      +       +     ++V +DG     V V   Y+  + G+CG+   N + D+ +     D+    N   L+G ++ +   S PG      K     S C    +  +  KK C +L+ P  PFS C     V  +  F  CV   C             C      A +C++AG +   WR+   CP++C   + ++  AN CP TC      T R C  LP  EGC C  G+I  G  CV    C     C D++ S       W  +  C  L   S   NI C  T   CKA
Sbjct: 1686 LCKPWKCKAQEACSYKNGVLGCHAQGAATCMVSGDPHYLTFDGALHHFMGTCTYVLTQPCWSKSQENN---FVVSATNEIHDGNLEVSYVKAVHVQVFDLKISMFKGQKVVL--NNQRVVLPVWPSQGRVTIRLSGIFVLLYTNFGLQVRYDGRHLVEVTVPSSYTGSLCGLCGNYNNNSMDDNLRV----DMKPAGNSL-LLGAAWKILEASDPGCFLVGGKP----SRCADSDMDDVWTKK-CAILMNPLGPFSNCHEA--VPPQASFSSCVYGQCETNGD----NLTLCHSLQAYASLCAQAG-QVTTWRNSTFCPMRCPPRSSYNPCANSCPATCLT--LSTPRDCPTLPCVEGCECQSGHILSGTTCVPLRQCG----CSDQDGSYHLLGESWYTEKTCTTLCTCSAHSNITCSPT--ACKA 2082          

HSP 3 Score: 117.857 bits (294), Expect = 3.066e-25
Identity = 101/398 (25.38%), Postives = 173/398 (43.47%), Query Frame = 2
Query:  110 CTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRY----TLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRD---DFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDIS-----------YHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CT+G   I+   +V  +G    +      +C + + +  +C+  GDP+Y T+DG   HF G   Y    T+ +  R  +P    +E +N+         +  + I++ ++   +L ++ V+ VN +   VPY  ++ +R+    + L  V     + + FDG  +A + +   Y     G+CG  N  RD   +    SG   SN      + GNS+ V       +  + +              S C ++    + + + C VL++P  PF+ C +   +    F Q C++DMC    +    +++RC + SG A +C EAG     WR   +C + C  N  +     PCP +C    F T + C + P  EGCA   GYI      +   HC C
Sbjct: 4873 CTDGV--IQCQNFVCPSGSHCQYNEDGSSDCAANKLE--RCTIFGDPYYLTFDGFTYHFLGRMNYYLIKTVDKLPRGIEP--LIMEGRNKISPKGSSTLHEVTTIVYGYK--IQLQEELVVLVNDEKVAVPYNPNEHLRVMLRAQRLLLVT-DFEMVLDFDGKHSAVISLPTTYRGLTRGLCG--NYDRDQSNELMLPSGVLTSNVH----VYGNSWEVKAQHAFFRFPRALPEEEERDEEPDLLQSECSQEQTALISSTQACRVLVDPQGPFAACHQI--IAPEPFEQRCMLDMCTGW-KTKEEEELRCRVLSGYAIICQEAGANMTGWRDHTHCAMTCPANTVYQRCMTPCPASCAK--FVTPKVC-EGPCVEGCASLPGYIYSDTQSLPVTHCGC 5249          

HSP 4 Score: 58.9214 bits (141), Expect = 2.159e-7
Identity = 81/391 (20.72%), Postives = 146/391 (37.34%), Query Frame = 2
Query:  143 TYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYR--GDNKYF-TYTKSVIIHMFREVYELGQKGVLK-VNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDD-FKTKSG-------------RDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE--REGCACNRGYIRDGALCVKPMHCKC 1249
            T  K N VC   R +  + C ++  +   C    D    ++D         C Y L +  H   + P  F I  + +    G NK F  Y   + I  F    +     ++  +N  +  +P           +      V  +  ++V F+ ++   V++    + K+ G+CG+ NG  +D   T SG             +D S   N   + G +  V +      K + I +            KA+ +C   L+    ++ C+ +  V ++ F   C+   C  +       +  C+      + C   G +   WR+   CPL+C  ++H++     CP +C +     +   + +P   REGC C   Y+     CV   HC C
Sbjct: 2078 TACKANHVC--LRQEGLLRCAAEMGE---CRISEDSQIVSFDDHSHPIQDTCTYILVKVCHPNTNMP-FFMISAKTDINTNGKNKTFGVYQLYIDIFNFHITLQKDHLVLISLINDSIVTLPTTTHIPGVSVMTEDVYTIVTIKDEIQVKFESNNFLDVKIPASSNGKVCGVCGNFNGEEEDELMTPSGELAEDEQEFMNSWKDKSMDPNCQKIEGQNLQVEQQEIMNGKCRPIDFE-----------KAQANCQTALQ-GPAWAHCSSR--VPIKPFLLKCMNSFCEFR----ELFRALCDSLQSFEDACQNQGLKPPIWRNSSFCPLECPAHSHYTNCLPSCPPSCLDPDSRCEGSGHKVPATCREGCICQPDYVLLNDKCVLRSHCGC 2444          
BLAST of VWFD domain-containing protein vs. Ensembl Mouse
Match: Zan (zonadhesin [Source:MGI Symbol;Acc:MGI:106656])

HSP 1 Score: 138.658 bits (348), Expect = 1.903e-31
Identity = 109/362 (30.11%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  191 QVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            Q  CE   K    C   GD H+ T+D + I F G C Y LTQ         F I    E RG        K VI      V  +  +  L +  Q   +P   SDD  +  S +F++       +RV +DGD   FV VS  +S K+ G CG+ +G   +   KS   +++   +  L   S+ V +          C+K K+      C      ++   K CG L+ P+ PF  C    ++   +F  +CV DMC  +      Q+  C   S +   C +AG+    WR    CPL C KN+ +S  A PCP TC  H   T + C D    EGC C+ G+I  G+ CV    C C + 
Sbjct: 1315 QYQCEPYGKA--TCLVYGDLHFVTFDERHIGFTGTCTYILTQTCSNSTDHFFRITANTEERGVEGVSCLDKVVISLPETTVTMISGRHTL-IGDQEVTLPAILSDDTYVGLSGRFVELRT-TFGLRVRWDGDQQLFVTVSSTFSGKLCGFCGNYDGDSSNDNLKSDGMMTHDEEELRL---SWQVEEDEDKDWVSSRCQKKKNPPS---CDAALGSTMSGPKLCGQLVNPSGPFEACLL--HLKASSFLDNCVTDMCSFQG----LQQKLCAHMSAMTATCQDAGYPVKPWREPQFCPLVCPKNSRYSLCAKPCPETC--HPISTTQHCSDK-CVEGCECDPGFILSGSECVPSSQCGCTSF 1657          

HSP 2 Score: 130.183 bits (326), Expect = 5.942e-29
Identity = 121/427 (28.34%), Postives = 174/427 (40.75%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKR-------KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH----NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDC--NGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKC--RKWKQQGQCKEL---SEAMNIICPKTCGFCKA 1375
            +C P++ K Q  C  K        +    C   GDPHY T+DG + HF G C Y LTQ     ++E++   F +   NE    N   +Y K+V + +F     +  GQK VL  N Q   +P   S      +       +     ++V +DG     V V   Y+  + G+CG+   N + D+ +     D+    N   L+G ++ +   S PG      K     S C    +  +  KK C +L+ P  PFS C     V  +  F  CV   C             C      A +C++AG +   WR+   CP++C   + ++  AN CP TC      T R C  LP  EGC C  G+I  G  CV    C     C D++ S       W  +  C  L   S   NI C  T   CKA
Sbjct: 1686 LCKPWKCKAQEACSYKNGVLGCHAQGAATCMVSGDPHYLTFDGALHHFMGTCTYVLTQPCWSKSQENN---FVVSATNEIHDGNLEVSYVKAVHVQVFDLKISMFKGQKVVL--NNQRVVLPVWPSQGRVTIRLSGIFVLLYTNFGLQVRYDGRHLVEVTVPSSYTGSLCGLCGNYNNNSMDDNLRV----DMKPAGNSL-LLGAAWKILEASDPGCFLVGGKP----SRCADSDMDDVWTKK-CAILMNPLGPFSNCHEA--VPPQASFSSCVYGQCETNGD----NLTLCHSLQAYASLCAQAG-QVTTWRNSTFCPMRCPPRSSYNPCANSCPATCLT--LSTPRDCPTLPCVEGCECQSGHILSGTTCVPLRQCG----CSDQDGSYHLLGESWYTEKTCTTLCTCSAHSNITCSPT--ACKA 2082          

HSP 3 Score: 117.857 bits (294), Expect = 3.066e-25
Identity = 101/398 (25.38%), Postives = 173/398 (43.47%), Query Frame = 2
Query:  110 CTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRY----TLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRD---DFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDIS-----------YHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CT+G   I+   +V  +G    +      +C + + +  +C+  GDP+Y T+DG   HF G   Y    T+ +  R  +P    +E +N+         +  + I++ ++   +L ++ V+ VN +   VPY  ++ +R+    + L  V     + + FDG  +A + +   Y     G+CG  N  RD   +    SG   SN      + GNS+ V       +  + +              S C ++    + + + C VL++P  PF+ C +   +    F Q C++DMC    +    +++RC + SG A +C EAG     WR   +C + C  N  +     PCP +C    F T + C + P  EGCA   GYI      +   HC C
Sbjct: 4873 CTDGV--IQCQNFVCPSGSHCQYNEDGSSDCAANKLE--RCTIFGDPYYLTFDGFTYHFLGRMNYYLIKTVDKLPRGIEP--LIMEGRNKISPKGSSTLHEVTTIVYGYK--IQLQEELVVLVNDEKVAVPYNPNEHLRVMLRAQRLLLVT-DFEMVLDFDGKHSAVISLPTTYRGLTRGLCG--NYDRDQSNELMLPSGVLTSNVH----VYGNSWEVKAQHAFFRFPRALPEEEERDEEPDLLQSECSQEQTALISSTQACRVLVDPQGPFAACHQI--IAPEPFEQRCMLDMCTGW-KTKEEEELRCRVLSGYAIICQEAGANMTGWRDHTHCAMTCPANTVYQRCMTPCPASCAK--FVTPKVC-EGPCVEGCASLPGYIYSDTQSLPVTHCGC 5249          

HSP 4 Score: 58.9214 bits (141), Expect = 2.159e-7
Identity = 81/391 (20.72%), Postives = 146/391 (37.34%), Query Frame = 2
Query:  143 TYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYR--GDNKYF-TYTKSVIIHMFREVYELGQKGVLK-VNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDD-FKTKSG-------------RDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE--REGCACNRGYIRDGALCVKPMHCKC 1249
            T  K N VC   R +  + C ++  +   C    D    ++D         C Y L +  H   + P  F I  + +    G NK F  Y   + I  F    +     ++  +N  +  +P           +      V  +  ++V F+ ++   V++    + K+ G+CG+ NG  +D   T SG             +D S   N   + G +  V +      K + I +            KA+ +C   L+    ++ C+ +  V ++ F   C+   C  +       +  C+      + C   G +   WR+   CPL+C  ++H++     CP +C +     +   + +P   REGC C   Y+     CV   HC C
Sbjct: 2078 TACKANHVC--LRQEGLLRCAAEMGE---CRISEDSQIVSFDDHSHPIQDTCTYILVKVCHPNTNMP-FFMISAKTDINTNGKNKTFGVYQLYIDIFNFHITLQKDHLVLISLINDSIVTLPTTTHIPGVSVMTEDVYTIVTIKDEIQVKFESNNFLDVKIPASSNGKVCGVCGNFNGEEEDELMTPSGELAEDEQEFMNSWKDKSMDPNCQKIEGQNLQVEQQEIMNGKCRPIDFE-----------KAQANCQTALQ-GPAWAHCSSR--VPIKPFLLKCMNSFCEFR----ELFRALCDSLQSFEDACQNQGLKPPIWRNSSFCPLECPAHSHYTNCLPSCPPSCLDPDSRCEGSGHKVPATCREGCICQPDYVLLNDKCVLRSHCGC 2444          
BLAST of VWFD domain-containing protein vs. Ensembl Mouse
Match: Fcgbp (Fc fragment of IgG binding protein [Source:MGI Symbol;Acc:MGI:2444336])

HSP 1 Score: 128.642 bits (322), Expect = 1.544e-28
Identity = 100/346 (28.90%), Postives = 157/346 (45.38%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            C A GDPHY T+DG+     G C YT+ +    D+   +F++E +NE+RG ++  +Y   V ++ +     L  G+ G ++++ Q SR+P   S+  +R+ KS      +     + V +D D    + + KR+  ++ G+CG+ NG   DDF T    D+    +      NS+ +    + C      S  S C     +  K  + CG+L     PFS C     +D + F  DCV D+CV        +   C   S  A+ C E G     WR   +CP+ C  N+ +   +  CP +C +    T   C   P  EGC C  G++  G  CV    C CI
Sbjct:   56 CRAQGDPHYTTFDGRRYDMMGTCSYTMAELCGSDETLPAFSVEAKNEHRG-SRQVSYVGLVTVYAYSHSVSLVRGEIGFVRIDNQRSRLPASLSEGRLRVHKSGT-RGVIEMDFGLVVTYDWDGQLTLSLPKRFQDQVCGLCGNYNGDPADDFLTP---DLDQAPDALEF-ANSWKLDDGDYLCDDGCHNSCPS-CTPGQTQHYKGDRLCGMLTLSTGPFSACHE--FLDPKPFLDDCVFDLCVTGGE----RLSLCRSLSAYAQACVELGVTLENWRLPASCPMSCPANSCYDPCSPACPPSCNSEAVPTN--CSSRPCVEGCVCLPGFVASGGDCVPVSSCGCI 386          

HSP 2 Score: 120.939 bits (302), Expect = 3.261e-26
Identity = 105/372 (28.23%), Postives = 162/372 (43.55%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ-KGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKH----CGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE--REGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQC 1315
            C A GDPHY T+DG+   F G C Y L Q          F +  +NE  G+ K  + TK + + +      L Q +  +KVNG  +++P       +R+ +    +  +     +RVA+D      V +   Y K+M G+CGD NG  +DDF+   G   ++  +     GNS+  + P   C      +    C  +    L+ K H    CG+L  P  P + C +   +D +   QDCV D+C+        Q + C I       C  AG +   WR++  CP++C  ++H+   A+ C   C      T + C   PE   EGC C+ G++ +G  CV    C C +  V  E  E       Q  C
Sbjct:  836 CQASGDPHYVTFDGRRFDFMGTCVYVLAQTCGNRPGLHQFTVLQENEAWGNGK-VSVTKVITVLVANYTLRLEQSQWKVKVNGVDTKLPVMLDGGKIRVSQHGSDV-VIETDFGLRVAYDLVYYVRVTIPGNYYKQMCGLCGDYNGDPKDDFQKPDGSQTTDPSD----FGNSWEEAVPDSPCAPVPPCTGDD-CDTECSPELQDKYHGEQFCGLLTSPTGPLAACHKL--LDPQGPLQDCVFDLCLGGGN----QSILCNIIHAYVSACQAAGGQVEPWRTETFCPMECPPHSHYEVCADTCSLGCWA--LNTPQQC---PEGCAEGCECDSGFLYNGKACVPIEQCGCYHNGVYYEPEESVLIENCQQHC 1189          

HSP 3 Score: 120.168 bits (300), Expect = 5.966e-26
Identity = 96/348 (27.59%), Postives = 151/348 (43.39%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHF--FGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            +C A GDPHY T DG    F G C Y L+   H        FN+ V NE+RG ++  +YT+SV + ++     L  +    L+VNG+   +P+     + ++ S   +  V     V +AFDGDS   + V   Y+  + G+CG+ N   +D  T  G     K   + + G       PG  C + +       C  +     +    CG++  P  P + C     V    +F+ C++D C  +  P       C   +     C  AG +  +WR    CPLQC  ++H+    + CP +C +     G +  C     REGC C+ G++  G  CV    C C+
Sbjct: 1651 ECQAWGDPHYTTLDGHRFDFQGTCEYLLSAPCHEPPTGTEYFNVTVANEHRG-SQAVSYTRSVTLQIYGLSLTLSAQWPRKLQVNGEFVALPFHLDQKLSVYISGADV-VVNTASGVSLAFDGDSFVRLRVPAAYAGTLCGLCGNYNKNPNDDLTAVG----GKPEGWKVGG------APG--CDQCEPEPCPKPCTPEEQEPFRGPDACGIITAPEGPLAPC--HSLVPPTQYFEACLLDACQVQGHPGGL----CPAIATYVAACQAAGAQLGEWRKPDFCPLQCPAHSHYQLCGDSCPVSCPSLSAPVGCETIC-----REGCVCDAGFVLSGDTCVPVGQCGCL 1973          

HSP 4 Score: 115.546 bits (288), Expect = 1.398e-24
Identity = 99/361 (27.42%), Postives = 166/361 (45.98%), Query Frame = 2
Query:  218 DFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-SFNIEVQNEYRGDNKYFTYTKSV--IIHMFREVYELGQKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYH--------VSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            +F  C A GDPHY ++DG+   F G C Y L     ++    +F + V+NE+RG ++  +YT++V  + H           G + ++G L  +P++ +   +++++       V+    + V ++ D++   +V   Y+K + G+CG+ NG   DD   K G   SN  +     GNS+          ++PG  C +   +    I         + KK CG+L +P  PF +C +  N   +   +DCV D+C+   +        C+  +  A  C  AG     WRS+  CPL C  N+H+ + +  CP +C +     G    C     REGC CN G+   G  CV    C C++
Sbjct:  444 NFASCQASGDPHYVSFDGKRFDFMGTCTYLLVGSCGQNAALPAFKVLVENEHRG-SQTVSYTRAVRVVAHGVEVAVRRENPGRVLIDGVLQYLPFQAAGGKIQVYRQGND-AIVSIDFGLTVTYNWDAHVTAKVPSSYAKDVCGLCGNFNGNPDDDLALKGGGQASNVLD----FGNSWQEEIIPGCGATEPGD-CPQLDSLVTQQI---------QDKKECGILADPEGPFRECHKLLNP--QGAIRDCVYDLCLLPGQSGPL----CDALAAYAAACQAAGGTVHPWRSEELCPLTCPPNSHYEQCSYGCPLSCGDLPVQGGCGSEC-----REGCVCNEGFALSGESCVPLASCGCVH 777          

HSP 5 Score: 85.5001 bits (210), Expect = 1.881e-15
Identity = 95/410 (23.17%), Postives = 163/410 (39.76%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCE--NHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI---------NLCVDRESSEKCRKWKQQG-QCKELSEAMNIICPKTCGF--CKATAGHCEDELSA 1408
            C A G  HY T DG+V   +G C Y L    H +  D   F+I ++    GD +    T +       +V  L +   + V+G++  +P          + R  +  +     ++V FDGD++  + +   +  ++ G+CG+ NG   DDF   SG    N        G ++        C +        +C  +  ++ +    CG + +P+ PF+ C +   +    +F+ CV DMC +K      +   C   +     C  AG     WR+   CPLQC  ++H+S     C  +C   +   G    C+     EGC C+  ++    +C+    C C+         +  +  + SE+C      G  C E       +C    G   C+A  G C   + A
Sbjct: 2034 CLANGGLHYVTLDGRVYDLHGSCSYVLASVCHPKPGDE-EFSIVLEKNSAGDPQRVVVTVAG------QVVGLARGPQVTVDGEVVTLPVATGHVSVTAEGRNIV--LQTNKGMKVLFDGDAHILMSIPSSFRGRLCGLCGNFNGNWSDDFVLPSGAVAPN----VEAFGTAWRAPGSSLGCGEGCGPQGCPVCLAEETQAYEKNDACGKIRDPHGPFAACHKV--LSPLEYFRQCVYDMCAHKGD----KAYLCRSLAAYTAACQAAGAAVKPWRTDSVCPLQCPAHSHYSICTRSCQGSCAALSGLTGCTTRCF-----EGCECDDHFLLSHGVCIPAQDCGCVHNGQYMPVNSSLMSSDCSERCFCSPNNGLTCHEAGCPSGHVCEIQAGVRECQAARGLCSISVGA 2419          

HSP 6 Score: 67.0106 bits (162), Expect = 7.507e-10
Identity = 100/404 (24.75%), Postives = 163/404 (40.35%), Query Frame = 2
Query:   89 TKVEKEPCTNGTRNIRITTYVKD-NGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRY----TLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVP-YEKSDDVRIFK--SRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPG------HHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLE-PNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            T V K+PC   T   + T  V+   GVC P    T             C   GDPHY ++DG    F G C Y    TL      +    F +  +NE RG +   +Y + V +        + +   G ++VNG L  +P Y     + +    S+  L+       ++V +D +    V +   Y   + G+CG+ +    + +      ++     +   G S+ V  PG      H C+ +        C +D +   +    CG L     +PF+ C    +V   +FF+ CV+D+C+        + + C+  +  A  C  AG +   WR+Q  C + C  N+H+     PCP +C      T     D P  EGC C+ G++     CV P+   C
Sbjct: 1218 TCVTKDPCHGITCRPQETCKVQGGEGVCVPNYNST-------------CWLWGDPHYNSFDGWSFDFQGTCNYLLAGTLCPGVNAEGLTPFTVTTKNENRG-SPAVSYVRQVTVTTLNTNISIHKNEIGKVRVNGVLMALPVYLAGGRISVINGGSKAVLE---TDFGLQVTYDWNWRVDVTLPSSYHGAVCGLCGNMDKNHQNDQVFPNGTMAPSIPTW---GGSWQV--PGWDPLCWHECQGS-----CPTCPEDRVEEYEGPGFCGPLAPGTGSPFTSC--HAHVPPESFFKGCVLDVCLGGGS----KDILCQALAAYAAACQAAGIKIEDWRTQAGCEITCPDNSHYELCGPPCPASCPPPARHTAPTVCDGPCVEGCQCDEGFVLSADQCV-PLDGGC 1587          
BLAST of VWFD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28983|ZAN_PIG (Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 7.037e-32
Identity = 112/390 (28.72%), Postives = 175/390 (44.87%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKR--KDFCK------CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYF-----TYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRI-FKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYH------------SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C PF   +   CE     KDFC+      CS  GDPHYRT+DG    F G   YTL    +  D     +E      G NK +      + + +I+ ++    +L  +  L VNGQ   +PY+ ++ +++  + R+   ++     + V+F+G +NA + +   Y   + G+CG+ +   R+DF   +G    N      + GNS+ V     H + ++ I               S C  + +  +   + CGVL++P  PF+ C +   V    F + CV D+C     P   +++RC++ SG A +C E+G     WR   +C L C  N  +     PCP +C        R C D P  EGCA   GYI  GA  +   HC C N
Sbjct: 1941 CRPFTCPSGSQCEPNEDGKDFCQPNSSNLCSVFGDPHYRTFDGLSYRFQGRMTYTLV---KTLDVLPDGVEPL-VVEGRNKVYPSLTPVFLQEIIVMVYGYTVQLQAELELVVNGQKVSIPYKPNEYLQVTLRGRRL--YLVTDFELVVSFNGRNNAVIAMPSTYLGLVRGLCGNYDKNKRNDFMLPNGSFTQN----LLVFGNSWEVKAKEGHPRFSRAIREEEEKNEESGFQNVSECSPEQLELVNHTQACGVLVDPQGPFAACHQI--VAPGPFQEHCVFDLCAAPG-PKEQEELRCQVLSGYAIICQESGPTLAGWRDHTHCALPCPANTVYQSCMTPCPASCAT--LAVPRAC-DGPCVEGCASLPGYIYSGAQSLPMAHCGCTN 2314          

HSP 2 Score: 141.354 bits (355), Expect = 1.424e-31
Identity = 112/376 (29.79%), Postives = 166/376 (44.15%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS------FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C  F+  T   C+ K   +         CS  GDPHY T+DG+  +F G C Y L Q      PC       F + V+ E RG       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   FV V   +S K+ G+CGD +G  D        D S  +++  L G+S+  S+      +   +S  S C      ++   + CG L+ P+  F  C    ++   +FF+ C  DMC  +      Q + C   S L E C +AG+    WR    CPL C +N+ ++  A  CP TC + F G  R C D    EGC C+ G++  G  CV    C C++
Sbjct:  773 CQTFKCGTHTVCQLKNGQYGCHPYGSATCSVYGDPHYLTFDGRRFNFMGKCTYILAQ------PCGNLTEHFFRVLVKKEERGQEGVSCLSKVYVTLPESTVTLLKGRHTL-VGGQRVTLPAIPSRGVFLAPSGRFVE-LQTAFGLRVRWDGDQQLFVSVPSTFSGKLCGLCGDYDG--DSSNDNQKPDGSPAKDEKEL-GSSWQTSEDADQQCEENQVSPPS-CNTALQNTMSGPEFCGQLVAPHGVFEACLP--HLRASSFFKSCTFDMCNFQG----LQHMLCAHMSALTENCQDAGYTVKPWRGPQFCPLACPRNSRYTLCARLCPDTCHSEFSG--RACKDRCV-EGCECDPGFVLSGLQCVSRSECGCLD 1127          

HSP 3 Score: 136.346 bits (342), Expect = 4.637e-30
Identity = 108/355 (30.42%), Postives = 161/355 (45.35%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-------SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVP-YEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY---DLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+  GDPHY T+DG + HF G C YTLT+      PC       SF +   NE+RG N   +Y ++V + +F     L +   + ++G+   +P +     V I  S  F+  +     ++V +DGD    V V   Y+ ++ G+CG+ N    DD      R  S+       +G S+ +   S+PG   +  K        GK+   +   +K+C VL+ P  PFS+C R   V  ++ F  C+   C  K          C      A +C+ AG + + WR+   CPL+C   + +S  ANPCP TC         P Y    LP  EGC C +G+I  G  CV    C C
Sbjct: 1186 CTVSGDPHYLTFDGALHHFTGTCTYTLTK------PCWLRSLENSFLVSATNEFRGGNLEASYVRAVQVQVFNLRISLIKGRKVTLDGRRVALPLWPAQGRVSITSSGSFI-LLYTDFGLQVRYDGDHLVEVTVPSSYAGRLCGLCGNYNNNSLDDILQPDKRPASSSVR----LGASWKINELSEPGCFAEGGKP---PRCLGKEVADAW--RKNCDVLMNPQGPFSQCHRV--VAPQSSFSSCLYGQCATKGD----TLTLCRSLQAYASLCARAG-QALTWRNGTFCPLKCPSGSSYSTCANPCPATC----LSLNNPSYCPSTLPCAEGCECQKGHILSGTSCVPLSQCGC 1513          
BLAST of VWFD domain-containing protein vs. UniProt/SwissProt
Match: sp|O88799|ZAN_MOUSE (Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.264e-30
Identity = 109/362 (30.11%), Postives = 155/362 (42.82%), Query Frame = 2
Query:  191 QVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKP------GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            Q  CE   K    C   GD H+ T+D + I F G C Y LTQ         F I    E RG        K VI      V  +  +  L +  Q   +P   SDD  +  S +F++       +RV +DGD   FV VS  +S K+ G CG+ +G   +   KS   +++   +  L   S+ V +          C+K K+      C      ++   K CG L+ P+ PF  C    ++   +F  +CV DMC  +      Q+  C   S +   C +AG+    WR    CPL C KN+ +S  A PCP TC  H   T + C D    EGC C+ G+I  G+ CV    C C + 
Sbjct: 1271 QYQCEPYGKA--TCLVYGDLHFVTFDERHIGFTGTCTYILTQTCSNSTDHFFRITANTEERGVEGVSCLDKVVISLPETTVTMISGRHTL-IGDQEVTLPAILSDDTYVGLSGRFVELRT-TFGLRVRWDGDQQLFVTVSSTFSGKLCGFCGNYDGDSSNDNLKSDGMMTHDEEELRL---SWQVEEDEDKDWVSSRCQKKKNPPS---CDAALGSTMSGPKLCGQLVNPSGPFEACLL--HLKASSFLDNCVTDMCSFQG----LQQKLCARMSAMTATCQDAGYPVKPWREPQFCPLVCPKNSRYSLCAKPCPETC--HPISTTQHCSDK-CVEGCECDPGFILSGSECVPSSQCGCTSF 1613          

HSP 2 Score: 131.724 bits (330), Expect = 1.470e-28
Identity = 121/425 (28.47%), Postives = 173/425 (40.71%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKR-------KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH----NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKC--RKWKQQGQCKEL---SEAMNIICPKTCGFCKA 1375
            +C P++ K Q  C  K        +    C   GDPHY T+DG + HF G C Y LTQ     ++E++   F +   NE    N   +Y K+V + +F     +  GQK VL  N Q   +P   S      +       +     ++V +DG     V V   Y+  + G+CG+ N    D   ++  D+    N   L+G ++ +   S PG      K     S C    +  +  KK C +L+ P  PFS C     V  +  F  CV   C             C      A +C++AG +   WR+   CP++C   + ++  AN CP TC      T R C  LP  EGC C  G+I  G  CV    C     C D++ S       W  +  C  L   S   NI C  T   CKA
Sbjct: 1642 LCKPWKCKAQEACSYKNGVLGCHAQGAATCMVSGDPHYLTFDGALHHFMGTCTYVLTQPCWSKSQENN---FVVSATNEIHDGNLEVSYVKAVHVQVFDLKISMFKGQKVVL--NNQRVVLPVWPSQGRVTIRLSGIFVLLYTNFGLQVRYDGRHLVEVTVPSSYTGSLCGLCGNYNNNSMDDNLRA--DMKPAGNSL-LLGAAWKILEASDPGCFLAGGKP----SRCADSDMDDVWTKK-CAILMNPLGPFSNCHEA--VPPQASFSSCVYGQCETNGD----NLTFCHSLQAYASLCAQAG-QVTTWRNSTFCPMRCPPRSSYNPCANSCPATCLT--LSTPRDCPTLPCVEGCECQSGHILSGTTCVPLRQCG----CSDQDGSYHLLGESWYTEKTCTTLCTCSAHSNITCSPT--ACKA 2038          

HSP 3 Score: 119.013 bits (297), Expect = 1.182e-24
Identity = 101/398 (25.38%), Postives = 173/398 (43.47%), Query Frame = 2
Query:  110 CTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRY----TLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRD---DFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDIS-----------YHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CT+G   I+   +V  +G    +      +C + + +  +C+  GDP+Y T+DG   HF G   Y    T+ +  R  +P    +E +N+         +  + I++ ++   +L ++ V+ VN +   VPY  ++ +R+    + L  V     + + FDG  +A + +   Y     G+CG  N  RD   +    SG   SN      + GNS+ V       +  + +              S C ++    + + + C VL++P  PF+ C +   +    F Q C++DMC    +    +++RC + SG A +C EAG     WR   +C + C  N  +     PCP +C    F T + C + P  EGCA   GYI      +   HC C
Sbjct: 4829 CTDGV--IQCQNFVCPSGSHCQYNEDGSSDCAANKLE--RCTIFGDPYYLTFDGFTYHFLGRMNYYLIKTVDKLPRGIEP--LIMEGRNKISPKGSSTLHEVTTIVYGYK--IQLQEELVVLVNDEKVAVPYNPNEHLRVMLRAQRLLLVT-DFEMVLDFDGKHSAVISLPTTYRGLTRGLCG--NYDRDQSNELMLPSGVLTSNVH----VFGNSWEVKAQHAFFRFPRALPEDEERDEEPDLLQSECSQEQTALISSTQACRVLVDPQGPFAACHQI--IAPEPFEQRCMLDMCTGW-KTKEEEELRCRVLSGYAIICQEAGANMTGWRDHTHCAMTCPANTVYQRCMTPCPASCAK--FVTPKVC-EGPCVEGCASLPGYIYSDTQSLPVTHCGC 5205          

HSP 4 Score: 59.3066 bits (142), Expect = 1.204e-6
Identity = 81/391 (20.72%), Postives = 146/391 (37.34%), Query Frame = 2
Query:  143 TYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYR--GDNKYF-TYTKSVIIHMFREVYELGQKGVLK-VNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDD-FKTKSG-------------RDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE--REGCACNRGYIRDGALCVKPMHCKC 1249
            T  K N VC   R +  + C ++  +   C    D    ++D         C Y L +  H   + P  F I  + +    G NK F  Y   + I  F    +     ++  +N  +  +P           +      V  +  ++V F+ ++   V++    + K+ G+CG+ NG  +D   T SG             +D S   N   + G +  V +      K + I +            KA+ +C   L+    ++ C+ +  V ++ F   C+   C  +       +  C+      + C   G +   WR+   CPL+C  ++H++     CP +C +     +   + +P   REGC C   Y+     CV   HC C
Sbjct: 2034 TACKANHVC--LRQEGLLRCAAEMGE---CRISEDSQIVSFDDHSHPIQDTCTYILVKVCHPNTNMP-FFMISAKTDINTNGKNKTFGVYQLYIDIFNFHITLQKDHLVLISLINDSIVTLPTTTHIPGVSVMTEDVYTIVTIKDEIQVKFESNNFLDVKIPASSNGKVCGVCGNFNGEEEDELMTPSGELAEDEQEFMNSWKDKSMDPNCQKIEGQNLQVEQQEIMNGKCRPIDFE-----------KAQANCQTALQ-GPAWAHCSSR--VPIKPFLLKCMNSFCEFR----ELFRALCDSLQSFEDACQNQGLKPPIWRNSSFCPLECPAHSHYTNCLPSCPPSCLDPDSRCEGSGHKVPATCREGCICQPDYVLLNDKCVLRSHCGC 2400          
BLAST of VWFD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZWJ8|KCP_HUMAN (Kielin/chordin-like protein OS=Homo sapiens OX=9606 GN=KCP PE=2 SV=3)

HSP 1 Score: 137.887 bits (346), Expect = 1.493e-30
Identity = 106/364 (29.12%), Postives = 158/364 (43.41%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRI-FKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK---PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQ----FNCPLQCGKNAHFSEKANPCPRTCENHFFGTK-------RPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDR 1270
             C A GDPHYRT+DG+++HF G C Y L +     D   F++ V N+ RG +    +T+ V + +      L Q G + V+G    +P+ +   + +  +    +    P   ++V +DG S   V V   Y  +  G+CG+ NG  +DD +   G  + ++    +  GNS+ VS+   PG  C   +++      G    R   A+  CGVL   ++PFS+C     V    FF  CV D+C      S      C+     A  C +AG     WR        CPL+  +   F E   PCPRTC N             RPC       GC C  G +   A C+ P  C  + L  D+
Sbjct: 1214 SCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHSGD---FSVHVTNDDRGRSG-VAWTQEVAVLLGDMAVRLLQDGAVTVDGHPVALPFLQEPLLYVELRGHTVILHAQP--GLQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPSE----AAFGNSWQVSEGLWPGRPCSAGREVDPCRAAGYRARREANAR--CGVLK--SSPFSRC--HAVVPPEPFFAACVYDLCACGPG-SSADACLCDALEAYASHCRQAGVT-PTWRGPTLCVVGCPLE--RGFVFDECGPPCPRTCFNQHIPLGELAAHCVRPCVP-----GCQCPAGLVEHEAHCIPPEACPQVLLTGDQ 1552          
BLAST of VWFD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y493|ZAN_HUMAN (Zonadhesin OS=Homo sapiens OX=9606 GN=ZAN PE=2 SV=5)

HSP 1 Score: 137.887 bits (346), Expect = 1.719e-30
Identity = 103/344 (29.94%), Postives = 154/344 (44.77%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTK-SGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG+   F G C Y L Q         F +  +NE +G       +K  +      V  L  +  L V GQ   +P   S  V +  S +F++ +     +RV +DGD   +V VS  YS K+ G+CG+ +G  D+   K  G    +K      +GNS+   +     C+K + ++  S C      S+     CG L++ + PF  C    +V   +FF  C++DMC  +      Q + C   S +   C +AG     WR    CP+ C  N+ +S  A PCP TC + F G    C D    E C CN G++  G  C+    C C++
Sbjct: 1156 CLVYGDPHYVTFDGRHFGFMGKCTYILAQPCGNSTDPFFRVTAKNEEQGQEGVSCLSKVYVTLPESTVTLLKGRRTL-VGGQQVTLPAIPSKGVFLGASGRFVE-LQTEFGLRVRWDGDQQLYVTVSSTYSGKLCGLCGNYDGNSDNDHLKLDGSPAGDKEE----LGNSWQTDQDEDQECQKYQVVNSPS-CDSSLQSSMSGPGFCGRLVDTHGPFETCLL--HVKAASFFDSCMLDMCGFQG----LQHLLCTHMSTMTTTCQDAGHAVKPWREPHFCPMACPPNSKYSLCAKPCPDTCHSGFSGMF--CSDRCV-EACECNPGFVLSGLECIPRSQCGCLH 1483          

HSP 2 Score: 112.079 bits (279), Expect = 1.299e-22
Identity = 101/374 (27.01%), Postives = 158/374 (42.25%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDF-------CKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKD-WIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPC-YDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C P+R + Q  C  +   +         C+A GDPHY T+DG + HF G C Y LT+   +R  D   F +   NE RG     +Y K+V + +F     L +   + +NG    +P   +      +    L  +     ++V +DG     V V   Y  ++ G+CG+ N    D   +  R ++    +          S+PG      K  S       D W       K+C +L+ P  PFS+C +   V  ++ F  CV   C  K   +      C      A +C++AG +   WR++  CP++C   + +S  ++PCP TC +      R C   LP  E C C +G+I  G  CV    C C +
Sbjct: 1514 CQPWRCRAQEFCGQQDGIYGCHAQGAATCTASGDPHYLTFDGALHHFMGTCTYVLTRPCWSRSQDS-YFVVSATNENRGGILEVSYIKAVHVTVFDLSISLLRGCKVMLNGHRVALPVWLAQGRVTIRLSSNLVLLYTNFGLQVRYDGSHLVEVTVPSSYGGQLCGLCGNYNNNSLDDNLRPDRKLAGDSMQLGAAWKLPESSEPGCFLVGGKPSSCQENSMADAW------NKNCAILINPQGPFSQCHQV--VPPQSSFASCVHGQCGTKGDTT----ALCRSLQAYASLCAQAG-QAPAWRNRTFCPMRCPPGSSYSPCSSPCPDTCSS--INNPRDCPKALPCAESCECQKGHILSGTSCVPLGQCGCTD 1871          

HSP 3 Score: 64.6994 bits (156), Expect = 2.957e-8
Identity = 73/299 (24.41%), Postives = 125/299 (41.81%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIE---VQNEYRGD-NKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSK-----------PGHHCKKAKDISYH-----SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSG 1000
            C      +  NC S + +  +CS  GDP Y T+DG      G   Y L    +  D     +E   V+   + D  +   + + VI  ++    +L     L VN Q   VPY  ++ +R+    + L  V     + V+F G  NA + +   Y   ++G+CG+ +  R +D    SG    N     +  GNS+ V             P     +  ++        S C  + + S  + + C VL +P  PF+ C +   V    F + CV+D+C  ++ P   +++RC++ SG
Sbjct: 2312 CQLTSDNSNSNCVSDKSE--QCSVYGDPRYLTFDGFSYRLQGRMTYVLI---KTVDVLPEGVEPLLVEGRNKMDPPRSSIFLQEVITTVYGYKVQLQAGLELVVNNQKMAVPYRPNEHLRVTLWGQRLYLVTD-FELVVSFGGRKNAVISLPSMYEGLVSGLCGNYDKNRKNDMMLPSGALTQN----LNTFGNSWEVKTEDALLRFPRAIPAEEEGQGAELGLRTGLQVSECSPEQLAS-NSTQACRVLADPQGPFAACHQ--TVAPEPFQEHCVLDLCSAQD-PREQEELRCQVLSG 2596          
BLAST of VWFD domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y6R7|FCGBP_HUMAN (IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3)

HSP 1 Score: 131.724 bits (330), Expect = 1.471e-28
Identity = 102/353 (28.90%), Postives = 157/353 (44.48%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVR------VAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRP--CYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+DG+     G C YT+ +   EDD   +F++E +NE+RG  +  +Y   V +  +     L  G+ G + V+ Q SR+P   S+  +R+++S        PR  V       V +D D    + +  R+  ++ G+CG+ NG   DDF T  G    +         +S+ +    + C+     +  + C     +  +  + CG+L + + PF+ C     +D R F + CV D+CV        +   C   S  A+ C E G     WRS  NCPL C  N+ +      CP +C     G   P  C   P  EGC C  G++  G  CV    C C
Sbjct:  472 CRAQGDPHYTTFDGRRYDMMGTCSYTMVELCSEDDTLPAFSVEAKNEHRGSRR-VSYVGLVTVRAYSHSVSLTRGEVGFVLVDNQRSRLPVSLSEGRLRVYQS-------GPRAVVELVFGLVVTYDWDCQLALSLPARFQDQVCGLCGNYNGDPADDFLTPDGALAPDAVE----FASSWKLDDGDYLCEDGCQNNCPA-CTPGQAQHYEGDRLCGMLTKLDGPFAVC--HDTLDPRPFLEQCVYDLCVVGGE----RLSLCRGLSAYAQACLELGISVGDWRSPANCPLSCPANSRYELCGPACPTSCN----GAAAPSNCSGRPCVEGCVCLPGFVASGGACVPASSCGC 801          

HSP 2 Score: 119.398 bits (298), Expect = 7.591e-25
Identity = 100/354 (28.25%), Postives = 150/354 (42.37%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE------REGCACNRGYIRDGALCVKPMHCKCIN 1255
            +C A GDPHY T DG    F G C Y L+   H       +F + V NE+RG ++  +YT+SV + ++     L  +    L+V+G    +P++    +    S   +  V     + +AFDGDS   + V   Y+  + G+CG+ N    DD K   G+    +       G    VSKP   C         S C  +   S      CGV+   + P + C   G V    +FQ C++D C  +  P       C   +     C  AG +  +WR    CPLQC  ++H+    + CP +C         P    PE      REGC C+ G++  G  CV    C C++
Sbjct: 4473 ECQAWGDPHYVTLDGHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRG-SQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVALPFQLDSLLHAHLSGADV-VVTTTSGLSLAFDGDSFVRLRVPAAYAASLCGLCGNYNQDPADDLKAVGGKPAGWQVGGAQGCGEC--VSKP---CP--------SPCTPEQQESFGGPDACGVISATDGPLAPC--HGLVPPAQYFQGCLLDACQVQGHPGGL----CPAVATYVAACQAAGAQLGEWRRPDFCPLQCPAHSHYELCGDSCPVSC---------PSLSAPEGCESACREGCVCDAGFVLSGDTCVPVGQCGCLH 4796          

HSP 3 Score: 119.013 bits (297), Expect = 1.088e-24
Identity = 99/354 (27.97%), Postives = 150/354 (42.37%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE------REGCACNRGYIRDGALCVKPMHCKCIN 1255
            +C A GDPHY T DG   +F G C Y L+   H       +F + V NE+RG ++  +YT+SV + ++     L  +    L+V+G    +P++    +    S   +  V     + +AFDGDS   + V   Y+  + G+CG+ N    DD K   G+    +       G    VSKP   C         S C  +   S      CGV+   + P + C   G V    +FQ C++D C  +  P       C   +     C  AG +  +WR    CP QC  ++H+    + CP +C         P    PE      REGC C+ G++  G  CV    C C++
Sbjct: 2071 ECQAWGDPHYVTLDGHRFNFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRG-SQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVTLPFQLDSLLHAHLSGADV-VVTTTSGLSLAFDGDSFVRLRVPAAYAGSLCGLCGNYNQDPADDLKAVGGKPAGWQVGGAQGCGEC--VSKP---CP--------SPCTPEQQESFGGPDACGVISATDGPLAPC--HGLVPPAQYFQGCLLDACQVQGHPGGL----CPAVATYVAACQAAGAQLREWRRPDFCPFQCPAHSHYELCGDSCPGSC---------PSLSAPEGCESACREGCVCDAGFVLSGDTCVPVGQCGCLH 2394          

HSP 4 Score: 118.242 bits (295), Expect = 1.724e-24
Identity = 99/354 (27.97%), Postives = 149/354 (42.09%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE------REGCACNRGYIRDGALCVKPMHCKCIN 1255
            +C A GDPHY T DG    F G C Y L+   H       +F + V NE+RG ++  +YT+SV + ++     L  +    L+V+G    +P++    +    S   +  V     + +AFDGDS   + V   Y+  + G+CG+ N    DD K   G+    +       G    VSKP   C         S C  +   S      CGV+   + P + C   G V    +FQ C++D C  +  P       C   +     C  AG +  +WR    CP QC  ++H+    + CP +C         P    PE      REGC C+ G++  G  CV    C C++
Sbjct: 3272 ECQAWGDPHYVTLDGHRFDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHRG-SQAVSYTRSVTLQIYNHSLTLSARWPRKLQVDGVFVTLPFQLDSLLHAHLSGADV-VVTTTSGLSLAFDGDSFVRLRVPAAYAGSLCGLCGNYNQDPADDLKAVGGKPAGWQVGGAQGCGEC--VSKP---CP--------SPCTPEQQESFGGPDACGVISATDGPLAPC--HGLVPPAQYFQGCLLDACQVQGHPGGL----CPAVATYVAACQAAGAQLREWRRPDFCPFQCPAHSHYELCGDSCPGSC---------PSLSAPEGCESACREGCVCDAGFVLSGDTCVPVGQCGCLH 3595          

HSP 5 Score: 106.686 bits (265), Expect = 5.075e-21
Identity = 90/349 (25.79%), Postives = 141/349 (40.40%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKG-VLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK-------AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+DG+   F G C Y L Q             +Q      N   + T+ + + +      L Q+   + VNG   ++P   ++             +     +RVA+D      V V   Y ++M G+CG+ NG  +DDF+  +G    N        GNS+    P   C         ++D      C  +  +  + ++ CG+L  P  P S C +   VD +   +DC+ D+C+     S    + C         C  AG     WR++  CP++C  N+H+   A+ C   C          C D    EGC C+ G++ +G  CV    C C
Sbjct: 1252 CQASGDPHYTTFDGRRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENVAWGNGRVSVTRVITVQVANFTLRLEQRQWKVTVNGVDMKLPVVLANGQIRASQHGSDVVIETDFGLRVAYDLVYYVRVTVPGNYYQQMCGLCGNYNGDPKDDFQKPNGSQAGNANE----FGNSWEEVVPDSPCLPPTPCPPGSEDCIPSHKCPPELEKKYQKEEFCGLLSSPTGPLSSCHKL--VDPQGPLKDCIFDLCLGGGNLS----ILCSNIHAYVSACQAAGGHVEPWRTETFCPMECPPNSHYELCADTCSLGCSA--LSAPPQCQD-GCAEGCQCDSGFLYNGQACVPIQQCGC 1587          

HSP 6 Score: 106.301 bits (264), Expect = 7.459e-21
Identity = 94/354 (26.55%), Postives = 163/354 (46.05%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC-SFNIEVQNEYRGDNKYFTYTKSVIIHM--FREVYELGQKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDI-SYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            F  C   GDPHY ++DG+   F G C Y L     ++    +F + V+NE+RG ++  +YT++V +     +        G + V+  L  +P++ +D  V++F+  +    V     + V +D ++    +V   Y++ + G+CG+ NG   DD   + G   +N        GNS+   ++PG    +  D     S+  +     L++K  CG+L +P  PF +C  K  +D +   +DCV D C+   +        C+  +  A  C  AG     WRS+  CPL C  ++H+   +  CP +C +     G    C+     EGC C+ G+   G  C+    C C++
Sbjct:  861 FGTCQGSGDPHYVSFDGRRFDFMGTCTYLLVGSCGQNAALPAFRVLVENEHRG-SQTVSYTRAVRVEARGVKVAVRREYPGQVLVDDVLQYLPFQAADGQVQVFRQGRD-AVVRTDFGLTVTYDWNARVTAKVPSSYAEALCGLCGNFNGDPADDLALRGGGQAANAL----AFGNSWQEETRPGCGATEPGDCPKLDSLVAQ----QLQSKNECGILADPKGPFRECHSK--LDPQGAVRDCVYDRCLLPGQSGPL----CDALATYAAACQAAGATVHPWRSEELCPLSCPPHSHYEACSYGCPLSCGDLPVPGGCGSECH-----EGCVCDEGFALSGESCLPLASCGCVH 1193          

HSP 7 Score: 104.76 bits (260), Expect = 2.470e-20
Identity = 90/349 (25.79%), Postives = 140/349 (40.11%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKG-VLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS-------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+DG+   F G C Y L Q             +Q      N   + T+ + + +      L Q+   + VNG   ++P   ++             +     +RVA+D      V V   Y + M G+CG+ NG  +DDF+  +G    N        GNS+    P   C         S        C  +  +  + ++ CG+L  P  P S C +   VD +   +DC+ D+C+     S    + C         C  AG +   WR++  CP++C +N+H+   A+ C   C          C D    EGC C+ G++ +G  CV    C C
Sbjct: 2453 CQASGDPHYTTFDGRRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENVAWGNGRVSVTRVITVQVANFTLRLEQRQWKVTVNGVDMKLPVVLANGQIRASQHGSDVVIETDFGLRVAYDLVYYVRVTVPGNYYQLMCGLCGNYNGDPKDDFQKPNGSQAGNANE----FGNSWEEVVPDSPCLPPPTCPPGSEGCIPSEECPPELEKKYQKEEFCGLLSSPTGPLSSCHKL--VDPQGPLKDCIFDLCLGGGNLS----ILCSNIHAYVSACQAAGGQVEPWRNETFCPMECPQNSHYELCADTCSLGCSA--LSAPLQCPD-GCAEGCQCDSGFLYNGQACVPIQQCGC 2788          

HSP 8 Score: 104.375 bits (259), Expect = 2.920e-20
Identity = 90/349 (25.79%), Postives = 138/349 (39.54%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKG-VLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSI-------CGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+DG    F G C Y L Q             +Q      N   + T+ + + +      L Q+   + VNG   ++P   ++             +     +RVA+D      V V   Y + M G+CG+ NG  +DDF+  +G    N        GNS+    P   C         S        C  +  +  + ++ CG+L  P  P S C +   VD +   +DC+ D+C+     S    + C         C  AG     WR++  CP++C +N+H+   A+ C   C          C D    EGC C+ G++ +G  CV    C C
Sbjct: 3654 CQASGDPHYTTFDGHRFDFMGTCVYVLAQTCGTRPGLHRFAVLQENVAWGNGRVSVTRVITVQVANFTLRLEQRQWKVTVNGVDMKLPVVLANGQIRASQHGSDVVIETDFGLRVAYDLVYYVRVTVPGNYYQLMCGLCGNYNGDPKDDFQKPNGSQAGNANE----FGNSWEEVVPDSPCLPPPTCPPGSAGCIPSDKCPPELEKKYQKEEFCGLLSSPTGPLSSCHKL--VDPQGPLKDCIFDLCLGGGNLS----ILCSNIHAYVSACQAAGGHVEPWRNETFCPMECPQNSHYELCADTCSLGCSA--LSAPLQCPD-GCAEGCQCDSGFLYNGQACVPIQQCGC 3989          

HSP 9 Score: 93.5893 bits (231), Expect = 5.330e-17
Identity = 84/350 (24.00%), Postives = 145/350 (41.43%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENH------FFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +C A G  HY T DG+V   +G C Y L Q  H +  D   F+I ++    GD       + +++ +  +V  L Q   + V+G+   +P      VR+    + +     +  +R+ FDGD++  + +   +  ++ G+CG+ NG   DDF   +G   S+        G ++        C +        +C  +     ++ + CG L  P  PF+ C  +  +    +F+ CV D+C  K      +   C   +     C  AG     WR+   CPL C  ++H+S     C RTC+          G    C+     EGC C+  ++    +C+    C C
Sbjct: 4855 RCLANGGIHYITLDGRVYDLHGSCSYVLAQVCHPKPGDE-DFSIVLEKNAAGD------LQRLLVTVAGQVVSLAQGQQVTVDGEAVALPVAVGR-VRVTAEGRNMVLQTTK-GLRLLFDGDAHLLMSIPSPFRGRLCGLCGNFNGNWSDDFVLPNGSAASSVET----FGAAWRAPGSSKGCGEGCGPQGCPVCLAEETAPYESNEACGQLRNPQGPFATC--QAVLSPSEYFRQCVYDLCAQKGD----KAFLCRSLAAYTAACQAAGVAVKPWRTDSFCPLHCPAHSHYS----ICTRTCQGSCAALSGLTGCTTRCF-----EGCECDDRFLLSQGVCIPVQDCGC 5176          

HSP 10 Score: 88.5817 bits (218), Expect = 1.779e-15
Identity = 101/441 (22.90%), Postives = 171/441 (38.78%), Query Frame = 2
Query:   95 VEKEPCTNGT-RNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHN----REDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLE-PNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMH--CKC-INLCVDRESSE-----KCRKWKQQGQCKELSEAMNIIC-PKTCGF 1366
            V K+PC   T R           GVC P    T             C   GDPHY ++DG+   F G C Y L               F +  +N+ RG N   +Y + V +        + +   G ++VNG L+ +P   +D             +     ++V++D +    V +   Y   + G+CG+ +   ++ +      ++       + G S+        C      S  + C +D +   +    CG L      PF+ C    +V   +FF+ CV+D+C+        + + C+  +     C  AG     WR+Q  C + C +N+H+    +PCP +C +    T     + P  EGC C+ G++     CV P++  C C  N       SE      C +W     C+      +++C P +CG 
Sbjct: 1640 VTKDPCHGVTCRPQETCKEQGGQGVCLPNYEAT-------------CWLWGDPHYHSFDGRKFDFQGTCNYVLATTGCPGVSTQGLTPFTVTTKNQNRG-NPAVSYVRVVTVAALGTNISIHKDEIGKVRVNGVLTALPVSVADGRISVTQGASKALLVADFGLQVSYDWNWRVDVTLPSSYHGAVCGLCGNMDRNPNNDQVFPNGTLAPS---IPIWGGSWRAPGWDPLCWDECRGSCPT-CPEDRLEQYEGPGFCGPLAPGTGGPFTTC--HAHVPPESFFKGCVLDVCMGGGD----RDILCKALASYVAACQAAGVVIEDWRAQVGCEITCPENSHYEVCGSPCPASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSADRCV-PLNNGCGCWANGTYHEAGSEFWADGTCSQW-----CRCGPGGGSLVCTPASCGL 2050          

HSP 11 Score: 73.9442 bits (180), Expect = 4.930e-11
Identity = 101/441 (22.90%), Postives = 170/441 (38.55%), Query Frame = 2
Query:   95 VEKEPCTNGT-RNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHN----REDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLE-PNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMH--CKC-INLCVDRESSE-----KCRKWKQQGQCKELSEAMNIIC-PKTCGF 1366
            V K+PC   T R           GVC P    T             C   GDPHY ++DG+   F G C Y L               F +  +N+ RG N   +Y + V +        + +   G ++VNG L+ +P   +D             +     ++V++D +    V +   Y   + G+CG+ +   ++ +      ++       + G S+        C      S  + C +D +   +    CG L      PF+ C    +V   +FF+ CV+D+C+        + + C+  +     C  AG     WR+Q  C + C +N+H+     PCP +C +    T     + P  EGC C+ G++     CV P++  C C  N       SE      C +W     C+      +++C P +CG 
Sbjct: 2841 VNKDPCHGVTCRPQETCKEQGGQGVCLPNYEAT-------------CWLWGDPHYHSFDGRKFDFQGTCNYVLATTGCPGVSTQGLTPFTVTTKNQNRG-NPAVSYVRVVTVAALGTNISIHKDEIGKVRVNGVLTALPVSVADGRISVTQGASKALLVADFGLQVSYDWNWRVDVTLPSSYHGAVCGLCGNMDRNPNNDQVFPNGTLAPS---IPIWGGSWRAPGWDPLCWDECRGSCPT-CPEDRLEQYEGPGFCGPLAPGTGGPFTTC--HAHVPPESFFKGCVLDVCMGGGD----RDILCKALASYVAACQAAGVVIEDWRAQVGCEITCPENSHYEVCGPPCPASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSADRCV-PLNNGCGCWANGTYHEAGSEFWADGTCSQW-----CRCGPGGGSLVCTPASCGL 3251          

HSP 12 Score: 73.559 bits (179), Expect = 5.878e-11
Identity = 101/441 (22.90%), Postives = 170/441 (38.55%), Query Frame = 2
Query:   95 VEKEPCTNGT-RNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHN----REDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLE-PNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMH--CKC-INLCVDRESSE-----KCRKWKQQGQCKELSEAMNIIC-PKTCGF 1366
            V K+PC   T R           GVC P    T             C   GDPHY ++DG+   F G C Y L               F +  +N+ RG N   +Y + V +        + +   G ++VNG L+ +P   +D             +     ++V++D +    V +   Y   + G+CG+ +   ++ +      ++       + G S+        C      S  + C +D +   +    CG L      PF+ C    +V   +FF+ CV+D+C+        + + C+  +     C  AG     WR+Q  C + C +N+H+     PCP +C +    T     + P  EGC C+ G++     CV P++  C C  N       SE      C +W     C+      +++C P +CG 
Sbjct: 4042 VTKDPCHGVTCRPQETCKEQGGQGVCLPNYEAT-------------CWLWGDPHYHSFDGRKFDFQGTCNYVLATTGCPGVSTQGLTPFTVTTKNQNRG-NPAVSYVRVVTVAALGTNISIHKDEIGKVRVNGVLTALPVSVADGRISVAQGASKALLVADFGLQVSYDWNWRVDVTLPSSYHGAVCGLCGNMDRNPNNDQVFPNGTLAPS---IPIWGGSWRAPGWDPLCWDECRGSCPT-CPEDRLEQYEGPGFCGPLSSGTGGPFTTC--HAHVPPESFFKGCVLDVCMGGGD----RDILCKALASYVAACQAAGVVIEDWRAQVGCEITCPENSHYEVCGPPCPASCPSPAPLTTPAVCEGPCVEGCQCDAGFVLSADRCV-PLNNGCGCWANGTYHEAGSEFWADGTCSQW-----CRCGPGGGSLVCTPASCGL 4452          
BLAST of VWFD domain-containing protein vs. TrEMBL
Match: A0A1C9ZZN4 (Uncharacterized protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 602.823 bits (1553), Expect = 9.337e-175
Identity = 534/1768 (30.20%), Postives = 870/1768 (49.21%), Query Frame = 2
Query: 4628 NNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKC----------KKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATFCEISKKRWVKHVICKPPYKTKVCYPKHN--RLVIKTYFYVVXXXXXXXXXXXXXXXXXXXXXXXXXRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINRRIEVCECEKTKK-MKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCR-NNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSXXXXXXXXXXXXXXXTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPXXXXXXXXXX-XXXXXXXXISTGLCTYVIRKYSVFIRKCKCYR-KLIKVIKKERCCKKPKVSY-RCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFK--WIKTGNC----GQHKKXXXXXXXXXLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKK--GTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIG---LCYRDRNG----FAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPC-VPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRKRCV-SNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLG---KCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXX--XXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTK---KCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSK-EVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVL 9802
            NN  Y+SC  +++ Y NC+CV       +  +C        RC +NR++++ T+++   N C     +    I C R ++  T     T YK+ Y+ + NCKC++        K C  P F +KC            +  V T  +     TN KL PE  S IK   C  +++  ++ + C   Y+   C    +  ++    Y  V   C   + + K            I  S+CGP    G  Y+  T + + + ++  CK  I +   +  C  +++ +  C +G++IF TI   +A++  C+  +     SI C+N GR NKWI+ R   C  PGE+TIKY  R  +N +TC C+R++ S  +SICC+P ++   CR NN I  I   +    LKC          +IC KP   ++G+C  + IRYR VSY+ V CRCV+ V+  T    SD  KC+   SW+ +HI YK     CV +  +IT   + CS +  + D+RI+EC F RS+  K+  +C+C D   + +IL+Y+CCQK ++ K C ++ T+V   I+++LL+FKC+PV++  +  +    L  R++I+T  CTY  + Y    ++CKCYR     +   + CC    + Y RCD + G  I V   YQ  K   CI     +   INC    C     +CI+NT+TV M+C  R+ C+C +  +     CCG      W K G C     + + YY   R Y L++D    +CR+V++++ +  C C KSF + +C +N Y K  R  Y + +    C     + +V I++C +   I + +  +   GW     +I  P +C C E+    +  C C       + R YCK ++ IV +     C    + WTI  I  +IV C  V++  G    C R R      F   +RYDT VQ++   C C+ K+IK+      C  +H+ +QC+ ++I + +YSYSI  G C++ V K++  +PCP  P + KS+C++N Y +T   Y   NCRC   + R+TCDC+C K+ K  KCSRNY + E++  Y+K+ CRC +  +++Q  PSCPRFI  T G C +      YR++  R++ ++++NCKC+V       +C CRK I K   CV +N+ V++ W  ++NRR+N+CE+ +   +S    CP+  I  +C     + K+I T Y +  CKC++    ++  C C    VL + G C  +    RI+ Y ++      C+  ++   VIC C + +    C  + +V +   F L +     C +  I T   ++CS ++T  +S C ++GF+   Y+ + + NC+C++R +  + C+C+C  +   + C+     +  I  T+    C C  +       I+CPS    VS C  +R   YW +TT  T Y   + CVCV  V     IC+ +  ++  V C  ++   I      +LRNG+CV++ N   +RI CN  W + + SGC+     G +   Y +L    C+C   S+  +C C C+  P      +  ++R  Y    ++     RQLIR E      C+     +G C    N CV+ V ++    +NCRC  RR+++   C +  C Q++TK    C+    + + +   C +   G I ++ +V  K + C    TC     C   + T+   C       C C +K EV +   C C   ++K G C+  +  + + +    LV+L
Sbjct:   52 NNCYYQSCYKSFYRYQNCRCVRHIESANKCVRCVKP-KREIRCRHNREIVKITNYFIKDNRCHPVHYERVKTIECPRWKVIKTRKHGYTQYKIIYYKVENCKCIQ--------KTCQGPYFRRKCPFSKSTMKCINNNQLVFTQINREIHSTNDKLCPESGSPIKNQICIENRRTRIEPIRCPNNYEKITCIVSRDIRKVKKYYYKVVNCKCVKAVTIEKSRPCKPCDKPIIIHESSCGPFDADGIGYIETTTRYWTRNKKYICKPHIRKSKRIGCCWNSRQTVNECVNGKKIFKTIVREVASQ--CRRRISMIYESIPCYNNGRPNKWIIERIHHCSRPGEFTIKYLVRMQFNPRTCGCRRVRNSVHMSICCRPCRYRTVCRHNNKIVTISNCQRSEKLKCRNYKRETSKILICPKPVKRMIGDCKRRDIRYRIVSYKPVHCRCVQVVKEYTQNPISDVTKCIVD-SWQTTHIGYKFYRNRCVPERPKITIIPVLCSTVETYFDERINECNFTRSYFRKFVSNCRCVDRFVRKEILHYKCCQKPIITKHCVNHNTRVVVSINFKLLNFKCYPVRRELRFPVDCSHLISRKQINTNQCTYNEKYYYGVSKQCKCYRVPKFTIFNLKYCCLPIPLPYTRCDDRRGVLITVQRRYQLVKHK-CIPRISTIEKPINCDGRICETRYGKCIRNTQTVEMFCLKREGCQCAKQIITRHNVCCGPNKDSIWTKIGECKDILNEKEGYYELIRTYALRLDYRTNQCRSVVIRQHYRICDCYKSFARTSCSMNIYIKTRRVSYKMDRPNNVCHKTIDESMVPITTCYKTFTIVMDERETTPDGWCIRTSKITTPVNCGCKERTEKTRFKCPCYKRVDVVRRR-YCKNNDIIVEETLTPRCRLNNIYWTIDRIFTRIVKCSHVQVSHGPTFPCSRYRGDISTRFCTRMRYDTYVQWYVDNCNCRNKLIKQRPWCTECWPSHQHEQCLGSNINVISYSYSIVNGICRRNVDKNLVHIPCPRGPKVHKSRCKKNIYTITTTYYYYANCRCKSRVERRTCDCQCGKDSKEIKCSRNYFLNEITTKYYKRDCRCFKTVNVKQIEPSCPRFIYFTYGKCNIQNYYSIYRKLTTRRIDRNYRNCKCVVVGKSENEVCGCRKEIRKHHDCVNNNYFVIQTWERRINRRKNKCEQVITHVDSKLISCPRMRIEKVCKLNMTIGKEITTKYHLVNCKCIENKSFRRVVCPCYTKPVLEDRGVCNNKTR-RRIEVYWHKEPRGKHCVTVIENKPVICKCKRNKSMTFCNYYQIVHIRTYFNLIISIINYCQRRNIVTYNPVRCSQEITKTQSTCYRSGFQFIYYYAQTVHNCRCIRRRIRVEFCRCKCPSSRIFRKCHPSGNALINIYFTYKHIGCSCKGEIRKHFQPIQCPSRTVIVSGCNEVRCRGYWFRTTTVTNYHPRH-CVCVRNVETIKSICKIQTIKQVSVTCDRRRRLEIRKESELILRNGKCVKLTNENRKRIACNNNWVIINRSGCR---LDGTQISVYQRLHFRNCQCYPESRFTKCKCRCNS-PFVVRKCEGNVNRLYYYRYELRRCECNRQLIRVE-TKRSYCKSKLLNVGPCFEKNNHCVRNVEYQQSVLVNCRCIKRRRIIQRICHS--CCQHSTKIKNYCEKCDTKLITEVTSCWVNYYGRIIRTTQVTSKGVACDEGTTCVSQNDCDYLTSTETLKCTTKTLEKCLCVTKTEVIKKDLCMCGLPKLKFGACDLNSRKRAVYQIENKLVIL 1796          
BLAST of VWFD domain-containing protein vs. TrEMBL
Match: A0A1I8HAX6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 364.385 bits (934), Expect = 2.652e-105
Identity = 191/486 (39.30%), Postives = 280/486 (57.61%), Query Frame = 2
Query:   80 CQNTKVEKEPCTNGTRNIRITTYVKDN-GVCTPFRTKTQVNCES-KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKY---SLIGNSYHV----SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN-----LCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFC--KATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCN 1486
            C   K  ++PC  G + +    YVKD  G C   +  T V+ E   R+  C+C A+GDPH+  YDG  +HF G+C+YTLT+     DPC+F+++V+NE+RGDNK +TY + + + +F  V+ L Q   L V+G++  +PY      R+F S  ++QFVA +C    AFDG    +VEV K+Y+ +M G+CG+CNG  +DD+ T+ G +V  K++ +   +L+GNS+ V     KPG  CK    +S  S C   WI   +A+  C  L +   PF KC   G V       DC  D CVN+ +P+  ++  CE    LAE C+EAGF G++WR++  CP++C K+  ++ K  PCP++CEN FFGTK  CY+LP+REGCAC +G + DG  CV+P  C+C+      +C D  S++KCR+W+  G C      M  +C +TCG C  K     C + +S R+C   + KG C   F    C  TC 
Sbjct:  129 CPKPKTIEKPCVAGKQKVVTIYYVKDRMGNC---KKMTDVDTEVCARRKTCRCDALGDPHFLMYDGVPLHFQGECKYTLTKLRNPADPCAFDVQVKNEHRGDNKNYTYVRLLDVKIFGRVFRLHQHKRLLVDGKIVSLPYT-GPGFRVFYSGPYVQFVATKCRFSAAFDGRYTGYVEVGKQYAGRMVGLCGNCNGKQKDDYVTREGVNVIAKKDNFERDNLVGNSFRVPDDSDKPGKRCKNTPALSASSACSNAWI--PRARALCRRLSDRRGPFGKCIASGRVPSLALANDCRNDACVNRLKPAALRRAVCEAHKDLAEQCAEAGFAGLRWRTKTFCPMKCDKDKVYTTKMQPCPKSCENLFFGTKANCYNLPKREGCACKKGLVLDGRKCVRPEMCQCVKKFPELMCKDDASAKKCRRWRAAGHCASNPYTMLKMCRRTCGLCHTKKAKASCRNIMSVRRCKILKQKGQCGTSFVSTACRRTCG 608          
BLAST of VWFD domain-containing protein vs. TrEMBL
Match: A0A1I8JEH9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 4.885e-105
Identity = 191/486 (39.30%), Postives = 280/486 (57.61%), Query Frame = 2
Query:   80 CQNTKVEKEPCTNGTRNIRITTYVKDN-GVCTPFRTKTQVNCES-KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKY---SLIGNSYHV----SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN-----LCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFC--KATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCN 1486
            C   K  ++PC  G + +    YVKD  G C   +  T V+ E   R+  C+C A+GDPH+  YDG  +HF G+C+YTLT+     DPC+F+++V+NE+RGDNK +TY + + + +F  V+ L Q   L V+G++  +PY      R+F S  ++QFVA +C    AFDG    +VEV K+Y+ +M G+CG+CNG  +DD+ T+ G +V  K++ +   +L+GNS+ V     KPG  CK    +S  S C   WI   +A+  C  L +   PF KC   G V       DC  D CVN+ +P+  ++  CE    LAE C+EAGF G++WR++  CP++C K+  ++ K  PCP++CEN FFGTK  CY+LP+REGCAC +G + DG  CV+P  C+C+      +C D  S++KCR+W+  G C      M  +C +TCG C  K     C + +S R+C   + KG C   F    C  TC 
Sbjct:  129 CPKPKTIEKPCVAGKQKVVTIYYVKDRMGNC---KKMTDVDTEVCARRKTCRCDALGDPHFLMYDGVPLHFQGECKYTLTKLRNPADPCAFDVQVKNEHRGDNKNYTYVRLLDVKIFGRVFRLHQHKRLLVDGKIVSLPYT-GPGFRVFYSGPYVQFVATKCRFSAAFDGRYTGYVEVGKQYAGRMVGLCGNCNGKQKDDYVTREGVNVIAKKDNFERDNLVGNSFRVPDDSDKPGKRCKNTPALSASSACSNAWI--PRARALCRRLSDRRGPFGKCIASGRVPSLALANDCRNDACVNRLKPAALRRAVCEAHKDLAEQCAEAGFAGLRWRTKTFCPMKCDKDKVYTTKMQPCPKSCENLFFGTKANCYNLPKREGCACKKGLVLDGRKCVRPEMCQCVKKFPELMCKDDASAKKCRRWRAAGHCASNPYTMLKMCRRTCGLCHTKKAKASCRNIMSVRRCKILKRKGQCGTSFVSTACRRTCG 608          
BLAST of VWFD domain-containing protein vs. TrEMBL
Match: A0A267GW13 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022069g1 PE=4 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 8.969e-103
Identity = 180/449 (40.09%), Postives = 264/449 (58.80%), Query Frame = 2
Query:  188 TQVNCES-KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKY---SLIGNSYHV----SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN-----LCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFC--KATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCN 1486
            T V+ E   R+  C+C A+GDPH+  YDG  +HF G+C+YTLT+     DPC+F+++V+NE+RGDNK +TY + + + +F  V+ L Q   L V+G++  +PY      R+F S  ++QFVA +C    AFDG    +VEV K+Y+ +M G+CG+CNG  +DD+ T+ G +V  K++ +   +L+GNS+ V     KPG  CK    +S  S C   WI   +A+  C  L +   PF KC   G V       DC  D CVN+ +P+  ++  CE    LAE C+EAGF G++WR++  CP++C K+  ++ K  PCP++CEN FFGTK  CY+LP+REGCAC +G + DG  CV+P  C+C+      +C D  S++KCR+W+  G C      M  +C +TCG C  K     C + +S R+C   + KG C   F    C  TC 
Sbjct:    8 TDVDTEVCARRKTCRCDALGDPHFLMYDGVPLHFQGECKYTLTKLRNPADPCAFDVQVKNEHRGDNKNYTYVRLLDVKIFGRVFRLHQHKRLLVDGKIVSLPYT-GPGFRVFYSGPYVQFVATKCRFSAAFDGRYTGYVEVGKQYAGRMVGLCGNCNGKQKDDYVTREGVNVIAKKDNFERDNLVGNSFRVPDDSDKPGKRCKNTPALSASSACSNAWI--PRARALCRRLSDRRGPFGKCIASGRVPSLALANDCRNDACVNRLKPAALRRAVCEAHKDLAEQCAEAGFAGLRWRTKTFCPMKCDKDKVYTTKMQPCPKSCENLFFGTKANCYNLPKREGCACKKGLVLDGRKCVRPEMCQCVKKFPELMCKDDASAKKCRRWRAAGHCASNPYTMLKMCRRTCGLCHTKKAKASCRNIMSVRRCKILKRKGQCGTSFVSTACRRTCG 453          
BLAST of VWFD domain-containing protein vs. TrEMBL
Match: A0A267G000 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022069g2 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 2.011e-100
Identity = 191/486 (39.30%), Postives = 279/486 (57.41%), Query Frame = 2
Query:   80 CQNTKVEKEPCTNGTRNIRITTYVKDN-GVCTPFRTKTQVNCES-KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKY---SLIGNSYHV----SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN-----LCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFC--KATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCN 1486
            C   K  ++PC  G + +    YVKD  G C      T V+ E   R+  C+C A+GDPH+  YDG  +HF G+C+YTLT+     DPC+F+++V+NE+RGDNK +TY + + + +F  V+ L Q   L V+G++  +PY      R+F S  ++QFVA +C    AFDG    +VEV K+Y+ +M G+CG+CNG  +DD+ T+ G +V  K++ +   +L+GNS+ V     KPG  CK    +S  S C   WI   +A+  C  L +   PF KC   G V       DC  D CVN+ +P+  ++  CE    LAE C+EAGF G++WR++  CP++C K+  ++ K  PCP++CEN FFGTK  CY+LP+REGCAC +G + DG  CV+P  C+C+      +C D  S++KCR+W+  G C      M  +C +TCG C  K     C + +S R+C   + KG C   F    C  TC 
Sbjct: 1291 CPKPKTIEKPCVAGKQKVVTIYYVKDRMGNCKKM---TDVDTEVCARRKTCRCDALGDPHFLMYDGVPLHFQGECKYTLTKLRNPADPCAFDVQVKNEHRGDNKNYTYVRLLDVKIFGRVFRLHQHKRLLVDGKIVSLPYT-GPGFRVFYSGPYVQFVATKCRFSAAFDGRYTGYVEVGKQYAGRMVGLCGNCNGKQKDDYVTREGVNVIAKKDNFERDNLVGNSFRVPDDSDKPGKRCKNTPALSASSACSNAWI--PRARALCRRLSDRRGPFGKCIASGRVPSLALANDCRNDACVNRLKPAALRRAVCEAHKDLAEQCAEAGFAGLRWRTKTFCPMKCDKDKVYTTKMQPCPKSCENLFFGTKANCYNLPKREGCACKKGLVLDGRKCVRPEMCQCVKKFPELMCKDDASAKKCRRWRAAGHCASNPYTMLKMCRRTCGLCHTKKAKASCRNIMSVRRCKILKRKGQCGTSFVSTACRRTCG 1770          

HSP 2 Score: 80.4925 bits (197), Expect = 1.105e-10
Identity = 315/1379 (22.84%), Postives = 527/1379 (38.22%), Query Frame = 2
Query: 6860 FVRCKCPKSFTKMTCVLNRY-NKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSK--KTGWRYVVYRIIYPKHCKCVEKKHSFKEICICS---VAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRI-CACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLI-------RQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVI--ISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRI----------RKTNYWLKTTRTTRYFV----NNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXXXXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIP----YTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIM----------TCRQVT---------KCHKKSMTQKFLCRVPHK-TNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKV---------------------------KCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKC--DKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERV-GCKCEEQIHWIFSLLHCKKPTTTRK-CIENNIVSTKIYYVKER 10741
            + +C C K +T   C  N +  K + +     K  C     ++ V +   P K + K+    S+    G+R V   +   + C CV +  S +E C C    +       R+Y  +    + D R   C  KR      T S+  + C +  ++   C +         R  T V Y+   C+C ++V  R ++ CAC  N    +C+   +V     Y +K G+C     K  R+V CP K  + + KC + + IVT R   R+NC+C   ++R    C C +    R CS +      S  Y      C+  +  +     CP   +  +G C    +D  R  +   +    + C C  + VKR R+ C C K   KR++CV  H+ +E+        R  C+R  VS    P  C +    I    +   + +     LI       R C+C+KR RVKK  C C                    +  YR                            KRCE      VI    FT    +C K+   T+  +KC    +  +S CGK G++       KL +C CVK+   + R  CRC +       + + ++ +  T  + L      R+K+      KCP+E     +C  +          ++T +        R  +     NR  C+ +  K  + C C +  +T V C  +++ LI VT    L+  +C++      +  +C       SE+ C+      V  +TY K     C+C+   K +R  C C     ST CV+  I  +      +K +  +  +  +   +KC+      G  K+ R +C K    ++     Y  NC C   RK   +    C CP+  T+      +R V+      ++  G  Q+    + K+I C+S +            RQVT         KC +       LCR P   +   CRS+ +  T   + +      GK       K  TR + +LV      V                           KC++  +  K++C CP + K V    H+  + K +R  +     +C    ++     +C    +  +  C  D  R +K I+   R   +C+C +R  V LR+ C   KD+   +CI N  V +   +   + +C +         KC+             GF+ +     +   C C + V+ +++RC C    V + C+ +K +  K  TS+KL+   NRC +   +   ++SC   ++        + K    ++     + R+  C C+     +     C KP T  K C+        IYYVK+R
Sbjct:   64 YEKCGCGKDYTTEKCDDNVWIVKAVNHKMDGAKSAC-----KRSVAVRKKPIKCRGKLHRRVSRCQSDGYRVVRQLVEEARDCVCVTRVTSHRERCRCEKSRIEHECRGNRVYKHRYVQHLVDGR---CLLKR------TTSVVRIKCGENTVKSSDCVK-------GWRTKTYVNYYPYNCKCLKRVYNRQVR-CACPKNRTKTRCIRGVLVKLEKKYEMKDGQCIGHTCKITRRVHCPRKFEVKRGKCTKKQRIVTTRETRRRNCKCKSVVKRTKEVCGCPRPVHRRVCSADQVETIYSTKYKLVDGLCLAEEDEKVIPNKCPSKPLYRRGRC---GSDGSR--VDTWVHHSLRKCVCH-QRVKRLRLRCRCPKPT-KRRKCV-KHRSLEIVKVSHLLIRGVCKRS-VSFQRTPVYCLEEETPIYGRCRGARKGRSAGQRLITYVKHQTRNCRCVKRTRVKKIPCAC-------------------HLLNYR---------------------------TKRCENKKKRFVIRDYRFTEGAERCKKTVKTTNVPIKCDENRSEHKSACGKRGYQTVTLTYHKLVSCACVKKH-KKRRVICRCPKTKVELKPDPKLKWNRKCTTVYRLN-----REKNRCDKKTKCPAETKQKKMCRPVMAPLKAGPCNKETGFQTTELTIGRVVLLPPPQNRYACLVKKVKMKRRCTCPKPART-VKC--RRNVLITVTVTQKLKGQKCIKAKKVDKKATKCPKNS--ISETKCRSDNTKVVTKVTYRKR---NCKCERKVKHRRVLCRCPDPIISTRCVRHTIKERSTVSYQLKSERCRRKKQVSKKKIKCK------GGTKVTRTKCDKRCNQKVTKVTRYIRNCEC---RKKTDISSVKCCCPKSVTRVACIDDSRRVVTTTSWRLV-RGACQRKARKREKKIVCLSNLKPIRGPCKRNGYRQVTFVSYRLRKCKCVRVQRKSNELCRCPKSHSESSCRSERLV-TRRTRYRLQSTGRGK-------KVCTRHVRNLVRSPGCPVDKRVKTTKCREDDFKRITTVRRYQKNCKCRKSVKTEKRRCRCPKSSKKVS--CHSDNVIKVLRTTYTLRGNSCLKDEQTKATKVVCYEKEKPDRSPCGDDGYRQVKLISYQAR---DCKCTRRVRV-LRERCSCPKDYRARECINNNVVSTFVTYTLTSKECIRRSKITKEKPKCKSISKKSKGACRSDGFQSVFYEHEKLVNCECQKQVQTRKIRCACPKTRVKRRCVDNKVVTTK--TSFKLSG--NRCHRSRSHHRSRVSCPAKKRVV------KHKCVGNKRIYEYLEHRLRNCACKLVRQRVVKPCRCPKPKTIEKPCVAGKQKVVTIYYVKDR 1317          

HSP 3 Score: 73.559 bits (179), Expect = 1.622e-8
Identity = 158/613 (25.77%), Postives = 254/613 (41.44%), Query Frame = 2
Query: 7496 YSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKY-IVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKH---CRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKT-IEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKT--------GVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKG----------LVLVE------EGKCAKRP--VCVRIDKYRYEILVKGKCIKK-------------------LKEVKVICCCAKKQKYKRCEGHNMVTVIIS-FTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSV-SLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCK-RNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCAC 9175
            + ++ GRC+++V+ + + + C  K    KS C  N Y  V      R+ C C+   RR+    KC   + Y     +  +  V  V HK       C R  ++++    C   + +    C   ++D YR +  R+LV++ ++C C+ +    +  C C K+ IE            E  G +V   ++R  ++LV    + KR     +RI C   T        G   K    Y    CKCLKR+  ++ RC C K           LV +E      +G+C      +  R+   R   + +GKC KK                   +K  K +C C +    + C    + T+  + + L  G C+  E       KC SK   +  +CG +G ++  +    LR C C +R V   R +CRC +  KR+ C ++ R ++ + V+  L +  C R  S +   + C  E + +   C   RK     +   T        C CV R   K   C C   N +TK   + KK  +I   +FT     +C +   T    I+C+ + R + +S C  RG+  V TLTY KLV   C C +  K +R  C C
Sbjct:    5 FQLRGGRCKEKVKVTKKPIVCNKKYRPVKSSCAFNGYRRVILYNQERRGCECVK--RRRITYEKCGCGKDYTTEKCDDNVWIVKAVNHKMDGAKSACKRSVAVRKKPIKCRGKLHRRVSRC---QSDGYRVV--RQLVEEARDCVCVTRVTSHRERCRCEKSRIEH-----------ECRGNRVY--KHRYVQHLVDGRCLLKRTTS-VVRIKCGENTVKSSDCVKGWRTKTYVNYYPYNCKCLKRVYNRQVRCACPKNRTKTRCIRGVLVKLEKKYEMKDGQCIGHTCKITRRVHCPRKFEVKRGKCTKKQRIVTTRETRRRNCKCKSVVKRTKEVCGCPRPVHRRVCSADQVETIYSTKYKLVDGLCLAEEDEKVIPNKCPSKPLYRRGRCGSDGSRVDTWVHHSLRKCVCHQR-VKRLRLRCRCPKPTKRRKC-VKHRSLEIVKVSHLLIRGVCKRSVSFQRTPVYCLEEETPIYGRCRGARKGRSAGQRLITYVKHQTRNCRCVKRTRVKKIPCACHLLNYRTKRCENKKKRFVIRDYRFTEGAE-RCKKTVKTTNVPIKCD-ENRSEHKSACGKRGYQTV-TLTYHKLVS--CACVKKHKKRRVICRC 589          

HSP 4 Score: 67.3958 bits (163), Expect = 1.037e-6
Identity = 91/366 (24.86%), Postives = 162/366 (44.26%), Query Frame = 2
Query: 9866 PNPKDVVKCI-HNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNV-SVVSKYRFVFKNGKCHKFVNRINHIIKCRRS-HVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNER---RNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVST--KIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSC 10939
            P+P    +C+ H  K R TV +   KS++ C   ++   +   C+   +  + KCDK RC +++T + R + NC+CRK+ D+   KCCC  K   +V CI +   VV+   +    G C +   +    I C  +    RG C  R G+R +    YR  KC+C+R  +     C C  +     C  ++ + R+  T Y+L      +  C + +RN  R   C  +++ +    T + +   F++ TT  + +  CKC + +        C K +    C  +N++      Y ++  S +K+   K     KV+   ++   RS        D ++      ++   C+C    +V R +CSC
Sbjct:  775 PDPIISTRCVRHTIKERSTVSYQL-KSER-CRRKKQVSKKKIKCKGGTKVTRTKCDK-RCNQKVTKVTRYIRNCECRKKTDISSVKCCCP-KSVTRVACIDDSRRVVTTTSWRLVRGACQRKARKREKKIVCLSNLKPIRGPCK-RNGYRQVTFVSYRLRKCKCVRVQRKSNELCRCPKSHSESSCRSERLVTRR--TRYRLQSTGRGKKVCTRHVRNLVRSPGCPVDKRVK----TTKCREDDFKRITTVRRYQKNCKCRKSVKTEKRRCRCPKSSKKVSCHSDNVIKVLRTTYTLRGNSCLKDEQTKAT---KVVCYEKEKPDRSPCGD----DGYRQVKLISYQARDCKCTRRVRVLRERCSC 1122          

HSP 5 Score: 64.3142 bits (155), Expect = 9.678e-6
Identity = 135/577 (23.40%), Postives = 241/577 (41.77%), Query Frame = 2
Query: 7358 TKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSI-VIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKY-IVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKS-----IQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRK---LVKDFKNCKCLVKEVKR-------KRICACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKG-----KCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSL-CIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQ 9019
            TKV  + + C C++K     +K C C  +     C+ +S  V+   S+ + RG CQ++ RK  +K+ C +     +  C+RN Y  VT  +Y  + C+C V ++RK+                             + CRC +  S      ++ V    R+ +++ G      T   R ++R     + K  K  KC   + KR       ++ C CRK+++  KR                    RC            RCPK + ++ C+    V K + TTY +R   CLK  + K ++      +V  E+ K  + P     D YR   L+       KC ++++ ++  C C K  + + C  +N+V+  +++TL   +C++    T    KC S     +  C  +GF+   Y  EKL NC+C K  V   + +C C +   ++ C   K  + T   +F L   +C R +S     + CP++   V   C+  ++   +L+      + + N C C     +  K CRC + +  +  C A K  ++ +  +   R G C ++ +   +
Sbjct:  836 TKVTRYIRNCECRKKTDISSVK-CCCPKSVTRVACIDDSRRVVTTTSWRLVRGACQRKARKREKKIVCLSNLKPIRGPCKRNGYRQVTFVSYRLRKCKC-VRVQRKS----------------------------NELCRCPKSHSESSCRSERLVTRRTRYRLQSTGRGKKVCTRHVRNLVRSPGCPVDKRVKTTKCREDDFKRITTVRRYQKNCKCRKSVKTEKR--------------------RC------------RCPKSSKKVSCH-SDNVIKVLRTTYTLRGNSCLKDEQTKATK------VVCYEKEKPDRSPC--GDDGYRQVKLISYQARDCKCTRRVRVLRERCSCPKDYRARECINNNVVSTFVTYTLTSKECIRRSKITKEKPKCKSISKKSKGACRSDGFQSVFYEHEKLVNCECQK-QVQTRKIRCACPKTRVKRRCVDNK--VVTTKTSFKLSGNRCHRSRSHHRSRVSCPAKKRVVKHKCVGNKRIYEYLE------HRLRN-CACKLVRQRVVKPCRCPKPKTIEKPCVAGKQKVVTIY-YVKDRMGNCKKMTDVDTE 1330          
BLAST of VWFD domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000053976.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001842.1:579:10825:-1 gene:ENSAMXG00000043233.1 transcript:ENSAMXT00000053976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 1.652e-35
Identity = 98/347 (28.24%), Postives = 165/347 (47.55%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNK---RNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+  GDPHY T+D Q+ HF G C Y L++   +  P  + IE +NE+RG  +  ++T+ V + ++ E  EL    +   KVNG  +  P+  ++  +++++S  F   ++    + V +D  S   + V   Y     G+CG+ N    DDF+T SG  +S+     N ++  G++     PG  C+        + C +          +CG+L +P  PFS C  +  +  + F ++C+ D+CV       +Q + C+  +  +  C + G +   WR Q  C + C +N+HF      CP TC N       P   LP +E C C+ GY+     CV   +C C
Sbjct:  123 CTISGDPHYYTFDNQIFHFQGTCTYVLSEACGDGLP-YYRIEGKNEHRGSTR-VSWTRLVRVFVYDEELELVKDHQYEAKVNGSFASTPFSLRNGSIQVYQS-GFSVAISTDFGLVVTYDAYSYVTISVPFDYQNATCGLCGNFNHHPEDDFRTPSGEVLSSDTDFANSWTATGDT----DPG--CQNTCSGLTCAACTEAQRSLYSNPDYCGILGDPAGPFSSCHSR--LSPQTFMENCIYDLCVGGG----YQPILCQALNVYSAQCQQQGVQLGLWRRQGFCEISCPRNSHFESSGTSCPATCSNPTAPVNCP---LPNQESCICDAGYVLSAGECVSQANCGC 451          

HSP 2 Score: 122.094 bits (305), Expect = 1.026e-26
Identity = 94/349 (26.93%), Postives = 142/349 (40.69%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNE-YRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIR---SLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            CSA GDPHY ++DG+   F G CRY L+    + +D P  F +  +NE + G     T   SV +     +    ++G+  ++ +   +P           S     F+     + V++DG     V V   YS    G+CG+ NG   DDF+ +SG  VS+              S+ G   K   D S    CG    R    + A+  C +L +   P S C     VD   +F DC  D+C+++ +      V C         C  A    + WR    C + C  N+H+      C  TC +      +  C      EGC CN G++R G  C+    C C+
Sbjct:  896 CSASGDPHYTSFDGRNFDFQGTCRYILSTVCSDNQDLP-FFQVVAKNEAWNGLPVSITVEVSVNVSGHLVLVSRNKRGIAVIDSETKNLPVLLDSGSVSVYSSGQNTFITTDFGLSVSYDGSWVVRVTVPANYSGATCGLCGNFNGQTNDDFRIRSGELVSS-------------ASQFGADWKVGNDTSCDDECGDSCARCQNPVSARSQCEILRDRQGPVSFC--HSYVDPEAYFNDCAFDLCLSEYQ----HDVLCRSIQTYVSACQSANAPVLPWRQNTTCRMDCPMNSHYELCGTDCEHTCASSIDSVCEHAC-----SEGCFCNEGFVRSGGFCIPVEQCGCL 1219          

HSP 3 Score: 112.464 bits (280), Expect = 8.679e-24
Identity = 94/405 (23.21%), Postives = 166/405 (40.99%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE------REGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSAR 1411
            +  C   G   Y TYDG +  + G C  TL++        +F + +Q +  G    F+   +      +   ++ + G   V+GQ   +P+   S  + I+ S      +     V V  D      +     Y+  + G+CG+ N  + D+F +  G  +++ R      G+S+       HC+++ DI         +  S + + HC +L  P+ PF++C    ++D     +DC+  +     +    ++  CE   G A +C + G    +WR+  +C   C  N+H+      CP  C         P    P       +EGC C+ G +  G  CV P+ C C++    R+  E  R W  + QC+ L      IC  T GF +     C ++ + R
Sbjct:  508 YSTCWVEGPGFYHTYDGLMFSYPGACELTLSRVMGLSPLPNFAVTIQKQPSGPQG-FSRVLTFEAEGTQVSMKMEEGGTATVDGQEVALPFSVGSGRIHIYHSSVKGIIMETTFGVTVRADWPHLIRITAPSTYNGTLGGLCGNFNEYLEDEFLSPDGVLLNDSRT----FGDSWRDGSLSAHCEESTDIWQKGY----YQDSNQFRMHCSILSSPSGPFAQC--HSSLDPSAKVEDCISSL----QQTEGAKEALCEALRGYAVLCQQNGIVLQEWRNITDCEFPCPTNSHYELCGTSCPAAC---------PSLSFPYLCTQHCQEGCQCDDGLLLSGDHCVPPIGCGCLHEGRYRQGGE--RFWHGE-QCQSL-----CICDGTTGFVRCNPSSCSEQETCR 880          

HSP 4 Score: 81.6481 bits (200), Expect = 2.154e-14
Identity = 85/345 (24.64%), Postives = 140/345 (40.58%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQF--------VAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCP-------LQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYI 1207
             C   GDPHY T+DG V  F G C Y +++   N  D+   F +   N +R +NK  ++   V I + +     GQ+  + + GQ  RV  + +D D   F+  +  +F        V     + V FDG     V + + +   + G+CG+ NG   D K      ++   +++   GNS+        C  A D  Y      D   + +  + C ++   + PF  C    +V+   +F+ CV D+CV  +       + C         C+  G E  +WRS   C        L+C  +    EK N     C  +    K+  YD   +E C  + G +
Sbjct: 1276 SCMVWGDPHYLTFDGAVTTFQGTCSYEISKTCGNLLDNGLEFLVVATNMHR-ENKDVSFASVVDIWLSKG----GQRSQITI-GQNKRVKVDGTDIDSSAFEIGQLAEFHQENDFVVVNASSELMVYFDGRFTLLVRLDESFHGSVCGMCGNNNGDAADDKAMPSGALAPSDDEF---GNSWRSEISTQGC-GAIDQRYDV---NDCPFTQEYSEVCSIITNTSGPFQHC--HFHVNPMVYFRSCVYDLCVYTSA----NGMLCSALEAYEVACTTMGLEISEWRSDLGCSYTDPCAELECTADEWCGEKDNIYGCFCNENHPRPKKESYD--SKEECESSSGTM 1599          
BLAST of VWFD domain-containing protein vs. Ensembl Cavefish
Match: zanl (zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-2])

HSP 1 Score: 147.517 bits (371), Expect = 1.973e-34
Identity = 104/344 (30.23%), Postives = 159/344 (46.22%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK-AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            CS  GDPHY ++D +V HF G C YTLT+  N  D    F +E +NE+R +N   +Y KSVI+++F     L +   ++VNG    VP    +DV+IF S KF+  +     +R  FDG+  A + +   Y   + G+CG+ N    D    S    ++  N+   +G S+ V      C     DI     C K+     +    CG++ +    F +C +  + D   +F+ CV D C             C+     A +C++AG   I WR+   CPL+C   +H+      C  +C++   G    C + P  EGC C+ G I  G  CV    C C +
Sbjct:  319 CSVCGDPHYTSFDNKVHHFMGACSYTLTKPCNDTDGLPYFTVETENEHRSNNNKVSYVKSVIVNVFGMKIILDKGRKVQVNGVQVTVPVTLLNDVKIFLSGKFV-VLETNFGLRARFDGNHYADISLPSPYKGLLCGMCGNFNDNPADDNIMSNGKPTDSTNE---LGESWQVPDDRPDCSHGGGDIE----CDKNIENEAQKPTSCGMITDITGIFKECHKFVSPD--PYFESCVFDQCGTDGS----AVALCQAIESYATLCAQAGVP-INWRNNTFCPLKCPAGSHYEHCGTACSPSCQDP--GAAGTCTE-PCVEGCVCDTGLILSGDKCVPFSECGCTD 644          

HSP 2 Score: 131.724 bits (330), Expect = 1.384e-29
Identity = 92/369 (24.93%), Postives = 152/369 (41.19%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS------------------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            + + F KC+  GDPHYRT+D    H+ G   Y L + HN   +   F +  +N  +G N   +Y   V + ++     + Q  VL V+G+    P      +RI  + ++LQ V+    + V FDG+    + +   Y   + G+CG+ +G  ++   K    ++    ++   G+S+ V+       +  D+   +                   C    +  L  +  CG L  P+ PF+ C      D   + +DCV D+C  ++       +RCE ++  A  C E G     WR Q  C L C  N+ ++     CP +C +        C      EGC C  G+     LCV    C C  L
Sbjct: 1084 RPESFGKCAISGDPHYRTFDTFNHHYQGAYTYILARDHNLPSNLTPFKVRGKNARKGGNNRISYLHEVYVDVYDINVRILQAKVLLVDGERVFPPLSPKQGIRIAMNSRYLQ-VSTDFGLTVRFDGNMQGEILLPSPYKSFVGGLCGNFDGRTNNEYMKPDGTIARLLGEF---GDSWRVTDRQAEGLQVSDLPKLTRLHRREVEEDLDSGFETEGCSAAQLAELNGENQCGALSNPDGPFAACHSVIQPD--TYKEDCVFDLCAEQDS----STLRCENYAVYALACQEQGIVLGPWRQQLGCALTCSANSSYTTCMTTCPASCAD--LAAPSECEQTTCVEGCQCAPGFAMSDTLCVPFSQCGCTYL 1440          

HSP 3 Score: 116.316 bits (290), Expect = 6.549e-25
Identity = 98/350 (28.00%), Postives = 155/350 (44.29%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPER---EGCACNRGYIRDGALCVKPMHCKCI 1252
            C   GDPHY T+DG +  + G C YTL     E     F I  +NE RG  +  +Y +SV +++   V  L +   + ++GQ  R P +  + + ++F S      ++    + V FDG  +  + V   Y  K+ G+CG+ NG   DD    +G    +       +G+S+     S PG  C+       H  C  +   ++ A+    +L   ++ F  C     +    F  +C+ DMC      +  Q   C+     A+ C  AG   I WR+   CPL C  N+H+S+   PCP TC + F     P +  LP     EGC C+ G++     CV   +C C+
Sbjct:  704 CHIAGDPHYYTFDGVMHTYMGTCTYTLVAICDESMVTPFTIVAKNEERGLPEA-SYVRSVTVYLPGAVITLSKSKRVLLDGQRIRTPMDILAANAQVFTS-GVNTVLSTDFGLIVQFDGVHHVEITVPGDYFNKVCGMCGNYNGNSSDDNLMPNGNPAKDDIE----LGDSWKAEGDSDPG--CQPDLRPDVHPNCTAEEEEAIAAQCSSIIL---SDRFKPCHSL--IPPEPFLGNCIYDMC----EYNGMQSTLCDNVEAYAQACQSAGVT-ISWRNTTFCPLPCPPNSHYSDCTPPCPPTCADLF-----PIFCPLPPNGCVEGCQCDSGFVLSDGKCVPLSNCGCV 1030          

HSP 4 Score: 92.8189 bits (229), Expect = 7.053e-18
Identity = 80/293 (27.30%), Postives = 122/293 (41.64%), Query Frame = 2
Query:  455 VLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAK----KHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER--EGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKC--RKWKQQG 1309
             + VNG    +P+  S  + I  + +++    P   + V +DG+  A + V   Y ++M G+CGD NG  ++  TK    ++   N +   G+S+   +         D             S++A+      CG + + + PF  C +   VD   FFQ CV DMC    R     +  C+      + C  AG    +WR    CPL C  N+H+S   + CP TC     G   P     E+  EGC C+ G++     CV    C     CVD E S      KW  +G
Sbjct:    6 TILVNGLRVGLPHSPSPLISITLAGQYVILTTPF-GLEVRWDGNHYAKITVPSTYYEQMCGLCGDYNGNPNNDFTKPNGSLAGNINDF---GSSWQTDE------DEDDTCKPVPPEPPCDPSIEAEVVKPDKCGKITDTSGPFRDCIKV--VDPTPFFQSCVFDMC----RYQGLIQTLCDQLQAYTDACLGAGAPVHQWREPDFCPLVCPPNSHYSTCVSSCPETC----LGVSGP-LGCGEKCVEGCECDPGFVLSNNKCVPLKDCG----CVDPEGSYHPINDKWYLEG 273          
BLAST of VWFD domain-containing protein vs. Ensembl Cavefish
Match: zanl (zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-2])

HSP 1 Score: 147.517 bits (371), Expect = 2.050e-34
Identity = 104/344 (30.23%), Postives = 159/344 (46.22%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK-AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            CS  GDPHY ++D +V HF G C YTLT+  N  D    F +E +NE+R +N   +Y KSVI+++F     L +   ++VNG    VP    +DV+IF S KF+  +     +R  FDG+  A + +   Y   + G+CG+ N    D    S    ++  N+   +G S+ V      C     DI     C K+     +    CG++ +    F +C +  + D   +F+ CV D C             C+     A +C++AG   I WR+   CPL+C   +H+      C  +C++   G    C + P  EGC C+ G I  G  CV    C C +
Sbjct:  369 CSVCGDPHYTSFDNKVHHFMGACSYTLTKPCNDTDGLPYFTVETENEHRSNNNKVSYVKSVIVNVFGMKIILDKGRKVQVNGVQVTVPVTLLNDVKIFLSGKFV-VLETNFGLRARFDGNHYADISLPSPYKGLLCGMCGNFNDNPADDNIMSNGKPTDSTNE---LGESWQVPDDRPDCSHGGGDIE----CDKNIENEAQKPTSCGMITDITGIFKECHKFVSPD--PYFESCVFDQCGTDGS----AVALCQAIESYATLCAQAGVP-INWRNNTFCPLKCPAGSHYEHCGTACSPSCQDP--GAAGTCTE-PCVEGCVCDTGLILSGDKCVPFSECGCTD 694          

HSP 2 Score: 131.724 bits (330), Expect = 1.132e-29
Identity = 92/369 (24.93%), Postives = 152/369 (41.19%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS------------------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            + + F KC+  GDPHYRT+D    H+ G   Y L + HN   +   F +  +N  +G N   +Y   V + ++     + Q  VL V+G+    P      +RI  + ++LQ V+    + V FDG+    + +   Y   + G+CG+ +G  ++   K    ++    ++   G+S+ V+       +  D+   +                   C    +  L  +  CG L  P+ PF+ C      D   + +DCV D+C  ++       +RCE ++  A  C E G     WR Q  C L C  N+ ++     CP +C +        C      EGC C  G+     LCV    C C  L
Sbjct: 1134 RPESFGKCAISGDPHYRTFDTFNHHYQGAYTYILARDHNLPSNLTPFKVRGKNARKGGNNRISYLHEVYVDVYDINVRILQAKVLLVDGERVFPPLSPKQGIRIAMNSRYLQ-VSTDFGLTVRFDGNMQGEILLPSPYKSFVGGLCGNFDGRTNNEYMKPDGTIARLLGEF---GDSWRVTDRQAEGLQVSDLPKLTRLHRREVEEDLDSGFETEGCSAAQLAELNGENQCGALSNPDGPFAACHSVIQPD--TYKEDCVFDLCAEQDS----STLRCENYAVYALACQEQGIVLGPWRQQLGCALTCSANSSYTTCMTTCPASCAD--LAAPSECEQTTCVEGCQCAPGFAMSDTLCVPFSQCGCTYL 1490          

HSP 3 Score: 116.316 bits (290), Expect = 5.905e-25
Identity = 98/350 (28.00%), Postives = 154/350 (44.00%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPER---EGCACNRGYIRDGALCVKPMHCKCI 1252
            C   GDPHY T+DG +  + G C YTL     E     F I  +NE RG  +  +Y +SV +++   V  L +   + ++GQ  R P +  + + ++F S      ++    + V FDG  +  + V   Y  K+ G+CG+ NG   DD    +G    +       +G+S+     S PG  C+       H  C  +   ++ A+    +L   ++ F  C     +    F  +C+ DMC         Q   C+     A+ C  AG   I WR+   CPL C  N+H+S+   PCP TC + F     P +  LP     EGC C+ G++     CV   +C C+
Sbjct:  754 CHIAGDPHYYTFDGVMHTYMGTCTYTLVAICDESMVTPFTIVAKNEERGLPEA-SYVRSVTVYLPGAVITLSKSKRVLLDGQRIRTPMDILAANAQVFTS-GVNTVLSTDFGLIVQFDGVHHVEITVPGDYFNKVCGMCGNYNGNSSDDNLMPNGNPAKDDIE----LGDSWKAEGDSDPG--CQPDLRPDVHPNCTAEEEEAIAAQCSSIIL---SDRFKPCHSL--IPPEPFLGNCIYDMCEYNGM----QSTLCDNVEAYAQACQSAGVT-ISWRNTTFCPLPCPPNSHYSDCTPPCPPTCADLF-----PIFCPLPPNGCVEGCQCDSGFVLSDGKCVPLSNCGCV 1080          

HSP 4 Score: 106.301 bits (264), Expect = 7.208e-22
Identity = 93/348 (26.72%), Postives = 147/348 (42.24%), Query Frame = 2
Query:  290 GDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAK----KHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER--EGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKC--RKWKQQG 1309
            G C YTL +  R +    F++E +NE RG     +Y + + + +      + +   + VNG    +P+  S  + I  + +++    P   + V +DG+  A + V   Y ++M G+CGD NG  ++  TK    ++   N +   G+S+   +         D             S++A+      CG + + + PF  C +   VD   FFQ CV DMC    R     +  C+      + C  AG    +WR    CPL C  N+H+S   + CP TC     G   P     E+  EGC C+ G++     CV    C     CVD E S      KW  +G
Sbjct:    2 GTCTYTLARPCRNNTGPWFSVEGKNEERG-LAGVSYLRKLYVTVDNITVTMMKSRTILVNGLRVGLPHSPSPLISITLAGQYVILTTPF-GLEVRWDGNHYAKITVPSTYYEQMCGLCGDYNGNPNNDFTKPNGSLAGNINDF---GSSWQTDE------DEDDTCKPVPPEPPCDPSIEAEVVKPDKCGKITDTSGPFRDCIKV--VDPTPFFQSCVFDMC----RYQGLIQTLCDQLQAYTDACLGAGAPVHQWREPDFCPLVCPPNSHYSTCVSSCPETC----LGVSGP-LGCGEKCVEGCECDPGFVLSNNKCVPLKDCG----CVDPEGSYHPINDKWYLEG 323          
BLAST of VWFD domain-containing protein vs. Ensembl Cavefish
Match: zanl (zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-2])

HSP 1 Score: 147.517 bits (371), Expect = 2.050e-34
Identity = 104/344 (30.23%), Postives = 159/344 (46.22%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKK-AKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            CS  GDPHY ++D +V HF G C YTLT+  N  D    F +E +NE+R +N   +Y KSVI+++F     L +   ++VNG    VP    +DV+IF S KF+  +     +R  FDG+  A + +   Y   + G+CG+ N    D    S    ++  N+   +G S+ V      C     DI     C K+     +    CG++ +    F +C +  + D   +F+ CV D C             C+     A +C++AG   I WR+   CPL+C   +H+      C  +C++   G    C + P  EGC C+ G I  G  CV    C C +
Sbjct:  369 CSVCGDPHYTSFDNKVHHFMGACSYTLTKPCNDTDGLPYFTVETENEHRSNNNKVSYVKSVIVNVFGMKIILDKGRKVQVNGVQVTVPVTLLNDVKIFLSGKFV-VLETNFGLRARFDGNHYADISLPSPYKGLLCGMCGNFNDNPADDNIMSNGKPTDSTNE---LGESWQVPDDRPDCSHGGGDIE----CDKNIENEAQKPTSCGMITDITGIFKECHKFVSPD--PYFESCVFDQCGTDGS----AVALCQAIESYATLCAQAGVP-INWRNNTFCPLKCPAGSHYEHCGTACSPSCQDP--GAAGTCTE-PCVEGCVCDTGLILSGDKCVPFSECGCTD 694          

HSP 2 Score: 131.724 bits (330), Expect = 1.132e-29
Identity = 92/369 (24.93%), Postives = 152/369 (41.19%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHS------------------ICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            + + F KC+  GDPHYRT+D    H+ G   Y L + HN   +   F +  +N  +G N   +Y   V + ++     + Q  VL V+G+    P      +RI  + ++LQ V+    + V FDG+    + +   Y   + G+CG+ +G  ++   K    ++    ++   G+S+ V+       +  D+   +                   C    +  L  +  CG L  P+ PF+ C      D   + +DCV D+C  ++       +RCE ++  A  C E G     WR Q  C L C  N+ ++     CP +C +        C      EGC C  G+     LCV    C C  L
Sbjct: 1134 RPESFGKCAISGDPHYRTFDTFNHHYQGAYTYILARDHNLPSNLTPFKVRGKNARKGGNNRISYLHEVYVDVYDINVRILQAKVLLVDGERVFPPLSPKQGIRIAMNSRYLQ-VSTDFGLTVRFDGNMQGEILLPSPYKSFVGGLCGNFDGRTNNEYMKPDGTIARLLGEF---GDSWRVTDRQAEGLQVSDLPKLTRLHRREVEEDLDSGFETEGCSAAQLAELNGENQCGALSNPDGPFAACHSVIQPD--TYKEDCVFDLCAEQDS----STLRCENYAVYALACQEQGIVLGPWRQQLGCALTCSANSSYTTCMTTCPASCAD--LAAPSECEQTTCVEGCQCAPGFAMSDTLCVPFSQCGCTYL 1490          

HSP 3 Score: 116.316 bits (290), Expect = 5.905e-25
Identity = 98/350 (28.00%), Postives = 154/350 (44.00%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHV---SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPER---EGCACNRGYIRDGALCVKPMHCKCI 1252
            C   GDPHY T+DG +  + G C YTL     E     F I  +NE RG  +  +Y +SV +++   V  L +   + ++GQ  R P +  + + ++F S      ++    + V FDG  +  + V   Y  K+ G+CG+ NG   DD    +G    +       +G+S+     S PG  C+       H  C  +   ++ A+    +L   ++ F  C     +    F  +C+ DMC         Q   C+     A+ C  AG   I WR+   CPL C  N+H+S+   PCP TC + F     P +  LP     EGC C+ G++     CV   +C C+
Sbjct:  754 CHIAGDPHYYTFDGVMHTYMGTCTYTLVAICDESMVTPFTIVAKNEERGLPEA-SYVRSVTVYLPGAVITLSKSKRVLLDGQRIRTPMDILAANAQVFTS-GVNTVLSTDFGLIVQFDGVHHVEITVPGDYFNKVCGMCGNYNGNSSDDNLMPNGNPAKDDIE----LGDSWKAEGDSDPG--CQPDLRPDVHPNCTAEEEEAIAAQCSSIIL---SDRFKPCHSL--IPPEPFLGNCIYDMCEYNGM----QSTLCDNVEAYAQACQSAGVT-ISWRNTTFCPLPCPPNSHYSDCTPPCPPTCADLF-----PIFCPLPPNGCVEGCQCDSGFVLSDGKCVPLSNCGCV 1080          

HSP 4 Score: 106.301 bits (264), Expect = 7.208e-22
Identity = 93/348 (26.72%), Postives = 147/348 (42.24%), Query Frame = 2
Query:  290 GDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAK----KHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER--EGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKC--RKWKQQG 1309
            G C YTL +  R +    F++E +NE RG     +Y + + + +      + +   + VNG    +P+  S  + I  + +++    P   + V +DG+  A + V   Y ++M G+CGD NG  ++  TK    ++   N +   G+S+   +         D             S++A+      CG + + + PF  C +   VD   FFQ CV DMC    R     +  C+      + C  AG    +WR    CPL C  N+H+S   + CP TC     G   P     E+  EGC C+ G++     CV    C     CVD E S      KW  +G
Sbjct:    2 GTCTYTLARPCRNNTGPWFSVEGKNEERG-LAGVSYLRKLYVTVDNITVTMMKSRTILVNGLRVGLPHSPSPLISITLAGQYVILTTPF-GLEVRWDGNHYAKITVPSTYYEQMCGLCGDYNGNPNNDFTKPNGSLAGNINDF---GSSWQTDE------DEDDTCKPVPPEPPCDPSIEAEVVKPDKCGKITDTSGPFRDCIKV--VDPTPFFQSCVFDMC----RYQGLIQTLCDQLQAYTDACLGAGAPVHQWREPDFCPLVCPPNSHYSTCVSSCPETC----LGVSGP-LGCGEKCVEGCECDPGFVLSNNKCVPLKDCG----CVDPEGSYHPINDKWYLEG 323          
BLAST of VWFD domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000034930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000038.1:2656807:2676617:1 gene:ENSAMXG00000010839.2 transcript:ENSAMXT00000034930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 8.151e-31
Identity = 111/376 (29.52%), Postives = 167/376 (44.41%), Query Frame = 2
Query:  158 NGVCTPFRTKTQVN----CESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKY--FTYTKSVIIHMFREVYELGQKGV-LKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            N  C P+ +   VN    C+      C+  A GDPHY ++DG    F G CRY L+Q    +      F++EV+NE R  N Y   + +K V + +F   + L +    + VNG L+ +P+  +D  VRI+K       +     +RV +D      V V   Y  +  G+CG+ +G  R+D    SG    N     +L G ++ V  PG  C    D    + C        +A  +CG++ +P+ PF+ C     +D   + Q+CV D+CV+         V C   +  A  C  AG    KWR+   CPL C +  H+   A+    TC      T    Y     EGC C+ GY+ +G  CV    C C+
Sbjct:  267 NFSCGPYESCVVVNGVRQCQPVGNAVCQ--ASGDPHYLSFDGFRYDFQGGCRYMLSQSCGLQGTSLVPFSVEVENE-RWPNSYVKVSVSKQVSLAVFGYTFVLRRSTAQILVNGLLTNLPWSLNDTKVRIYKEGTNYVMMTDF-GLRVTYDLWYYVTVTVPSSYLNRTCGLCGNYDGNPRNDLVLPSG----NTTTDVNLFGKAWKVLIPGVDCVDF-DSGPDADCNPKLRAIFEAPTYCGLISDPSGPFAAC--HAVIDPSGYLQNCVFDVCVSGGS----STVACHGVAAYASKCQTAGVVIKKWRTDSFCPLSCPQFMHYELCADTAAATCPGL---TDIIQYSSRCAEGCTCDIGYLFNGLSCVPYEDCGCM 624          

HSP 2 Score: 108.997 bits (271), Expect = 9.490e-23
Identity = 92/351 (26.21%), Postives = 158/351 (45.01%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFR-----EVYELGQKGVLKVNGQLS----RVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
             C A GDPHY T+DG    F G C YTL+Q     +    F++   N+ RG   Y +Y + V + ++      + Y+ GQ  V K+   L     RV  ++     + ++   LQ         + +D +S+  +++  +Y + + G+CG+ NG + D     G        +++    + + S+PG  C+   D S   +C  D  +   +  +CGVL   ++ F  C+ K  VD   F + CV D+C++        ++ C+     A +C  A    + WR +FNCP++C  N+H+   A     TC       ++P       E C C+ G++  G+ CV    C C
Sbjct:  733 TCWARGDPHYFTFDGFYYDFQGTCTYTLSQTCGPLNGLEPFSVTESNDNRGSTSY-SYVREVEVKVYGITITIQKYQWGQVTVQKLYLPLMLLDHRVQVQQVGSYAVVQTDFGLQ---------LKYDWNSDVNLQLPGQYYQHVCGLCGNFNGNQSDELIGPGGVQQATVIQWASSWRT-NASEPG--CRDTCD-SNCPVCSSDQQKLYNSDAYCGVL-STSDLFKPCSSK--VDPAVFQKTCVYDLCLSNGN----HRMLCDALQSYASMCRMADVVLLGWREKFNCPMRCQPNSHYEGCATSFNTTCPTP---QQQPNRTGVCVEACVCDPGFLLSGSTCVPAAQCGC 1059          

HSP 3 Score: 100.523 bits (249), Expect = 4.083e-20
Identity = 93/355 (26.20%), Postives = 140/355 (39.44%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVS---------KPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
             C A GDPHYRT+DG    F G   Y L    +       FN+ VQNE RG +   ++T++V + +F  V  + ++    + V+  L  +P E  + + I         +     +RV FD  S   V +   YS  + G+CG+ NG  +DD     G    N      ++G S+ V           P  +C  A+                +AK+ C ++ +P  PF  C R   V    +  DCV D C         Q V C+  +     C       I     F+    C  ++++S     C +TC +  +   R C      EGC C  GY+  G  CV    C C 
Sbjct: 1112 TCEAFGDPHYRTFDGLAFDFQGTSVYQLVALCSNRTYLVPFNVTVQNENRGRSA-VSFTRAVTVSVFGVVITITREYPRQVLVSMLLMELPLEMQNMLVIHHGGN-AAVLETSFGLRVTFDWISTLRVTLPNSYSGAVCGLCGNFNGSTQDDMAMPGGSLAPNAW----VLGQSWQVGGTPDSSSGPPPTQNCTAAQ--------------MEEAKRLCSIISDPAGPFRACHRV--VAPGPYENDCVFDTCQYPGL----QSVLCDAVAAYLYYCI------IYAVLLFSTAQFCPPHSNYSLCVPGCVQTCASVSWSCSRSC-----AEGCQCEPGYVFSGQACVPLADCGCF 1429          

HSP 4 Score: 92.0485 bits (227), Expect = 1.546e-17
Identity = 67/236 (28.39%), Postives = 108/236 (45.76%), Query Frame = 2
Query:  563 VRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSL-----IGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            + VAFD +S   V V   Y   + G+CG+       + +K+G D+  +   +S       G S+ V+  PG  C  A      S C     +   +  +CG++L+PN PF++C  +  +D   FF++CV D+C    R    + + C+  S     C + G     WR+   C +QC  ++H+      CP TC  +  G    C   P +E C C++G+I  G  CV    C C+
Sbjct:   17 LTVAFDWNSIGSVSVPSTYMAAVCGLCGN-------YNSKTGDDLMLRGTNFSSSSPDNFGESWKVADVPG--CVNACS-GNCSTCEAAHRQIYASADYCGLILDPNGPFTEC--QALLDPSLFFENCVYDVCAYLGR----KDILCQAISAYMSACQDIGARVYPWRTADFCGVQCPPHSHYDVCGPGCPATC--YGLGLPLSC-QRPCKESCVCDQGFILSGDDCVPFSQCGCL 233          
BLAST of VWFD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000981.1 (pep scaffold:Pmarinus_7.0:GL476384:615201:646381:-1 gene:ENSPMAG00000000884.1 transcript:ENSPMAT00000000981.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 1.178e-31
Identity = 103/387 (26.61%), Postives = 171/387 (44.19%), Query Frame = 2
Query:  110 CTNGTRNIRITTYV-KDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C N   N+    +V KD+ +C+       + C ++      C   GDPHY T+D    HF G+C YT     N+      FN+E  NE+RG +   +Y K V + ++   + L +   + V+G     P+  S  V I  S  ++  +    ++ V FDG+ +  + V   Y+ ++ GICG+ NG   D   K     +   N+   +GNS+ V +     C+   +      C ++     ++   CG++ +P   F +C     +  + FF +CV D+C             C+     A+ C++AG   + WR+   CP  C   +H+   A PCP TC N     G  + C      EGC C+ G++  G  CV    C C++
Sbjct:  855 CVNPGGNVSCDAWVCKDDEICS--VVDGILGCHTQEPG--DCVITGDPHYITFDKTTHHFMGECTYTAAVPCNQSSTLPHFNVETTNEFRGGSTAVSYVKDVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSG-VYIQLSGSYV-VLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNE---LGNSWRVFNSSDDDCQDGTE--EIPPCDENDKDVYESDSFCGIITDPEGAFKECHAV--LPPQVFFDNCVFDLCATGGD----HGSLCQALQAYADQCAQAGVI-VTWRNNTFCPFPCEPGSHYESCAPPCPATCSNASLPGGCNQQC-----AEGCVCDDGFVLSGDKCVPVELCGCLD 1218          

HSP 2 Score: 130.954 bits (328), Expect = 3.189e-30
Identity = 96/354 (27.12%), Postives = 156/354 (44.07%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS--------FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
             C   GDPHY T+D    HF G+C YT         PC+        FN+E  NE+RG +   +Y K V + ++   + L +   + V+G     P+  S  V I  S  ++  +    ++ V FDG+ +  + V   Y+ ++ GICG+ NG   D   K     +   ++   +GNS+ V +     C+   D      C ++     ++   CG++ +P   F +C     +  + FF +CV D+C             C+     A+ C++AG   + WR+   CP  C   +H+   A PCP TC N     G  + C      EGC C+ G++  G  CV    C C++
Sbjct:  503 DCVITGDPHYITFDKTTHHFMGECTYTAAI------PCNQSSTLLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSG-VYIQLSGSYV-VLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSE---LGNSWRVFNSSDDDCQD--DTGEIPPCDENDKNLYESDTFCGIITDPEGAFKECHAV--LPPQVFFDNCVFDLCATGGD----HGSLCQALQAYADQCAQAGVI-VTWRNNTFCPFPCEPGSHYESCAPPCPATCSNASLPGGCNQQC-----AEGCVCDDGFVLSGDKCVPTEQCGCLD 831          

HSP 3 Score: 130.183 bits (326), Expect = 5.573e-30
Identity = 95/347 (27.38%), Postives = 155/347 (44.67%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENH--FFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
             C   GDPHY T+D    HF G+C YT     N+      FN+E  NE+RG +   +Y K V + ++   + L +   + V+G     P+  S  V I  S  ++  +    ++ V FDG+ +  + V   Y+ ++ GICG+ NG   D   K     +   ++   +GNS+ V +     C+   D      C ++     ++   CG++ +P   F +C     +  + FF +CV D+C             C+     A+ C++AG   + WR+   CP  C   +H+   A PCP TC N     G  + C      EGC C+ G++  G  CV    C C++
Sbjct:  117 DCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSG-VYIQLSGSYV-VLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSE---LGNSWRVFNSSDDDCQD--DTGEIPPCDENDKNLYESDTFCGIINDPEGAFKECHAV--LPPQIFFDNCVFDLCATGGD----HGSLCQALQAYADQCAQAGVI-VTWRNNTFCPFPCEPGSHYESCAPPCPATCSNANPPAGCNQQC-----AEGCVCDDGFVLSGDKCVPTDQCGCLD 444          
BLAST of VWFD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005510.1 (pep scaffold:Pmarinus_7.0:GL476588:620363:669144:-1 gene:ENSPMAG00000004964.1 transcript:ENSPMAT00000005510.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 3.720e-31
Identity = 97/374 (25.94%), Postives = 157/374 (41.98%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVR------VAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCK 1318
             C   GDPHY T+D    HF G+C YT     N+      FN+E  NE+RG +   +Y K V + ++   + L +   + V+G     P        +F S  ++Q       +       V FDG+ +  + V   Y+ ++ GICG+ NG   D   K     +   N+   +GNS+ V +     C+          C ++     ++   CG++++    F +C     +  + FF +CV D+C             C+     A+ C++AG   + WR+   CP  C   +H+   A PCP TC N     G  + C      EGC C+ G++  G  CV    C C++   D +       W + G C 
Sbjct:  504 DCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPP--------VFMSGVYIQLSGSYVVLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSNE---LGNSWRVFNSSDDDCQDGT--GEIPPCDENDKDVYESDSFCGIIIDDEGAFKEC--HAVLPPQVFFDNCVFDLCATDGD----HGSLCQALQAYADQCAQAGVI-VTWRNNTFCPFPCEPGSHYESCAPPCPATCSNASLPGGCNQQC-----AEGCVCDDGFVLSGDKCVPVELCGCLDF--DNQYHPLGESWFESGNCS 850          

HSP 2 Score: 133.265 bits (334), Expect = 9.473e-31
Identity = 95/348 (27.30%), Postives = 156/348 (44.83%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYT--LTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENH--FFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
             C   GDPHY T+D    HF G+C YT  +  +     P  FN+E  NE+RG +   +Y K V + ++   + L +   + V+G     P+  S  V I  S  ++  +    ++ V FDG+ +  + V   Y+ ++ GICG+ NG   D   K     +   ++   +GNS+ V +     C+   D      C ++     ++   CG++ +P   F +C     +  + FF +CV D+C             C+     A+ C++AG   + WR+   CP  C   +H+   A PCP TC N     G  + C      EGC C+ G++  G  CV    C C++
Sbjct:  117 DCVITGDPHYITFDKTTHHFMGECTYTAAIPCNQSSTLPPHFNVETTNEFRGGSTAVSYVKEVHVDVYGHRFTLAKGRRVLVDGLRVTPPFFMSG-VYIQLSGSYV-VLETDFNLVVRFDGNHHVEIVVPGEYAGQLCGICGNFNGDGSDDNLKPDGSAAASSSE---LGNSWRVFNSSDDDCQD--DTGEIPPCDENDKNLYESDTFCGIITDPEGAFKEC--HAVLPPQIFFDNCVFDLCATGGD----HGSLCQALQAYADQCAQAGVI-VTWRNNTFCPFPCEPGSHYESCAPPCPATCSNANPPAGCNQQC-----AEGCVCDDGFVLSGDKCVPTDQCGCLD 445          

HSP 3 Score: 127.872 bits (320), Expect = 3.537e-29
Identity = 99/355 (27.89%), Postives = 156/355 (43.94%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEK-SDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGH----------HCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE-REGCACNRGYIRDGALCVKPMHCKC 1249
             C   GDPHY T+D    HF G+C YT     N+      FN+E  NE+RG +   +Y K V + ++   + L +   + V+ +  + P E     V+I  S  ++  +     V V FDG  +  +     Y  K+ G+CG+ N    DD+   +G+  ++     + +G+S+                  CK  +      I G D I     KK C V++  +  F+KC  +  +D   F + C+ DMC         +   C+ F   AE C   G   I WR++  CPL C  N H++  A+PCP TC + +   +  C       EGC C++G++    LCV    C C
Sbjct:  890 DCVITGDPHYITFDKTTHHFMGECTYTAAVPCNQSSTLPHFNVETTNEFRGGSTTVSYVKEVHVEVYGYRFTLAKGRRVLVDDKRVKTPIEGLVPGVKIGISGSYV-LLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSA----AQLGDSWKAEGDDDAGSTLWVGEVSCKPDEP----HIPGCDPINEEAYKKMCEVVISTSGAFAKCHAE--IDPEPFLKTCIYDMCQFHGM----ESTLCDNFQAYAEACRAKGIN-ILWRNETFCPLPCPPNTHYTPCASPCPATCSDIY--AEDGCQSAARCAEGCVCDQGFVLSDDLCVSLEACGC 1226          

HSP 4 Score: 120.168 bits (300), Expect = 7.471e-27
Identity = 89/343 (25.95%), Postives = 157/343 (45.77%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDI------SYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALC 1225
            +  CS  GDPHY+T+D ++ HF G   YTL Q     ++     I  +N+  G N   ++  +V I+++    +   +   ++NG  ++ P    + + I  +   +  +     + V FD  S+A V +   Y+ ++ G+CG+ NG + D+FKT  G  V+++     + GNS+ V+      +++K +        +  C  +    L+ K  CGV  +P  PF +C     VD   ++ +C+ DMC N       +++ C         C + G     WR    C  QC  +  + E+ + CP TC +        C +LP+ EGC C  G++  G  C
Sbjct: 1284 YSTCSISGDPHYQTFDKRLYHFMGRETYTLVQSCGDNNNLLPIRILGKNKRVGHNHRVSFLDAVYIYVYGFKIKFTDRKDFELNGVRTKPPSNPKEGLEIVHTSHKM-VLRTDFGLTVIFDRKSHADVTIPSSYAGQVCGLCGNSNGDKSDEFKTPDGSLVTSE----DVFGNSWEVNDRRSLFEQSKRLVEEPRNDLNLSCSDEQWAELENKSSCGVFHDPAGPFVQCWIPAPVD--PYYTNCMYDMCENIGD----KELFCSSLEVYTSACQQEGITPNNWRIYTGCAQQCAAHNIYVERMSACPSTCGD--LAASSNC-ELPDVEGCQCMPGFVMSGFDC 1612          
BLAST of VWFD domain-containing protein vs. Ensembl Sea Lamprey
Match: tecta (tectorin alpha [Source:ZFIN;Acc:ZDB-GENE-110411-120])

HSP 1 Score: 133.65 bits (335), Expect = 7.004e-31
Identity = 101/348 (29.02%), Postives = 165/348 (47.41%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHM--FREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNC--PLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C+  GDPHY T+D  V HF G C YTL +    R  +  SF++  ++E+RG +   ++TK V + +  F  +   G +  + VN +L+ +P+   +  +R  +S   +  ++    + V +D D  A + V   +  ++ G+CG+ N   RD+F   +G   ++     +  GNS+ V + G  C +   I     C +  + + + +  CG++  PN PF+ C     +   NF + CV DMC         + V C+  S  A  C         WR Q NC    QCG N+H+    + CP +C+    G +  C  LP  EGC C+ G++  G  CV P  C C
Sbjct:  320 CTVSGDPHYNTFDRVVHHFQGTCAYTLARTCLERPTELSSFHVIAKSEHRGSST-VSWTKLVQLEVYGFSLIINKGDRSRVLVNEELTSLPFTLLNGRIRASQSGSSVA-ISTDFGLTVTYDTDHYATITVPGAFKGRLCGVCGNYNDDERDEFTMPNGTVTTS----VTEFGNSW-VQEAG--CDQV--ILPPPACTEAVLSTYRGESFCGLISNPNGPFAVCGTV--LSAFNFLESCVFDMCATGGD----RDVLCQSLSAFASACQAHRATIQAWRQQVNCLSAKQCGANSHYEVCTSSCPESCDGQ--GRRSRC-GLPCHEGCRCDEGHVLSGGRCVPPSACGC 647          

HSP 2 Score: 116.316 bits (290), Expect = 1.413e-25
Identity = 112/396 (28.28%), Postives = 163/396 (41.16%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGV--LKVNGQLSRVPYEKSDDVRIFKSRKFLQ-----FVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLI------GNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAM---NIICPKTCG 1363
            C A GDPHY T+DG    F G CRYTL +          FN+EV+N+ RG +   +YT  V + ++     +G+     ++V+G L  +P      V I      +Q      V     +RV +DG   A V + + Y     G+CG+ NG   DDF    G  ++  +N +         G+      P   C  A+   Y S               CG L++P  PF +C R   V     F  CV D+C    R +      C+  S  A  C  AG     WR+   CP+ C  N+H+   +N C R+C +        C   P  EGC CN G +     CV    C C +   +  S E    W ++  C+E  E     +++C  T G
Sbjct:  709 CQAAGDPHYYTFDGAAFDFMGTCRYTLAKTCAGGGGAVPFNVEVENDDRG-SLVVSYTNLVKVDVYGHSIVIGRADYPRVRVDGVLVNLP------VTIIPGNLTVQTGSATLVETNFGLRVQYDGHHVATVWLPRDYRGLTCGLCGNYNGNATDDFLLPDG-SLAASQNHFGQAWTVRGDGDCQATEPPSEPCPDAERPQYAS------------GAFCGPLVDPEGPFRECHRI--VRPEPHFGSCVTDVCALGGRIT----ALCDALSAYAAACQAAGVGVSGWRNSTFCPMSCQSNSHYELCSNTCQRSCSD--LAQPTICSRGPCAEGCRCNPGTVWRSGRCVPLAECGCFHGGRNYASGEAF--WPEE-LCRERCECRRDGSVVCEATGG 1073          

HSP 3 Score: 102.834 bits (255), Expect = 1.661e-21
Identity = 91/350 (26.00%), Postives = 154/350 (44.00%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRS----QFNCPLQCGKNAHFSEKANPCPRTCENHF--FGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A  DPHY T+DG    F G C YTL ++   + P  F +  +N   G +   +  + V + ++ +  ++  G    ++VNG    +P    D  + +++S      V+    ++V+++   +  VEV+  +  K+ G+CG+ N    D+F +  GR V++        G S+ V+  G  C          +C  +      +  +CG+L  P+ PF+ C     V   +++  CV D+C              E ++G    C   G    +WR+    Q +CPL    ++H+    + CP +C       G  RPC      EGC C+RGY+  GA CV    C C
Sbjct: 1097 CRAWSDPHYVTFDGLAFDFQGACTYTLARNCSRELP-RFEVRARNGNLGSSA-VSVPRQVTVTVYGQQVDIFAGDGANVQVNGLNRNLPVSHDDGRLSVYRSGSS-TVVSTDFGLQVSYNHRYHVTVEVASTFQSKLCGLCGNYNLNATDEFLSPEGRPVADPVQ----FGISWRVND-GSVCHDGSGTP--PVCDPEQRALYGSDGYCGILTSPDGPFAGC--HATVSPDSYYNSCVFDLCALGGGADLLAGA-LEAYTG---ACQSDGGPVEEWRNDTLGQHSCPL----HSHYELCGSACPSSCAQLTGPAGCHRPC-----GEGCQCDRGYVWSGAECVSVAQCGC 1421          

HSP 4 Score: 95.5153 bits (236), Expect = 2.649e-19
Identity = 94/338 (27.81%), Postives = 143/338 (42.31%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCS---------FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRC--SVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVR-CEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPR-TC-ENHFFGTKRPCYDLPEREGCACN 1195
            +C+   DPHY T+DG V+H+ G C Y + +      PC          F + ++N+ RG     ++   V + +      L  + VLKVNG  + +P   ++ V +  S +   FV  R   +V V +D    A VEV   Y+ ++ G+CG+ NG  RDD  T SG    + R      G S+        C+   D      C ++     +   HCGVL +P  PF  C     VD   + + CV D+C  +       KV+ C      A+ C  AG   + WR    C        HF   ++PC   +C E  + G+    Y      GC C+
Sbjct: 1480 RCTVTNDPHYFTFDGAVVHYQGVCAYDVAR------PCGGSGGEPYPFFRVVMENKRRGTGA-VSFISGVHLIVGSAHVLLRGREVLKVNGMRTLLPVVVAEGVAL--SEEASGFVVARTPHNVTVRYDRLYTAHVEVGAEYAGRLCGMCGNYNGDPRDDLLTPSGEIALDARQ----FGRSWRAPDVDAGCEDTVDHVEPGRCNEE-----EMWGHCGVLSDPEGPFRSC--HWFVDPALYLESCVYDLCSYEA-----TKVQLCRALEAYAQACGLAGVPLVDWRGPSGC--------HFIPASDPCSAISCGEREWCGSNSGIY------GCYCD 1778          
BLAST of VWFD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000971.1 (pep scaffold:Pmarinus_7.0:GL476384:436886:486709:1 gene:ENSPMAG00000000871.1 transcript:ENSPMAT00000000971.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 1.318e-28
Identity = 91/359 (25.35%), Postives = 165/359 (45.96%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNRED-DPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVS----------KPGHHCKKAKDISYHSI---CGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            +  CS  GDPHY+T+D ++ HF G   YTL Q   ++ +     I  +N+  G N   ++  +V I+++    +   +   ++NG  ++ P   ++ + I  + + +   A    + V F+  S+A V +   Y+ ++ G+CG+ NG + D+FKT  G  V+++    ++ GN++ V+           P    K+  +   + +   C  +    L+ K  CGV  +P  PF +C     VD   ++ +C+ DMC N       +++ C         C + G     WR    C  QC  +  + E+ + CP TC +        C +LP+ EGC C  G++  G  C+    C C+
Sbjct:  689 YSTCSISGDPHYQTFDKRLYHFMGRETYTLVQSCGDNKNLLPIRILGKNKRVGHNHRVSFLDAVYIYVYGFKIKFTDRKDFELNGVRTKPPSNPTEGLEIVHTSRKMVLRADF-GLAVIFNRKSHADVTIPSSYAGQVCGLCGNYNGDKSDEFKTPDGSLVTSE----NVFGNTWEVNDRRSLFEQYESPVFRSKRLVEEPRNDLNLSCSDEQWAELENKNSCGVFHDPAGPFVQCWIPAPVD--PYYTNCMYDMCENIGD----KELFCSSLEVYTSACQQEGITPNNWRIHTGCAQQCAAHNIYVERMSACPSTCGD--LAASSNC-ELPDVEGCQCMPGFVMSGFDCIPFTQCGCL 1033          

HSP 2 Score: 124.02 bits (310), Expect = 3.863e-28
Identity = 98/348 (28.16%), Postives = 154/348 (44.25%), Query Frame = 2
Query:  215 KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEK-SDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPE-REGCACNRGYIRDGALCVKPMHCKC 1249
            K +  C   GDPHY T+D  +I + G C YTL     + +   F I  +NE  G     +Y K VI+ +      L ++  + V+ +  + P E     V+I  S  ++  +     V V FDG  +  +     Y  K+ G+CG+ N    DD+   +G+  ++     + +G+S+     G      K    H I   D I     KK C V++  +  F+KC     +D   F + C+ DMC    +    +   C+ F   AE C   G   I WR++  CPL C  N H++  A+PCP TC + +   +  C       EGC C++G++    LCV    C C
Sbjct:  302 KGYATCHVAGDPHYFTFDLIMISYMGTCTYTLVDVCTDTNVTPFTITAKNEEHGQAS-GSYLKHVIVDIAGHRVTLQKRHRMLVDDKRVKTPIEDLVPGVKIGISGSYV-LLETDFGVTVKFDGKHHLEINTPSTYFNKLCGLCGNYNQNGTDDYLMPNGKLATSA----AQLGDSWKAE--GDDDAGCKPDEPH-IPSCDPINEEAYKKMCEVVISTSGAFAKC--HAEIDPEPFLKTCIYDMC----QFHGMESTLCDNFQAYAEACRAKGIN-ILWRNETFCPLPCLLNTHYTPCASPCPATCSDIY--AEASCQSAARCAEGCVCDQGFVLSDDLCVSLEACGC 631          

HSP 3 Score: 98.5969 bits (244), Expect = 2.196e-20
Identity = 66/234 (28.21%), Postives = 101/234 (43.16%), Query Frame = 2
Query:  560 SVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            ++ V FDG+ +  + V   Y+  + GICG+ NG   D   K    V+    +   +GNS+        CK   D      C        + +  CG++ +PN  F +C     +  + FF +CV D+C     P       C+     A+ C++AG   + WR+   CPL C   +H+   A PCP TC N     G    C      EGC C+ G++  G  CV    C C++
Sbjct:   31 NLVVRFDGNHHVEIVVPNEYAGILCGICGNFNGDGSDDNLKPDGSVAASSAE---LGNSWQSVNSLDECKD--DDGGRPECDPATQEEFEKEGFCGLITDPNGAFKEC--HAVLPPQVFFDNCVFDLCATGGNPLSL----CQALQAYADQCAQAGVI-VTWRNNTFCPLTCKPGSHYESCAPPCPATCSNTSLPGGCNHLC-----GEGCVCDDGFVLSGDKCVPAEQCGCLD 247          
BLAST of VWFD domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004575.1 (pep scaffold:Pmarinus_7.0:GL480782:524:24919:1 gene:ENSPMAG00000004167.1 transcript:ENSPMAT00000004575.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 4.356e-27
Identity = 93/346 (26.88%), Postives = 150/346 (43.35%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFF--GTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+DG  + F G C YT  +  N       FN+E  NEYR      ++ + V   ++ +   L     L +N +L   P      + +  S  +L  +    ++ V F+GD+ A V V + Y++++ GICG+ NG R D++    G   S+       +GNS+       +          S+    W+ +      C +++E    F++C     V+    F  CV+D C         +   C      A+ C+E G   I WR+   C  +C  ++H+   A PCP TC N       ++PC      EGC C+ G++  G  CV    C C++
Sbjct:    1 CIVHGDPHYVTFDGLSLAFMGTCTYTTAKLCNSSSHLPYFNVETTNEYRNQGS-ISFVREVHTEVYGQNITLSLGRTLLLNEELVTPPLVLPG-LHVSLSGSYLVLMT-DFNLIVRFNGDNRAEVTVPREYAEELCGICGNFNGDRTDEYLMPDGTQASSPTE----LGNSWKTDNSSAYITL-------SLASGLWLWT------CTIVIERTGLFTEC--HAVVNPEELFTSCVLDQCWTYGD----KGTLCGSLQAYADECAENGIV-IMWRNATFC-RECKPDSHYESCAPPCPATCSNVTLPGACQQPC-----GEGCVCDEGFVFSGDKCVPQDQCGCLD 313          

HSP 2 Score: 59.6918 bits (143), Expect = 1.157e-8
Identity = 38/138 (27.54%), Postives = 62/138 (44.93%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRI-FKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGI 640
            C   GDPHY T+D  +I + G C Y L      D+   F I  +NE RG     +Y K V + +  +   L +K V+ +NG+  + P  +S    + F        V     + + FDG  +  + +S  Y+ K+  +
Sbjct:  373 CHVAGDPHYFTFDSALITYMGTCTYQLVSVCNADNVTPFTILAKNEERGQPNA-SYLKHVYVDIGSDRIHLKKKNVILLNGKKVKTPMIESLVPGVQFSIIGSYVHVVTDFGLVIKFDGVHHLSITLSSAYANKVIAV 509          
BLAST of VWFD domain-containing protein vs. Ensembl Nematostella
Match: EDO41876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S312])

HSP 1 Score: 112.849 bits (281), Expect = 5.346e-26
Identity = 94/348 (27.01%), Postives = 154/348 (44.25%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYE-------LGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNK-RNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CS  G  HYRT+DG+ I F G C YTL Q         F++ VQN+    +      +++++++  + Y+       +   G ++VNG     PY K  +V + K   +    +    + + FDG S+  V VS +Y     G+CG+ NG+ DD    +   V+NK     +    S+ + +P   C+   +++         +    AK+ C VLL  N  FS C  K  VD   F + C  D+C  K         +C+  +  +  C+      + WRSQ  CP QC +   +SE    C +TC+    G +  C++    +GC C  G ++    C+    C C
Sbjct:    4 CSTWGQRHYRTFDGRHIDFIGKCSYTLAQDCIPGSD-QFSLHVQNDKTCGSAGMDCERALLLYIGEKTYKVRWLVHLISSHGAIRVNGAKVSAPY-KDTNVEVSKVHSYTIIRSQGDELGIKFDGASSIQVAVSHKYRNNTCGLCGNNNGIPDDDLLMA---VTNKPATSVAEFAESWAMPEPNEKCESPLEVTRDVCSNASSVIRDAAKRICMVLLSEN--FSACHTK--VDPVPFVKRCEEDVCSCKF--GEHSGCQCQALTEYSRACASREIM-LDWRSQHLCPKQCIQPKVYSECGPACVKTCDAD--GLQPTCHETC-IDGCHCPEGTVQTDNRCLPVNQCPC 336          
BLAST of VWFD domain-containing protein vs. Ensembl Nematostella
Match: EDO33061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST99])

HSP 1 Score: 102.449 bits (254), Expect = 7.176e-23
Identity = 72/248 (29.03%), Postives = 132/248 (53.23%), Query Frame = 2
Query:  215 KDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGV-RDDFKTKSGRDVSNKRN---KYSLIGNSYHVSKPGHHCKKAKDISYH-SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMC 943
            +D   C++ GDPHY+T+DG++ +F+G+CRY L    R+ +   F++ +++E R  N+     KS+++H+   V  L +  V+KV+ +  ++PY++   ++I + + F+  +     V++ +DG+S   V VS RY     G+CG+ NGV  DDF  K+GR   + R     +SL G   H  +P      +  I+   S C +  +   +A+K C  +    + FS C     V    +++ C+ ++C
Sbjct:   52 EDMGICTSYGDPHYQTFDGRMFNFHGNCRYRLVADCRQGN---FSVRLRSE-RHHNQAVGEAKSLVVHIGSTVIHLQRGLVVKVDRKEVQLPYQRLPSLQIDR-KNFMITLLSETGVKIIWDGESYIEVHVSHRYRGNTCGLCGNFNGVPSDDFMMKNGRYARSDREFGKSWSLGG---HRRRPCLQRAPSPPIAEPISKCRRSALHHWRARKRCWPI---KSQFSNC--HPVVKPHKYYKACISEVC 286          
BLAST of VWFD domain-containing protein vs. Ensembl Nematostella
Match: EDO44199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWN6])

HSP 1 Score: 95.9005 bits (237), Expect = 3.437e-19
Identity = 98/357 (27.45%), Postives = 151/357 (42.30%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK-----GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCS--VRVAFDGDSNAFVEVSKRY------SKKMNGICGDCNGVR-DDFKTKSGRDVS-NKRNKY--SLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C   G  H+ T+D Q   FYG C Y     N       F + + N+   D      TKSV +++  +   LGQ+     G +KV+G    +PY KS        R+  ++V  R S  V + FDG     ++V   Y        ++ G+CG+ +G   +DF    G   + +  N +  S++ +    + P     K     Y  + G  +     A+K C V+   ++ FS C  K  VD R+F   C+ D+C   N  SR     C + S  ++ C+      + WRS   CP+ C      SE ++ CPR C N    +     +    +GC C  G I+D   CV P  C C
Sbjct:  478 CYISGRGHFTTFDHQEYSFYGTCSYKALIDNSNVKQI-FQVVLNNDKNCDINA-PCTKSVDVNVDGKKVHLGQEVASRHGFVKVDGVTENLPYTKS----WPNIRQAGKYVIVRTSDEVLIYFDGSEELMIKVPDSYKTVNSSDTRLKGLCGNYDGNNTNDFIGLDGTTYTKDNINDFGVSMLDDPLCTNPP-----KPPSGCYSEVAGDVFSAMQNAEKMCSVIQ--SDAFSACRSK--VDFRDFKAQCIADVCA-CNSTSR-SDCMCNVLSTYSKACAWNHNITLSWRSPSLCPVTCPSGMEHSECSSACPRDCSN--MNSDPNACNSKCVDGCFCPEGKIQDRGKCVDPGQCSC 815          

HSP 2 Score: 57.3806 bits (137), Expect = 1.579e-7
Identity = 85/361 (23.55%), Postives = 136/361 (37.67%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH--NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRS-------QFNCPL-----QCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER---EGCACNR--GYIRDGALCVKPMHCKC 1249
            C+ VG+ H+ T+D +    +G C Y L++H     D    F I ++    G  +               V   G   VL  NG+ +      S  + +         V     + + + G  NA++ V   +  +  G+CG  N    DDF T   RD  N+ + Y+       VS     +C ++        C         AK  C  +++ N PF  C R   V  ++ +Q CV D C+ K+         C + +  A+ C++ G     WR        +F CP      QC ++   + K   CP TC++    T       P R   EGC C +    + +   CV    C C
Sbjct:  853 CTMVGNSHFTTFDSRSYSMHGQCDYVLSEHCHFSNDTTKQFTIHIKISSDGSRQLIVSLAGATPVTLGGVE--GSPTVLNSNGKAT------SHILSVEHIGVQNVLVHAYAGLTILWTG-YNAYITVGPDFKSQTCGLCGTFNQNDADDFHT---RDGDNEADAYAFAQEWQVVSSVAASNCHRSNWNQLDQPCSTYSSNEGYAKSGCNAIIDLNGPFKACHRY--VPPQDMYQKCVKDGCMCKD-------CLCSVAAAYAKACADKGIVIDGWRDTISVCKPKFVCPAGTVLKQCNRDP-LTRKLR-CPSTCDDLANVTDT----CPSRRCVEGCYCEKEGELMNNEHKCVDKTQCPC 1186          
BLAST of VWFD domain-containing protein vs. Ensembl Nematostella
Match: EDO41877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S313])

HSP 1 Score: 61.6178 bits (148), Expect = 2.760e-9
Identity = 74/301 (24.58%), Postives = 129/301 (42.86%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--------SFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQ-KGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVS--KRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKR---NKYSLIGNSYHVSKPGHHCK--KAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGK 1081
            C+A GDPHY+T+DG++  F G C Y ++      D C        SF I+ +N   G +   T TKSV + +   +  + + K V  V    S  P        +  +  ++   AP   + V +D  +  ++E+S   ++  K+ G+CG+ +G + +D+  K+G   ++     + +   G+     +P H CK  K ++   H+ C    I      K C + ++P+  + +C              CV D C   +      +  CE  +  A  C  AG   +KWR       +CGK
Sbjct:   74 CTAFGDPHYKTFDGRLYSFQGGCNYVMST-----DKCPGSKLTLQSFRIDAENIPCG-SAGVTCTKSVTVTLHDTIIHMVRGKAVPSVTKVSSLSPVHAR--YELVYAGLYVIIKAPF-GLNVIWDRGTRLYIELSPDSQHWSKVCGLCGNFDGDMTNDYMAKNGITETSPYPFGDTWRARGDCTKTMEPIHPCKQNKHRESKSHAACA---IIKSGTFKPCHISVDPDPYYERCR-------------CVYDTCGCDSVGD--CECTCEAIAAYAYECLAAGVV-VKWRQD-----KCGK 341          
BLAST of VWFD domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000006964.2 (alpha-tectorin-like [Source:NCBI gene;Acc:105358719])

HSP 1 Score: 155.606 bits (392), Expect = 7.251e-37
Identity = 110/369 (29.81%), Postives = 174/369 (47.15%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVS---KPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            VC P+    Q +C++ ++  C  S  GDPHY T+D  V HF G C Y L++  +   P  + IE +NE+RG + + ++T+ V + ++ E  EL  G  G  KVNG  +  P+  +   V++++S  F   V+    + V++D  S+  + +   Y     G+CG+ N    DDF+T++G  VS+  +      NS+  S    PG  C+        + C            HCG+L   + PF+ C +   +  +NF Q CV D+C+       +Q + C+     A  C + G +   WR    C + C  N+HF  +A  CP TC N       P   LP +E C C+ GY+     CV    C C
Sbjct:  213 VCMPY--SFQFSCQTVQRRTCTIS--GDPHYYTFDDTVFHFQGTCTYVLSEQCQYGLP-YYRIEGKNEHRG-STHVSWTRLVKVFVYNETIELVKGNPGRAKVNGTFTATPFTLNQGRVQVYQS-GFSVVVSTDFGLTVSYDTYSHVGISLPYTYQNATCGLCGNFNNQPGDDFQTRNGEVVSSDVD----FANSWRASGDEDPG--CEAQCRGLECAGCNAAQTALYNNNDHCGILQNSSGPFAACHQT--LPPQNFVQSCVYDLCIGGG----YQPILCQSLGVYASQCQQNGIQPASWRRPGFCEIPCPANSHFESQATGCPSTCVNPNSTQNCP---LPVQESCVCDTGYVLSAGQCVPYAQCGC 559          

HSP 2 Score: 108.997 bits (271), Expect = 9.591e-23
Identity = 87/352 (24.72%), Postives = 147/352 (41.76%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEK-SDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKR--YSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSR-WQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +   +  C   G   Y+T+DG    + G C+  + +     D   FN+  +   +G   +  Y              +  +G  KV+GQLSR+P+   S+   IF S      +  R S  +        FV V+    Y+  + G+CG+ N    DDF+T  G  V + +    + G+S+       HC +  +        ++ + +  +  +CG+L  P+ PF+ C    N   +       +D+CV+  R S   +   C++      +C + G    +WR+   C   C  N+H       CP TC +  F     C D P ++GC CN G++ +G  CV P  C C
Sbjct:  612 RPNGYATCLIRGPGSYQTFDGLTYQYPGACKLIVAKVIGSSDHPHFNVSTEKVPQGQESFSNYLN------------IEAQGA-KVDGQLSRLPFSSASNQFHIFHSNT--HSIILRTSFGLTVQTVWPHFVRVTAPVVYTSSLGGLCGNYNNEPNDDFQTPDGTLVHSVQ----VFGDSWREGSLASHCVENTN--------RNIMTNFNSSDYCGILSSPHGPFTPCWPVVNPSQQ-------VDVCVDILRRSEDPESTLCQVLRDYVLMCQQKGVSLGEWRNTTGCAATCPSNSHSEVCGTSCPSTCPSLSF--PFSC-DTPCQDGCQCNDGFVLNGNRCVPPTSCGC 926          

HSP 3 Score: 102.064 bits (253), Expect = 1.275e-20
Identity = 97/356 (27.25%), Postives = 144/356 (40.45%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQN-EYRGDNKYFTYTKSVIIHMFR---------EVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIR---SLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CSA GDPHY T+DG+   F G CRY L +  +       F++E +N  + G     T   +V +  ++         EV     K +L +  Q   +P+  + ++ +F S  +  FV     + V +DG S           + M G+CG+ N    DDF +  G  V+         G ++ V  PG++       S    CG    R      A+  C V+   + P S C    +VD   FF DCV D+CV  N  +    + C         C  A      WR    C + C  N+H+      C  TC +    T +  C      EGC C+ G++R G  CV    C C
Sbjct:  988 CSASGDPHYLTFDGKTYDFQGTCRYVLAEVCHSSSGLHQFSVEAKNMPWNGLPVSITAEVAVTVWGYKVWMFSNNRVEVSICLNKTLLIILYQ--NLPFVLNGNISVFAS-GYQTFVRTSFGLSVMYDGWSTV---------RNMCGLCGNFNDNPNDDFHSPDGAAVTTP----DAFGAAWKV--PGNY-------SCSDGCGSSCPRCTNDQAARVQCEVIQAADGPLSFCHE--HVDPAPFFSDCVFDVCVGGNARN---DLLCRAIETYVSACQSANARIYPWRQNTTCSINCPANSHYELCGTDCGHTCVSSTNATCEHAC-----SEGCFCDEGFVRSGTTCVPEESCGC 1308          

HSP 4 Score: 96.6709 bits (239), Expect = 5.267e-19
Identity = 78/303 (25.74%), Postives = 123/303 (40.59%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKD-FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNRE-DDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPL 1069
            CTP +  T  N +    D    C+  GDPHY T+DG + HF G C Y +T+     ++   F +   N +RG+N                        V  V+G    +P       ++     F+ F A    + V FDG S   V +S+ Y  K++G+CG+ NG   D K K    ++    ++   G+S+    P   C    +I+    C      S +  + C ++   + PFS C      D + FF  CV D+C+     S    + C   S   + C+  G    +WR   +C L
Sbjct: 1344 CTPAQQCTVRNGQLGCYDGMSTCTVWGDPHYITFDGALAHFQGTCSYIITETGSHGNNHTQFEVVATNNHRGNNH-----------------------VSFVDGSDVSLPTTVGGIAQVSTQGGFVVFNA--ADLIVQFDGQSTLLVRMSQHYQNKVSGMCGNFNGDPSDDKVKPSGTLAQNDTEF---GHSW--KSPSSQCGSTDEINEDGHC----RFSQEYSELCSIITNTSGPFSACHLHS--DPQPFFSSCVYDLCLY----SPANGMLCSAVSAYEKTCTVLGLNIPEWRPALHCAL 1606          
BLAST of VWFD domain-containing protein vs. Ensembl Medaka
Match: FCGBP (Fc fragment of IgG binding protein [Source:NCBI gene;Acc:101155957])

HSP 1 Score: 149.828 bits (377), Expect = 4.630e-35
Identity = 97/346 (28.03%), Postives = 164/346 (47.40%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHV-SKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +  C+A GDPHY T+DG+  +F G C Y L    ++      FN+ V+NE RG +K  ++TK+V   ++     + ++   K+NGQL+ +P + +D++ +F S      +     + + +D  S   V V   Y   M G+CG+ NG   DD   ++G+   ++      +G S+ V S PG  C  A    +   C     +  +A + CG++ +   PF +C +   VD   + +DCV D+C             C+        C   G     WR+Q  CP++C  N+H++  A+ CP TC +    +   C+ +   E C C++G++  G  CV    C C
Sbjct: 1626 YATCTASGDPHYHTFDGRRFNFQGTCVYQLAGLCSQHPGLVPFNVTVENENRG-SKAVSFTKTVTFSIYGSTLTISKENPYKLNGQLAALPLKSNDELAVFLSGS-QAVIETAAGITITYDWWSTVRVTVPSNYHGAMCGLCGNYNGKALDDMTMQNGKTTPDEAK----LGESWQVASVPG--CSSACQGPWCQACSDSQKKVYQASQFCGIIADETGPFRECHKF--VDPAAYVEDCVYDVCQFHGH----HGSVCKAVEVYLSACQSQGIPIHPWRTQAFCPMECPANSHYNLCASGCPTTCAS--INSLTTCH-MHCSEACECDQGHLMSGDTCVPVRDCGC 1954          

HSP 2 Score: 135.961 bits (341), Expect = 8.225e-31
Identity = 104/356 (29.21%), Postives = 166/356 (46.63%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPC--SFNIEVQN---EYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVR-DDFKTKS---GRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPER--EGCACNRGYIRDGALCVKPMHCKCIN 1255
            C A GDPHY ++DGQ   F G C Y L++    +D    +F+++V+N   +     K  + T+ V + +F     +  K  GVL VNG L+ +P   +D +V++++       +A    + V +D   +  V V   Y  K+ G+CG+ NG R DDF+       +D+       ++ G S+ V+ P   C+     +  + C            +CG+L  P  PF+ C  K  +D +++F DCV D+C +        KV C+  +  A  C  AG     WR+   CP++C  N+H+   A  C  +C          C   PE   EGC C+ G++ DG  CVK   C C +
Sbjct:  817 CRASGDPHYTSFDGQKFDFQGTCTYVLSKSCGVEDTHLEAFSVQVENVQWDRMKGKKKVSVTRLVAVEVFGFTLIMKSKMFGVL-VNGVLNNIPLNLNDGEVQVYQEGTNY-LIATNFGLLVTYDLVYHVTVTVPGNYRDKVCGLCGNFNGDRKDDFQMPDQILAKDI-------NVFGKSWKVAIPNVVCENGCQGNECADCDPAHKDVFSKPAYCGILTAPKGPFAVCHSK--LDPQSYFDDCVFDVCASNGD----GKVLCDSVAAYAYNCHMAGVNVNDWRTPSFCPMKCPANSHYEVCAETCTYSCPG--LSDMVQC---PEACTEGCVCDAGFLYDGQTCVKETECGCYD 1152          

HSP 3 Score: 135.961 bits (341), Expect = 8.435e-31
Identity = 109/351 (31.05%), Postives = 167/351 (47.58%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK-PGHHCKKAKDISYHSICGK-DWIRSLKAKKH--CGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCI 1252
            +  C A GDPHY T+D +   F G C Y L    +++ +   F + VQNE+RG N   +YTK V I    +VY L       +N QL  +P    +  V ++KS  F   V     ++V+F+  S AFV +   Y   + G+CG+ NG ++DD   K+G    N   K +  G S+ V++ PG  C +        +C   D  + ++ +K   CG++ +   PF  C  K  VD   FF+DCV D+C+ + R    + V C+  +     C   G     WR+   C ++C  ++H+   A+ CP +CE        P       EGC+C+ GYI  G  CV    C C+
Sbjct:  437 YSTCKATGDPHYVTFDNKKYDFQGTCVYQLAALCSKDTELTPFEVLVQNEHRGRN-VVSYTKLVQI----KVYSLN-----ILNDQLVNLPVSLVEGKVSVYKSGWF-AVVTTDFGLKVSFNWHSAAFVTLPSNYMGAVCGLCGNYNGNMQDDLTPKNG----NTPVKPTDFGTSWRVAEIPG--CIEG----CQGVCPSCDITQKVQYEKEDLCGIIRDTKGPFRDCHAK--VDPAGFFEDCVYDVCMYEGR----KDVLCQAVTAYTSACQGVGVNVYSWRTSNFCAVKCPIHSHYDICASACPASCEGL---APPPGCRAHCEEGCSCDEGYILSGDQCVPFSQCGCL 757          

HSP 4 Score: 129.413 bits (324), Expect = 8.307e-29
Identity = 108/393 (27.48%), Postives = 180/393 (45.80%), Query Frame = 2
Query:  101 KEPCTNGTRNIRITTYVKDN-GVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKY-FTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSD-DVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLI--GNSYHVSKP--GHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLL-EPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            K+PC +    ++ T  V+    VC P  T T             C A GDPHY T+DG    F G C+Y +++     +    F+I  +N+ RG+    F     V I+ +       Q G + VNG+L  +P++  D +V +F+S      V  +  + V++D + +  +++   Y   + G+CG+ NG   D+ +  SG+ V+      S+I  G S+       GH C    + +  + C  D     K +  CG L  + N+ F  C  K  +D + F  +CV DMC+NK      +++ C+  +   + C + G     WR +FNCP+ C + +H+   A+PC  +C   F   K+ C      E C C+ GY+    +C+    C C
Sbjct: 1205 KDPCKDANCRVQETCRVEGGEAVCIPKYTST-------------CWAWGDPHYHTFDGFDFDFQGTCKYIISKTCGNLNGLVPFSITERNDNRGNAAVSFVREVDVFIYDYNITIRKNQVGQVTVNGELLNLPFQLGDNEVSVFQSGS-SAVVETKFGLIVSYDWNWHLVIKLPSSYYSSVCGLCGNFNGDTGDELQNPSGKAVA------SVIEWGKSWQTPDQDKGHPCWDTCEKNCPT-CDDDERELYKTQAFCGGLAAKTNSVFKICNSK--LDPQAFMNNCVYDMCLNKGD----KRMLCQALTSYNKQCRDEGIIIKDWRKEFNCPMNCQRFSHYEHCASPCQPSCP--FPEQKQTCSGAC-VEACVCDEGYVLSAGVCIPAKTCGC 1567          

HSP 5 Score: 128.257 bits (321), Expect = 1.559e-28
Identity = 97/349 (27.79%), Postives = 157/349 (44.99%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDD-PCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKD-ISYHSICGKDWIRSLKAKKHCGVLL-EPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTK--RPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A+GDPHYRT+DGQ   F G C Y + ++  ED    +F +  QNE RG ++  +Y   V + ++         + G ++V+  L  +P   ++  ++IF+S + +   A    + V +D   N  V +   YS K  G+CG+ NG  +DDF T SG   S         G+S+ V       +   D +     C +  +    +   CG++  + N PF  C     +D + + ++C  D+C+ K      ++  C      AE C  AG +   WR    C  +C  N+ +    + CP TC +    +K  RPC      E C C  G++  G+ CV    C C
Sbjct:   47 CWAMGDPHYRTFDGQRFDFMGTCTYVIAKNCGEDSRLTAFEVHAQNENRGSHR-VSYVGLVTVQVYDTTITAVRSETGRVRVDNSLWSLPIILNNGKLKIFQSGRSVVIEADF-GLMVRYDWTHNLVVTLPDTYSGKTCGLCGNFNGNPKDDFTTPSGTQASGAV----AFGSSWKVPGLVADPQCRNDCVGGCGSCTESQLNKWDSDLSCGIITRKENGPFKNC--HAIIDPKAYLENCKYDLCMGKGL----RQFLCNALETYAEACQAAGVQIGDWRGLAKCSPRCPANSKYELCGSACPATCSDPDAPSKCQRPCV-----ETCTCKEGFVLSGSECVPATKCGC 378          

HSP 6 Score: 122.479 bits (306), Expect = 8.819e-27
Identity = 99/349 (28.37%), Postives = 149/349 (42.69%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ--HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRK-FLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHF--FGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            KC A GDPHY ++DGQ   F G C Y L +   + ++    F +   N   G+ K  + TKSV + +  E          ++N  LS       D  R+  +R+    FV     ++V +D      V V   Y  KM G+CG+ N   RD+F+   G+   N        G S+ V  P H C   ++     +C K      +    CG++  P+ PF  C  K  +D   +  DCV D+C         +++ C         C  AG +   WRS   CP  C  N+H+   A+ C  TC +          C+     EGC C+ G++ DGA CV   +C C++
Sbjct: 2014 KCVASGDPHYTSFDGQRFDFQGTCVYVLAKVCDDNDNQLTPFTVTQGNAKYGNGK-VSVTKSVTVTVNNE----------ELNLPLSL------DKGRLTVTREGHNTFVRTDFGLKVLYDTVYYVEVIVPSTYQGKMCGLCGNYNKKDRDEFRLPGGKGTKNVNE----FGKSWVVDLPEHICGGCEEDC--PVCEKANAVLYEKLDSCGIMKAPDGPFQACHSK--IDPAAYVSDCVFDVCAAGGS----KEILCNSVQAYVLACQNAGVQIQPWRSSSFCPASCPPNSHYEVCADTCRGTCASFIQQLTCSESCF-----EGCECDAGFVFDGAQCVPLENCGCVH 2328          
BLAST of VWFD domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044715.1 (alpha-tectorin-like [Source:NCBI gene;Acc:105358719])

HSP 1 Score: 148.673 bits (374), Expect = 9.358e-35
Identity = 109/369 (29.54%), Postives = 174/369 (47.15%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYEL--GQKGVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVS---KPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            VC P+    Q +C++ ++  C  S  GDPHY T+D  V HF G C Y L++  +   P  + IE +NE+RG + + ++T+ V + ++ E  EL  G  G  KV G++   P+  +   V++++S  F   V+    + V++D  S+  + +   Y     G+CG+ N    DDF+T++G  VS+  +      NS+  S    PG  C+        + C            HCG+L   + PF+ C +   +  +NF Q CV D+C+       +Q + C+     A  C + G +   WR    C + C  N+HF  +A  CP TC N       P   LP +E C C+ GY+     CV    C C
Sbjct:  246 VCMPY--SFQFSCQTVQRRTCTIS--GDPHYYTFDDTVFHFQGTCTYVLSEQCQYGLP-YYRIEGKNEHRG-STHVSWTRLVKVFVYNETIELVKGNPGRAKV-GEVVSTPFTLNQGRVQVYQS-GFSVVVSTDFGLTVSYDTYSHVGISLPYTYQNATCGLCGNFNNQPGDDFQTRNGEVVSSDVD----FANSWRASGDEDPG--CEAQCRGLECAGCNAAQTALYNNNDHCGILQNSSGPFAACHQT--LPPQNFVQSCVYDLCIGGG----YQPILCQSLGVYASQCQQNGIQPASWRRPGFCEIPCPANSHFESQATGCPSTCVNPNSTQNCP---LPVQESCVCDTGYVLSAGQCVPYAQCGC 591          

HSP 2 Score: 99.3673 bits (246), Expect = 9.812e-20
Identity = 92/347 (26.51%), Postives = 136/347 (39.19%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQN-EYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIR---SLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            CSA GDPHY T+DG+   F G CRY L +  +       F++E +N  + G     T   +V +++                      P+  + ++ +F S  +  FV     + V +DG S           + M G+CG+ N    DDF +  G  V+         G ++ V  PG++       S    CG    R      A+  C V+   + P S C    +VD   FF DCV D+CV  N  +    + C         C  A      WR    C + C  N+H+      C  TC +    T +  C      EGC C+ G++R G  CV    C C
Sbjct:  985 CSASGDPHYLTFDGKTYDFQGTCRYVLAEVCHSSSGLHQFSVEAKNMPWNGLPVSITAEVAVTVNL----------------------PFVLNGNISVFAS-GYQTFVRTSFGLSVMYDGWSTV---------RNMCGLCGNFNDNPNDDFHSPDGAAVTTP----DAFGAAWKV--PGNY-------SCSDGCGSSCPRCTNDQAARVQCEVIQAADGPLSFCHE--HVDPAPFFSDCVFDVCVGGNARN---DLLCRAIETYVSACQSANARIYPWRQNTTCSINCPANSHYELCGTDCGHTCVSSTNATCEHAC-----SEGCFCDEGFVRSGTTCVPEESCGC 1276          

HSP 3 Score: 87.0409 bits (214), Expect = 5.203e-16
Identity = 76/306 (24.84%), Postives = 125/306 (40.85%), Query Frame = 2
Query:  167 CTPFRTKTQVNCESKRKD-FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNRE-DDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNK-------NRPSRWQK----VRCEIFSGLAEVCSEAGFEGIKW 1045
            CTP +  T  N +    D    C+  GDPHY T+DG + HF G C Y +T+     ++   F +   N +RG+N                        V  V+G    +P       ++     F+ F A    + V FDG S   V +S+ Y  K++G+CG+ NG   D K K    ++    ++   G+S+    P  HC+ +++ S                + C ++   + PFS C      D + FF  CV D+C+         +  S ++K    +   IFS L++ C +      +W
Sbjct: 1312 CTPAQQCTVRNGQLGCYDGMSTCTVWGDPHYITFDGALAHFQGTCSYIITETGSHGNNHTQFEVVATNNHRGNNH-----------------------VSFVDGSDVSLPTTVGGIAQVSTQGGFVVFNA--ADLIVQFDGQSTLLVRMSQHYQNKVSGMCGNFNGDPSDDKVKPSGTLAQNDTEF---GHSW--KSPNGHCRFSQEYS----------------ELCSIITNTSGPFSACHLHS--DPQPFFSSCVYDLCLYSPANGMLCSAVSAYEKTCTTITPIIFSALSDPCEQLNCAEHEW 1569          

HSP 4 Score: 78.9518 bits (193), Expect = 1.201e-13
Identity = 77/352 (21.88%), Postives = 133/352 (37.78%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVR---DDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSR-WQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +   +  C   G   Y+T+DG    + G C+  + +     D   FN+  +   +G   +  Y                    L +  Q ++V        R++ S                   D N F     ++ K       DCN G++   DDF+T  G  V + +    + G+S+       HC +  +        ++ + +  +  +CG+L  P+ PF+ C    N   +       +D+CV+  R S   +   C++      +C + G    +WR+   C   C  N+H       CP TC +  F     C D P ++GC CN G++ +G  CV P  C C
Sbjct:  644 RPNGYATCLIRGPGSYQTFDGLTYQYPGACKLIVAKVIGSSDHPHFNVSTEKVPQGQESFSNY--------------------LNIEAQGAKVTIGMDSSNRVWVS-------------------DYNIF-----QHPKP------DCNHGLKCPNDDFQTPDGTLVHSVQ----VFGDSWREGSLASHCVENTN--------RNIMTNFNSSDYCGILSSPHGPFTPCWPVVNPSQQ-------VDVCVDILRRSEDPESTLCQVLRDYVLMCQQKGVSLGEWRNTTGCAATCPSNSHSEVCGTSCPSTCPSLSF--PFSC-DTPCQDGCQCNDGFVLNGNRCVPPTSCGC 923          
BLAST of VWFD domain-containing protein vs. Ensembl Medaka
Match: zanl (zonadhesin [Source:NCBI gene;Acc:101162078])

HSP 1 Score: 145.976 bits (367), Expect = 9.265e-34
Identity = 102/342 (29.82%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSK-RYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+D +  +F G+C Y ++          F +   NE R ++   +Y K+V +++      + + GV++VNG    +P   + +V +F+S K    V+    V V +DG  N F+++   +Y  K+ G+CGD NG  +DDF+   G  ++N  N++   G+S++       C K  +    +I G +       + +CG+LL+ N+PF+ C   G V+  N+FQDC+ D+C  +      + + CE        C + G +   WR++  C L+C  N+H+   A+PC  TC          C      EGC C+ GY+     CVK   C C
Sbjct: 1415 CIASGDPHYTTFDKRKYNFMGNCSYVMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPVNPTPEVSVFQSGKHYT-VSMTFGVTVRYDG--NHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGT-MTNDANEF---GHSWNTDP----CNKQPNA---TIPGCEPGEQELYEGYCGILLDKNSPFAVC--HGKVNPNNYFQDCLFDLCELEGA----KPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPSNSHYEPCADPCQDTCSGKPSSCGGAC-----SEGCVCDPGYVLSAGKCVKSDSCGC 1730          

HSP 2 Score: 145.206 bits (365), Expect = 1.263e-33
Identity = 103/373 (27.61%), Postives = 163/373 (43.70%), Query Frame = 2
Query:  146 YVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQ-HNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYH-SICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINL 1258
            YV  +G C        V  + +  DF +C+  GDPHYRT+DG   H+ G   Y LTQ HN +       +  +N  RG NK  ++   + ++++       QK  + VNG+    P      + I  + K +Q       + V FDG S   + + + YS  + G+CG+ +G+  +   K    V    N++   G+S+ VS+     +   D  +  S C +  +    +   CG L +P  PFS C       +   +QDCV D+C         +++RC  +   A +C EAG +   WR Q  C L C  N+ ++   +PCP +C +        C      EGC C  G++     CV    C C  L
Sbjct: 3516 YVLSDGKCVSLDKCGCVGSDGEYHDFDRCTVSGDPHYRTFDGFTHHYQGPYTYVLTQDHNLQGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNVYGVDVRFLQKKTVLVNGERVTPPLSPVRGLTITMNSKQMQLTT-DFGLTVRFDGKSRGVI-LPRTYSNSVRGLCGNYDGITRNEYMKPDGTVVRDLNEF---GDSWRVSR---DTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAALPPQI---YQDCVFDLCAEDGS----EELRCASYEAYATICQEAGVKLGSWRQQLGC-LPCPANSTYTACMSPCPSSCAD--LAAPSECDATACVEGCQCAAGFVMSEGACVPYPECGCTFL 3870          

HSP 3 Score: 144.436 bits (363), Expect = 2.196e-33
Identity = 102/342 (29.82%), Postives = 165/342 (48.25%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSK-RYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+D     F G+C Y ++          F +   NE R ++   +Y K+V +++      + + GV++VNG    +P   + +V +F+S K    V+    V V +DG  N F+++   +Y  K+ G+CGD NG  +DDF+   G  ++N  N++   G+S++       C K  +    +I G +       + +CG+LL+ N PF+ C   G V+  N+FQDC+ D+C  +      + + CE        C + G +   WR++  C L+C  N+H+   A+PC  TC          C      EGC C+ GY+     CVK   C C
Sbjct: 2233 CIASGDPHYTTFDKHRYDFMGNCSYVMSGICNTTSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYT-VSMTFGVTVRYDG--NHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGT-MTNDANEF---GHSWNTDP----CNKQPNA---TIPGCEPGEQELYEGYCGILLDKNGPFAVC--HGKVNPNNYFQDCLFDLCELEGA----KPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSGKPSSCGGAC-----SEGCVCDPGYVLSAGKCVKRESCGC 2548          

HSP 4 Score: 144.436 bits (363), Expect = 2.490e-33
Identity = 102/342 (29.82%), Postives = 165/342 (48.25%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSK-RYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            C A GDPHY T+D     F G+C Y ++          F +   NE R ++   +Y K+V +++      + + GV++VNG    +P   + +V +F+S K    V+    V V +DG  N F+++   +Y  K+ G+CGD NG  +DDF+   G  ++N  N++   G+S++       C K  +    +I G +       + +CG+LL+ N PF+ C   G V+  N+FQDC+ D+C  +      + + CE        C + G +   WR++  C L+C  N+H+   A+PC  TC          C      EGC C+ GY+     CVK   C C
Sbjct:  435 CIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKAVHVYVHMVKISILKGGVVQVNGTNVNLPLNPAPEVSVFQSGKHYT-VSMTFGVTVRYDG--NHFMDIKVIKYQDKLCGLCGDYNGNSKDDFQKPDGT-MTNDANEF---GHSWNTDP----CNKQPNA---TIPGCEPGEQELYEGYCGILLDKNGPFAVC--HGKVNPNNYFQDCLFDLCELEGA----KPILCEAIEAYVNECQDRGVDIGPWRNETFC-LKCPPNSHYEPCADPCQDTCSGKPSSCGGAC-----SEGCVCDPGYVLSAGKCVKRESCGC 750          

HSP 5 Score: 121.324 bits (303), Expect = 2.128e-26
Identity = 101/346 (29.19%), Postives = 150/346 (43.35%), Query Frame = 2
Query:  221 FCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            F  C   GDPHY T+D     F G C YTL +  R D P  F++E +NE RG +   +Y K + + +      L +     VNG+    P+  S  + +  S +++  +     +RV +DG+ +A + V   Y  +M G+CGD +G   +DF    G    N  +     GNS+   +    C           C  +    +     CG + +P+ PF +C   G VD   FFQ CV DMC           V C+      + C  AG     WR+   C L C  N+ +S   + CP TC     G+   C D+   EGC C+ G+I     CV    C C++
Sbjct:  806 FQDCIVSGDPHYNTFDKNYYTFMGTCTYTLARTCRNDSP-WFSVEGKNEERGVSG-VSYLKKLYVTVNNITVTLMKSRTTLVNGKRVAFPHNPSPLMSLSLSGQYV-ILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVND----FGNSWQTEEDEDECSPGTTPDLD--CDPELEAEVTKPDKCGKIEDPSGPF-ECI--GVVDPEPFFQSCVYDMCQFNGE----LHVLCDQLQAYTDACQSAGVTVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLG-VVGSPG-CEDV-CVEGCECDPGFILSDDKCVPLKDCGCVD 1130          

HSP 6 Score: 119.783 bits (299), Expect = 6.649e-26
Identity = 100/343 (29.15%), Postives = 150/343 (43.73%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCIN 1255
            C   GDPHY T+D +   F G C YTL +  R D P  F++E +NE RG +   +Y K + + +      L +     VNG+    P+  S  + +  S +++  +     +RV +DG+ +A + V   Y  +M G+CGD +G   +DF    G    N  +     GNS+   +    C           C  +    +     CG + +P+ PF +C   G VD   FFQ CV DMC           V C+      + C  AG     WR+   C L C  N+ +S   + CP TC     G+   C D+   EGC C+ G+I     CV    C C++
Sbjct: 1790 CIVSGDPHYNTFDKKFYSFMGTCTYTLARTCRNDSP-WFSVEGKNEERGASG-VSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYV-ILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVND----FGNSWQTEEDEDECSPGTTPDLD--CDPELEAEVIKPDKCGKIEDPSGPF-ECI--GVVDPEPFFQSCVYDMCQFNGE----LHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLG-VIGSPG-CEDV-CVEGCECDPGFILSDDKCVPLKDCGCVD 2111          

HSP 7 Score: 117.472 bits (293), Expect = 3.735e-25
Identity = 103/374 (27.54%), Postives = 159/374 (42.51%), Query Frame = 2
Query:  191 QVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQG 1309
            ++ C    +D   C   GDPHY T+D +   F G C YTL +  R D P  F++E +NE RG +   +Y K + + +      L +     VNG+    P+  S  + +  S +++  +     +RV +DG+ +A + V   Y  +M G+CGD +G   +DF    G    N  +     GNS+   +    C           C  +    +     CG + + + PF +C   G VD   FFQ CV DMC           V C+      + C  AG     WR+   C L C  N+ +S   + CP TC     G+   C D+   EGC C+ G+I     CV    C C++        +   +W  +G
Sbjct: 2597 ELGCYPSSQD---CIVSGDPHYNTFDKKYYSFMGTCTYTLARTCRNDSP-WFSVEGKNEERGASG-VSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSGQYV-ILQTTFGLRVRWDGNHHAQISV-PSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVND----FGNSWQTEEDEDECSPGTTPDLD--CDPELEAEVTKPDKCGKIEDLSGPF-ECI--GVVDPEPFFQSCVYDMCQFNGE----LHVLCDQLQAYTDACQSAGATVHHWRAPDFC-LDCPANSSYSLCVSSCPETCLG-VVGSPG-CEDV-CVEGCECDPGFILSDDKCVSLKDCGCVDTSGTYHPFQVDDEWLLEG 2946          

HSP 8 Score: 116.701 bits (291), Expect = 5.774e-25
Identity = 80/279 (28.67%), Postives = 128/279 (45.88%), Query Frame = 2
Query:  230 CSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNC 1063
            CS  GDPHY T+D +  H+ G C YTLT+  N   D   F ++ QNE+RG N   +Y ++V+I+++      G+   ++VNG +   P      V+I+ S KF+   A    +RV FDG+ +A V +   YS  + G+C   +   DD         +N       +G+S+ V  P    +   +      C +      +    CG++ +PN  F  C     V    +F++CV DMC    +        C+     A++C+ AG   I WR+   C
Sbjct: 2989 CSVSGDPHYTTFDKRTHHYMGACSYTLTKLCNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINVYGMTVVFGKGRSVQVNGTVVVPPVSSISGVKIYFSGKFVVLEA-SFGLRVRFDGNHHADVTLPSSYSGLLCGMCNFNDNPTDDNLKPDNTPAANSNE----LGDSWAVPDP----RPCTNGGGQEECDEKVEEEAQKPTSCGMITDPNI-FKPC--HAVVPPEPYFENCVYDMCATGGQ----TVALCQALESYADICAAAGVN-IPWRNSTFC 3250          

HSP 9 Score: 77.0258 bits (188), Expect = 5.419e-13
Identity = 78/308 (25.32%), Postives = 123/308 (39.94%), Query Frame = 2
Query:  344 FNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYE-KSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCY-DLPER---EGCACNRGYIRDGALCVKPMHCKCI 1252
            F +  +NE RG  +  +Y +SV + +              +NG+  R P    +   ++  S  +   +     ++V FDG  +  + V   Y  K+ G+CG+ N    D   K  +  +    +   +GNS+        C+       H  C  +     KA+    +L   ++ F  C    + D   F  +C+ DMC         Q   C+     A+ C  AG   I WR+   C L C  N+H+S+   PCP TC + F     P +  LP     EGC CN GY+     CV    C C+
Sbjct: 3260 FRVVAKNEERGQPEA-SYVRSVKVFL--------------LNGRRVRTPLTIDTIGAKVITSGSY-SLLDTNFGLQVKFDGVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIE---LGNSWKSEGDSDPCQPDNRPDVHPNCTAEEEEQFKAQCEQVIL---SSSFRPCHSVVSPDA--FLGNCIYDMCEYNGM----QATLCDNVEAYAQACQSAGVT-ITWRNSTFC-LPCPPNSHYSDCTAPCPPTCSDLF-----PIFCHLPPTACVEGCECNAGYVLSDGKCVSLDKCGCV 3532          
BLAST of VWFD domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000006984.2 (pep primary_assembly:ASM223467v1:19:4974111:4986611:-1 gene:ENSORLG00000004509.2 transcript:ENSORLT00000006984.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 9.379e-32
Identity = 105/369 (28.46%), Postives = 166/369 (44.99%), Query Frame = 2
Query:  164 VCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEKSDD-VRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVS---KPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            VC P     Q +C++  +  C  S  GDPHY T+D +V  F G C Y L++  + + P  F +E +NE+ G+ +  ++T  V + ++ E  EL ++  G  KVNG     P+    D +++++S   +  V+    + VA+D      + +   Y     G+CG+ N    DD +T+ G  VS+      +  NS+  S    PG  C    +    + C            HCG+L   + PF+ C +   +  +NF   CV D+CV       +Q + C+     A  C + G +   WR    C + C  N+HF  +A  CP TC N       P   LP +E C C+ GY+     CV    C C
Sbjct:  465 VCMP--ASFQFSCQTVPRRTCTIS--GDPHYYTFDDKVFSFQGTCTYVLSEQCQNELP-YFRVEGKNEHFGNTR-VSWTGLVKVFVYNETIELVKRTTGKAKVNGNFVAAPFSLLQDRIQVYQSGMSM-IVSTDFGLMVAYDISYYLRISLPYTYQNATCGLCGNFNNQPGDDLRTRDGEVVSSDV----VFANSWRASGDEDPG--CDAQCEGLGCAGCTAAQTALYSNNDHCGILQNSSGPFAACHQT--LPPQNFVDSCVYDVCVGGG----YQPILCQSLGVYASQCQQNGIQPQNWRRPGFCEIPCPANSHFESQATGCPPTCVNPNSTQNCP---LPVQESCVCDTGYVLSAGECVPYAECGC 811          

HSP 2 Score: 111.309 bits (277), Expect = 2.073e-23
Identity = 97/344 (28.20%), Postives = 138/344 (40.12%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
             CSA GDPHY T+DG+   F G CRY L +  N       F++E +NE   +    + T  V + ++            KV+G    +P+  +  + +F S  +  FV     + V +DG S             M G+CG+ N    DDF T  G  V+         G ++ V  PG++       S    C  D      A+  C V+   + PFS C    +VD   F  DCV D+CV  N       + C         C  A      WR    C + C  N+H+      C RTC +    T +  C      EGC C+ G++R G  CV    C C
Sbjct:  117 TCSASGDPHYLTFDGKTYDFQGTCRYVLAEVCNSSSGLHQFSVEAKNEPL-NGLPVSITAEVAVTVWG----------YKVDGITRNLPFVLNGTISVFAS-GYQTFVRTSFGLSVMYDGWSTV---------GNMCGLCGNFNDNPNDDFHTPDGAAVTTP----DAFGAAWKV--PGNYTCSDGCGSSCPRCTND----QAARVQCEVIQAADGPFSFCHE--HVDPAPFVSDCVFDVCVGGN---AGNDLLCRAIETYVSACQSANVRIYPWRQNTTCSINCPANSHYELCGTDCGRTCASSTDATCEHAC-----SEGCFCDEGFVRSGTTCVPEGSCGC 419          

HSP 3 Score: 108.227 bits (269), Expect = 1.713e-22
Identity = 89/358 (24.86%), Postives = 153/358 (42.74%), Query Frame = 2
Query:  209 KRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNI---EVQNEYRG-DNKYFTYTKSVIIHMFREVYELGQK--GVLKVNGQLSRVPYEK-SDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKR--YSKKMNGICGDCNG-VRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSR-WQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
            +   +  C   G   Y+T+DG    + G CR  + +         FN+   +V N  +G  N+      +++I     + +  Q    V +V+GQL ++P+   S+ +RIF S      +  R S  +        FV V+    YS  + G+CG+ N    DDF+T +G  V + +    + G+S+       HC +   ++           +  + + CG+L  P+ PF+ C    +   +       +D+CV+  R S   +   CE+    A +C +      +WR+   C   C  N+H+      CP TC +  F       D P ++GC CN G++ +G  CV P  C C
Sbjct:  864 RPNGYATCWIRGPGSYQTFDGLTYQYPGACRLIIAKEMGLSGHPHFNVITEKVPNILQGFSNQILNSETNLLIFPIMTLEKFSQSCFHVFQVDGQLYKLPFTSGSNQIRIFHSNT--HSIILRTSFGLTVQTVWPHFVRVTAPVVYSSSLGGLCGNYNDEPNDDFQTPNGTLVHSSQ----VFGDSWREGSLASHCVENTVLN---------PLNYSSTEFCGILSSPHGPFTPCWPVVDPSQQ-------VDVCVDILRRSEDPESTLCEVLRDYALMCQQQEVSLGEWRNTTGCAATCPSNSHYELCGTSCPSTCPSLSFPFS---CDSPCQDGCQCNDGFVLNGNQCVPPTSCGC 1196          

HSP 4 Score: 108.227 bits (269), Expect = 1.787e-22
Identity = 96/344 (27.91%), Postives = 135/344 (39.24%), Query Frame = 2
Query:  227 KCSAVGDPHYRTYDGQVIHFYGDCRYTLTQH-NREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCN-GVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGT-KRPCYDLPEREGCACNRGYIRDGALCVKPMHCKC 1249
             CSA GDPHY T+DG+   F G CRY L +  N       F++E +NE             + + +  EV          V+G    +P+  +  + +F S  +  FV     + V +DG S             M G+CG+ N    DDF T  G  V+         G ++ V  PG++       S    C  D      A+  C V+   + PFS C    +VD   F  DCV D+CV  N       + C         C  A      WR    C + C  N+H+      C RTC +    T +  C      EGC C+ G++R G  CV    C C
Sbjct: 1257 TCSASGDPHYLTFDGKTYDFQGTCRYVLAEVCNSSSGLHQFSVEAKNEPW---------NGLPVSITAEV---------AVDGITRNLPFVLNGTISVFAS-GYQTFVRTSFGLSVMYDGWSTV---------GNMCGLCGNFNDNPNDDFHTPDGAAVTTP----DAFGAAWKV--PGNYTCSDGCGSSCPRCTND----QAARVQCEVIQAADGPFSFCHE--HVDPAPFVSDCVFDVCVGGNA---GNDLLCRAIETYVSACQSANVRIYPWRQNTTCSINCPANSHYELCGTDCGRTCASSTDATCEHAC-----SEGCFCDEGFVRSGTTCVPEGSCGC 1552          
BLAST of VWFD domain-containing protein vs. Planmine SMEST
Match: SMESG000040823.1 (SMESG000040823.1)

HSP 1 Score: 7522.93 bits (19518), Expect = 0.000e+0
Identity = 4026/4048 (99.46%), Postives = 4036/4048 (99.70%), Query Frame = 2
Query:    2 MWRQWLTLLIITLSFYQFAKATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCVLERKSRTIVINCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLXXXXXXXXXXXXXXXXXNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLXXXXXXXXXXXXFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSEXXXXXXXXXXXXXXVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYECCDXXXXXXXXXXXXRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATFCEISKKRWVKHVICKPPYKTKVCYPKHNRLVIKTYFYVVXXXXXXXXXXXXXXXXXXXXXXXXXRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINRRIEVCECEKTKKMKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSXXXXXXXXXXXXXXXTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPXXXXXXXXXXXXXXXXXXISTGLCTYVIRKYSVFIRKCKCYRKLIKVIKKERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKXXXXXXXXXLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXXXXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCXXXXXXXXXXXSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYLSECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP 12145
            MWRQWLTLLIITLSFYQF KATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLC+LERKSRTIVI CKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLTCMRTCCCRKSKRCTTCNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLGTKTGKCDKTTCFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSERFSKSKCKCRKFRCVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFY+CCDEKSSETTKCKKKRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEI SRIKATFCEISKKRWVKHVICKP YKTK+CYPKHNRLVIKTYFYVVINCKCKLKVSK VK CV+CPKTKIIRSACGPRG+KGRRYLNVTIKRY  TRQNKCKLIINRRIEVCECEK KKMKLCK+GQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSYRIVKCRCVRRVRYRTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPVKKVTKRKLRCRLRRRERISTG+CTYVIRKYSVFIRKCKCYRKLIKVIKKERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKYYIRRRYYRLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDT VQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTCDCKCRKNRKYRKCSRNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKR+RCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRKIYKYKIIKCKCRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDK QKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIR IFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTT+TDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCIDDIRIRTTIRSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKY+SECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP
Sbjct:    1 MWRQWLTLLIITLSFYQFTKATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCILERKSRTIVIKCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLTCMRTCCCRKSKRCTTCNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLGTKTGKCDKTTCFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSERFSKSKCKCRKFRCVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYKCCDEKSSETTKCKKKRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEINSRIKATFCEISKKRWVKHVICKPRYKTKICYPKHNRLVIKTYFYVVINCKCKLKVSKIVKTCVECPKTKIIRSACGPRGEKGRRYLNVTIKRYIPTRQNKCKLIINRRIEVCECEKNKKMKLCKNGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSYRIVKCRCVRRVRYRTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPVKKVTKRKLRCRLRRRERISTGVCTYVIRKYSVFIRKCKCYRKLIKVIKKERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKYYIRRRYYRLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTTVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTCDCKCRKNRKYRKCSRNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRRRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRKIYKYKIIKCKCRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKFQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRNIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTSTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCIDDIRIRTTIRSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYISECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP 4048          
BLAST of VWFD domain-containing protein vs. Planmine SMEST
Match: SMESG000040823.1 (SMESG000040823.1)

HSP 1 Score: 7518.7 bits (19507), Expect = 0.000e+0
Identity = 4019/4048 (99.28%), Postives = 4028/4048 (99.51%), Query Frame = 2
Query:    2 MWRQWLTLLIITLSFYQFAKATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCVLERKSRTIVINCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLXXXXXXXXXXXXXXXXXNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLXXXXXXXXXXXXFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSEXXXXXXXXXXXXXXVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYECCDXXXXXXXXXXXXRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATFCEISKKRWVKHVICKPPYKTKVCYPKHNRLVIKTYFYVVXXXXXXXXXXXXXXXXXXXXXXXXXRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINRRIEVCECEKTKKMKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSXXXXXXXXXXXXXXXTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPXXXXXXXXXXXXXXXXXXISTGLCTYVIRKYSVFIRKCKCYRKLIKVIKKERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKXXXXXXXXXLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXXXXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCXXXXXXXXXXXSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYLSECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP 12145
            MWRQWLTLLIITLSFYQF KATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLC+LERKSRTIVI CKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLTCMRTCCCRKSKRCTTCNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLGTKTGKCDKTTCFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSERFSKSKCKCRKFRCVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFY+CCDEKSSETTKCKKKRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEI SRIKATFCEISKKRWVKHVICKP YKTK+CYPKHNRLVIKTYFYVVINCKCKLKVSK VK C       I RSACGPRG+KGRRYLNVTIKRY  TRQNKCKLIINRRIEVCECEK KKMKLCK+GQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSYRIVKCRCVRRVRYRTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPVKKVTKRKLRCRLRRRERISTG+CTYVIRKYSVFIRKCKCYRKLIKVIKKERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKYYIRRRYYRLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDT VQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTCDCKCRKNRKYRKCSRNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKR+RCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRKIYKYKIIKCKCRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDK QKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIR IFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTT+TDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCIDDIRIRTTIRSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKY+SECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP
Sbjct:    1 MWRQWLTLLIITLSFYQFTKATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCILERKSRTIVIKCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLTCMRTCCCRKSKRCTTCNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLGTKTGKCDKTTCFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSERFSKSKCKCRKFRCVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYKCCDEKSSETTKCKKKRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEINSRIKATFCEISKKRWVKHVICKPRYKTKICYPKHNRLVIKTYFYVVINCKCKLKVSKIVKTCECPKTKII-RSACGPRGEKGRRYLNVTIKRYIPTRQNKCKLIINRRIEVCECEKNKKMKLCKNGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSYRIVKCRCVRRVRYRTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPVKKVTKRKLRCRLRRRERISTGVCTYVIRKYSVFIRKCKCYRKLIKVIKKERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKYYIRRRYYRLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTTVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTCDCKCRKNRKYRKCSRNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRRRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRKIYKYKIIKCKCRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKFQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRNIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTSTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCIDDIRIRTTIRSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYISECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP 4047          
BLAST of VWFD domain-containing protein vs. Planmine SMEST
Match: SMESG000040791.1 (SMESG000040791.1)

HSP 1 Score: 3664.39 bits (9501), Expect = 0.000e+0
Identity = 1954/4023 (48.57%), Postives = 2717/4023 (67.54%), Query Frame = 2
Query:   77 VCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCVLERKSRTIVINCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLXXXXXXXXXXXXXXXXXNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLXXXXXXXXXXXXFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSEXXXXXXXXXXXXXXVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYECCDXXXXXXXXXXXXRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATFCEISKKRWVKHVICKPPYKTKVCYPKHNRLVIKTYFYVVXXXXXXXXXXXXXXXXXXXXXXXXXRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINRRIEVCECEKTKKMKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSXXXXXXXXXXXXXXXTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPXXXXXXXXXXXXXXXXXXISTGLCTYVIRKYSVFIRKCKCYRKLIKVIKKERCC--KKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKXXXXXXXXXLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXXXXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCXXXXXXXXXXXSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYLSECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADC 12139
            +C   K+ K PC NG R +    Y++    C P  +KT  +C  K+K FCKCSA+GDP+Y+TYDGQV HFYG CRYT +++    DPCSFNIEVQN Y+ D+K F YTKSVIIHMF ++YELGQ   LKVN   +R+PYEK   V+I +SR  LQFVAP+C +RV FDGD+NA+V+VS RYS +MNG+CG+CNG  DD KTK G DVS ++NKYSL+GNSY+VS  G  C  AK++SY  +C K+W++  KAKK CG L+E ++PF +C  KG++ L+ F+++C+ID+C    +P RWQK RCE+FSGLA+VCS+ G   + WR    CPL+CGKN+H S  A  CP TCEN+FFGTK PCY+   +EGC CN+GYIRDG+LCVKP HC+CI++CVDRE SE C+ WK +G CK+ S+AM IICPKTCGFC+     CED L  ++CL+FR +GLC   FYKA+CGLTCNYDKC CGK++  VGKC+   NRI TTH KF RD +G CAK++  +++ CNC KVTK    CN CTG R + ++++ I  NKCV +K+++ EKC KC  + R   +CI NR IK T  F +L GC+ CV ++K  T  I CK+++  K D+ TC+++ K+I RRP+NC+C E V NR+  WCCNKKPK L P C+ G+IIHRTI+Y F  +GC P  KD IEIPKCK  ++  KGKC R   G  FCKA D   + K+N+ CKC+  KL   RTCCC+K +  TTCN  +GI T V   + L+KK  ++ C+R  K+ S TI+ KT+++ IKGKC +NCLRK+ I++KFR GC V  +F + + R+CCC PKQ + I CI + IV KV++R  K+N C +V+ +  KK + CP   VKE+KC++RR ++++T I Y ++KC+C +R  +  ++C  C YK   TK G C+K TC R  Y  FQN+ C+   K     CCC  R IK SYC+R    RY ++K+WEFN KLR+CI ++ + A  P C +   +KG CG  +KN+ K+IT  E  S   CKC+K   VTW  C CP+ K  K+ C G   +I E  + L K  +KC+     +R  V+CP + +   K ++KC+YK YTG MKP NC+C   W     Y+CC +    +   K  + I+TK   + +   ++ CI  V R ++AITC +Y+ + +T+CK G+YW+ T  Y V NCKC + R T  KVIC+CIP  T+KR C GAG + I TK+ LIN KCI  +K  F P +C  + D   KC+RKTG+ITV R+Y  +  CKCVR K T +VRCPCFRKDR+V+++C    +R +E+QR    K KCIWK IKS+ EDC+C R    T C +H  +R+    Y L+   T+ IPLQ+C K   +K + ++CNR Y  K C+ H+ IE +CIYEK NCRCVK C+ +  GPC+C+RLNKC +KC+ N ++++C  +K GR  C KS+    I EKC   KI+CKSCS+++NNG+++ C  T++ Y NC+CV+K +   +LCKC  D  +RP C+ NRK I+T SFY +KNHCV RKRQ F+ I+C  P ++    KCST Y L Y+ ++ CKCVK  I + NSKCC KP   K C K HW  T   F Q+PT +KLFP IKS + ATFC+  KK W K + C   Y    C+ K +RL IK ++Y V  CKC+LKV+ K + C  CPK K+IRS CGP    GRRY ++TI+ +R+ + NKC   I +R EVC CEK+K  + C  G+R+F TIWYNI TKP CKP++ K++ISI C+N GRKNKWI  + V CR  G +T+K+FER  +N K C+CK++ KS K+ ICCKP  F   CRNN  EHI I +  + LKC    S K   + C KP  EVVGNC+GKVIRYR  ++R V C+CV+ V YR  +K  D  +CV++ +W+ + IPYKLI+G+C     +I      C  L++FVD++I+ CTFKR +IGK  K+C C D V +T+ILNY+CC+K++V  +C  ++ KV T  SYRL+ FKC+PV K+ K  ++C L+  ER STG CTY I  YSVFIR CKCYRKL KVIKK  CC  KKP     CD+  G KI +  S+ H KDD C+K  +  S  INC R+ C+K E +C+K T+ + ++C  RK CKC++ KVKE + CCG  F WIK+ +C Q+++ +IR RYY LK     K C+AV+VKE + RC+CP   + M CV +    ++R  Y+LK  +C L  S+K++ +  CP+K   K+++ C++KTGW+ +VYRI YPK+CKC++K  + KEICICS+AFP+ KE+  CK    +V++KR+A CT+ +VKW+IIT  + I+HCKK K EIG CY+ + G A+SIRYD  VQYF K CRCQRKV+KRILKHC C+  H S +C+ N  +   +SY + +G C +++ ++  KVPC  KP I+K  C +NKYI+T+ T++ KNC+C  SI+RK+CDCKC ++RKYRKCS  Y I E+++ Y K+ C C ++KS  Q VP CPRFIV +KG C+ G    YRE+I+R+L ++ + C C VKEVK K IC C   +  +K C SN  ++E+W WK+N ++N+CE+YL SSN  P  C    I+  CN KTG  K++   YL++ C C K   V+K +CKC +  VLV+ G+C+ RP C RID YR E L   KC +   +  V CCC K + Y +CE +N+  + I + L   KCV+ EI+ S  LKCS +++    KC +NG+K   Y+++ L+NCKC+K  +    C+CRC+++  + IC  RKR ++TI   + L KCKC  K S    +I CP + S  S C+R R TNYW+ +TRT  + +N +C CV +    +KICRC+ N+K K++C+AK H  +  TKF VL+NGQC+R+  T  + ++C+GKWR+K+ SGC+P GFYG+KT+ YSKL+H+ C CKE++K+  CHCACSG   S VCV E+IH K++ YKI KCKCRQL RSE VS VKC+++RPKI KC+I++NRCV++V H+ PYTI C+C YR +    PC+TC C  +T +KC   SN  +I    C IL NG I+++V+   +E+ C  +  C+Q+TKC KK++TQ F C V +K NCKC+S+  ++ +PC CKP  ++ GKCNRKTCL+++TR  FHL+V   N+ KC ++ R Y+++CCCP N KDV+KC  NR  +K  ++ FDK +KTC+II+++ D TP+C+P V+ + GKC+K  CL       +++++C+C   + + +R+CCC +KD+ + KC+  + V   ++FVF+N KC + + + + ++ C+ S + R KCN  T  R ++ H +  +KC+C+  + VKE+ C C   TV +ICL  KGI+R I  SY+LNE+ N+CD+ ++NED+QI CN  ++  C  T     NG +++CTT W +R+GCKC EQ+ WIFSL HC K  ++ +C++N  V  KIYYVK+RS  K YDY+CV+K K++ + + LC + Y   + CI SF TYT+H++ R  CQC+P  K++RV C+C   K +  +C++  +IR T R+YKL CD K IP C+C+++D+ VD  ++CPDD+F E C+    +RTWTTYDI+NCKCVA+ +T++R DCK +IC D+L+  +C  IKK+GKC Q+N+Y QFLCP+TCGYCEKC    IKKYLS+C CK +AGK+ICSR  L+   +P G+KC    ++VE+ CDC+N L N  C KS++ G C   +I+ KCAYHCN  C+ C +N++YK CLQ G NKGKYE+LRI++FK++ +CFF RK+SYEG C+LC  +  K V SCF GKRFV+TK+V K   GTCK  E++ AYSC  CC +I+T+I  C + SRV+ I FW+N+KG C++ KV N Y C+ +C+ ++ V++ C+YNKQLV+KTWYSD +C+PH VYE+  C
Sbjct:    1 MCMAPKIIKGPCENGIRIVTTIKYLEVLRKCKPIESKTTESCGRKKKRFCKCSALGDPYYKTYDGQVFHFYGSCRYTFSKYKSVQDPCSFNIEVQNGYKSDDKTFPYTKSVIIHMFGQIYELGQGKTLKVNDNPTRIPYEKDKKVKISQSRDILQFVAPKCLIRVGFDGDANAYVQVSTRYSGQMNGLCGNCNGKHDDLKTKDGTDVSRRKNKYSLVGNSYNVSTTGKACAPAKEVSYEDLCDKNWLQYFKAKKFCGGLIEEDSPFKECENKGHIVLKQFYENCLIDLCSKTKKPKRWQKARCELFSGLADVCSDNGVAVLDWRKILVCPLKCGKNSHLSVNAKLCPETCENYFFGTKNPCYESSSKEGCNCNKGYIRDGSLCVKPTHCRCISICVDREKSENCKDWKSKGHCKQFSKAMKIICPKTCGFCQVKDETCEDYLRFKRCLKFRRQGLCTSAFYKAVCGLTCNYDKCGCGKKKTIVGKCNKHKNRIKTTHIKFVRDPRGICAKVVGYTYQVCNCKKVTKKVGSCNFCTGKRIVTMNVETINGNKCVTQKKIVFEKCKKCDLKSRFTEKCIANRVIKKTTIFNRLSGCFRCVKDQKFETREIKCKNSRIEKLDKRTCLKHIKVITRRPLNCKCVESVTNRKVVWCCNKKPKVLKPFCRKGKIIHRTIFYVFRNHGCQPAPKDKIEIPKCKQNKEKNKGKCHRLLKGVHFCKATDVTRISKVNNACKCVVEKLHHTRTCCCKKPRNYTTCNRLLGILTAVKVEHSLIKKADKFECLRKAKQTSTTIKQKTEYLEIKGKCHSNCLRKNKIVKKFRDGCTVKVQFVKFQTRICCCLPKQIRTIECIADCIVTKVFRREFKSNSCRKVLISNVKKSVVCPKPTVKETKCIFRRNKKRVTKIFYVVQKCRCVRRKLVKIEKCKDCLYKETKTKEGPCNKKTCQRVIYTNFQNKYCENSVKKSHSTCCCRQRPIKSSYCDRFTSYRYHVVKFWEFNPKLRSCISKTTKKAHRPICNKDKVIKGGCGTIKKNFRKLITIREIVSPLDCKCKKTEIVTWNRCSCPVGKTTKR-CVGETLEIIEVGFKLTKDESKCVANKSVKRQSVICPRVVRRHTKVLSKCSYKSYTGYMKPKNCKCTLHWNKVVLYKCCQKPKISSKCFKN-KTIITKITKFIVSKDKKKCIPSVIRKTVAITCPRYVNVEKTKCKKGIYWVTTTKYAVVNCKCVQTRKTGTKVICKCIPGHTIKRHCTGAGIKTITTKFTLINGKCIPAAKTEFNPTRCGGAVDKPGKCNRKTGMITVNRMYFEAVKCKCVRRKSTHSVRCPCFRKDRVVKKQCIN-MKRIVEVQRHKLHKSKCIWKTIKSFSEDCKCSRNSFKTECFKHAAFRSNFVNYQLRTVSTYQIPLQRCFKSNSQKTKPLLCNRDYSEKRCINHQLIETKCIYEKINCRCVKNCRMIKIGPCQCRRLNKCLQKCVNNRKFSICLTYKPGRISCEKSQKQTLIPEKCLPTKIQCKSCSVKRNNGIFKICIKTFYEYQNCECVKKQKPIHKLCKCDRDRNNRPYCLANRKAIDTISFYPIKNHCVERKRQTFLKIDCPAPVIKTDNGKCSTKYTLIYYEVKKCKCVKKVIEKTNSKCCRKPTINKMCSKDHWTFTQIHFQQKPTTLKLFPTIKSSVLATFCQTVKKNWRKRISCPKSYTITTCHVKTDRLEIKHFYYAVNGCKCELKVTTKFETCRPCPKKKVIRSKCGPIALMGRRYFDLTIRGWRKQKNNKCTSYIKKRKEVCLCEKSKNYEQCLQGKRVFTTIWYNIKTKPACKPSIEKRSISIPCYNNGRKNKWIPTKVVTCRRHGHFTVKHFERLEFNPKACTCKKVYKSTKIGICCKPCHFKTVCRNNNYEHISICQESKNLKCVKKLSKKIRTVTCEKPLKEVVGNCNGKVIRYRITTFRKVNCKCVKSVTYRNKIKPIDRRECVKN-TWKITRIPYKLIHGVCQRGKPQIISDSTVCIMLIKFVDRKINSCTFKRLYIGKTVKNCVCVDKVIRTEILNYKCCKKNIVKLSCMKDRVKVVTTTSYRLMGFKCYPVIKIAKADIKCHLKTEERKSTGKCTYKILNYSVFIRNCKCYRKLGKVIKKAHCCSHKKPFTKRLCDSLKGFKIIIQTSFHHKKDDTCVKFDKKTSIPINCKRLACSKIEGQCVKKTRNIQVFCFKRKGCKCVKVKVKELQTCCGKRFNWIKSDSCSQNRRDFIRTRYYALKFVPKTKLCQAVVVKETYKRCRCPSIASSMRCVKDNSYLIVRTSYVLKGNSCNLITSKKIIPVKKCPKKIITKIKETCNRKTGWKTIVYRITYPKNCKCLQKTFTKKEICICSIAFPNPKEKTSCKNHYIVVKEKRLASCTKTKVKWSIITNQLPILHCKKTKTEIGRCYKSKTGNAVSIRYDVVVQYFMKNCRCQRKVLKRILKHCTCKRTHSSIKCIGNKKIETTFSYVLVKGFCIKKINRNTIKVPCSLKPKISKFPCVKNKYIITRTTFALKNCQCAKSIQRKSCDCKCPRDRKYRKCSGKYFINEITVKYQKQKCICHKKKSTVQIVPVCPRFIVVSKGACIAGTFGSYREVIKRQLQQNKQKCHCKVKEVKHKTICGCPSKLINKKLCKSNVFIIEIWAWKINSKKNKCEKYLKSSNRKPIVCKSTKIQKTCNTKTGNGKEVTEKYLLKNCICHKSRSVRKYKCKCNETPVLVKRGRCSGRPKCSRIDYYRQESLRGEKCKRIDSKKIVTCCCPKNKFYDKCEKNNLFKITIDYKLVFDKCVRKEIKKSIKLKCSDRISKITGKCQRNGYKSVAYYRKSLKNCKCIKEKIKSQNCRCRCRKSSSKTICYPRKRSLRTIITNYILAKCKCQPKISETTRTISCPRDSSVSSNCLRKRGTNYWIVSTRTITFSLNGKCKCVSKTVVVNKICRCEINKKVKILCNAKAHETVIRTKFNVLKNGQCIRIVKTASKPVKCDGKWRIKTNSGCKPHGFYGIKTIIYSKLIHNNCNCKEVTKSVSCHCACSGPGFSKVCVNEKIHHKVFYYKIEKCKCRQLTRSERVSPVKCKRVRPKITKCQIIKNRCVRIVEHKDPYTIKCKCFYRTRFEQQPCQTCPCQNFTNRKCNRRSNNIIITTKECRILSNGWIKQNVKTTTQEVPCGVLPKCKQITKCRKKTLTQTFDCLVSYKDNCKCKSRNERKIHPCVCKPVLIQRGKCNRKTCLRSITRTKFHLIVSIYNEKKCVKKSRVYRERCCCPSNAKDVIKCYKNRLTKKIRKYQFDKVKKTCNIIKQNLDITPICKPAVKFVPGKCNKSTCLVTNKYFYKQIISCRCITTKKIAIRECCCRKKDYKEKKCLGRLLVTISHKFVFENSKCSESLKKNSFVVNCKASRIERLKCNPLTRKRKVKYHSFINKKCKCLPKLVVKEILCRCPKPTVRRICLAGKGIVRIINKSYRLNEKLNKCDEIVKNEDQQIKCNNKKRYSCIATKHIHSNGLYKRCTTIWNQRIGCKCIEQLQWIFSLSHCNKAQSSTQCVKNTTVKRKIYYVKQRSSNKKYDYRCVRKEKILPALQILCKKPYIEKSKCIKSFMTYTHHFYIRTSCQCIPRMKIHRVICACGRKKEISRKCVNGRKIRKTFRTYKLNCDNKMIPNCKCMYVDSNVDLRIRCPDDQFKEACIRGKGVRTWTTYDIKNCKCVADKRTNTRTDCKNTICHDILSGKRCRIIKKYGKCKQLNVYSQFLCPITCGYCEKCQPAKIKKYLSQCECKYVAGKKICSRKALITHSVPSGRKCPAKSKVVETFCDCTNELSNKFCLKSLKQGHCNQMKIKQKCAYHCNSHCRQCGKNQLYKSCLQEGKNKGKYEVLRIRFFKLKNSCFFTRKVSYEGRCKLCDTKPYKSVLSCFNGKRFVVTKFVKKLPYGTCKLQEKKEAYSCRGCCEDILTRISSCSNNSRVITIIFWSNVKGHCKRHKVTNVYNCDKKCSNVKFVKTNCVYNKQLVVKTWYSDSVCVPHVVYEVVRC 4019          
BLAST of VWFD domain-containing protein vs. Planmine SMEST
Match: SMESG000040791.1 (SMESG000040791.1)

HSP 1 Score: 3662.08 bits (9495), Expect = 0.000e+0
Identity = 1953/4018 (48.61%), Postives = 2715/4018 (67.57%), Query Frame = 2
Query:   92 KVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCVLERKSRTIVINCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLXXXXXXXXXXXXXXXXXNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLXXXXXXXXXXXXFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSEXXXXXXXXXXXXXXVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYECCDXXXXXXXXXXXXRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATFCEISKKRWVKHVICKPPYKTKVCYPKHNRLVIKTYFYVVXXXXXXXXXXXXXXXXXXXXXXXXXRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINRRIEVCECEKTKKMKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSXXXXXXXXXXXXXXXTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPXXXXXXXXXXXXXXXXXXISTGLCTYVIRKYSVFIRKCKCYRKLIKVIKKERCC--KKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIKTGNCGQHKKXXXXXXXXXLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEEGKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXXXXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPKVVQTQCXXXXXXXXXXXSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDKFNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKCHKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYLSECSCKMIAGKRICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRCGNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIEGACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCKNMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVNKYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADC 12139
            K+ K PC NG R +    Y++    C P  +KT  +C  K+K FCKCSA+GDP+Y+TYDGQV HFYG CRYT +++    DPCSFNIEVQN Y+ D+K F YTKSVIIHMF ++YELGQ   LKVN   +R+PYEK   V+I +SR  LQFVAP+C +RV FDGD+NA+V+VS RYS +MNG+CG+CNG  DD KTK G DVS ++NKYSL+GNSY+VS  G  C  AK++SY  +C K+W++  KAKK CG L+E ++PF +C  KG++ L+ F+++C+ID+C    +P RWQK RCE+FSGLA+VCS+ G   + WR    CPL+CGKN+H S  A  CP TCEN+FFGTK PCY+   +EGC CN+GYIRDG+LCVKP HC+CI++CVDRE SE C+ WK +G CK+ S+AM IICPKTCGFC+     CED L  ++CL+FR +GLC   FYKA+CGLTCNYDKC CGK++  VGKC+   NRI TTH KF RD +G CAK++  +++ CNC KVTK    CN CTG R + ++++ I  NKCV +K+++ EKC KC  + R   +CI NR IK T  F +L GC+ CV ++K  T  I CK+++  K D+ TC+++ K+I RRP+NC+C E V NR+  WCCNKKPK L P C+ G+IIHRTI+Y F  +GC P  KD IEIPKCK  ++  KGKC R   G  FCKA D   + K+N+ CKC+  KL   RTCCC+K +  TTCN  +GI T V   + L+KK  ++ C+R  K+ S TI+ KT+++ IKGKC +NCLRK+ I++KFR GC V  +F + + R+CCC PKQ + I CI + IV KV++R  K+N C +V+ +  KK + CP   VKE+KC++RR ++++T I Y ++KC+C +R  +  ++C  C YK   TK G C+K TC R  Y  FQN+ C+   K     CCC  R IK SYC+R    RY ++K+WEFN KLR+CI ++ + A  P C +   +KG CG  +KN+ K+IT  E  S   CKC+K   VTW  C CP+ K  K+ C G   +I E  + L K  +KC+     +R  V+CP + +   K ++KC+YK YTG MKP NC+C   W     Y+CC +    +   K  + I+TK   + +   ++ CI  V R ++AITC +Y+ + +T+CK G+YW+ T  Y V NCKC + R T  KVIC+CIP  T+KR C GAG + I TK+ LIN KCI  +K  F P +C  + D   KC+RKTG+ITV R+Y  +  CKCVR K T +VRCPCFRKDR+V+++C    +R +E+QR    K KCIWK IKS+ EDC+C R    T C +H  +R+    Y L+   T+ IPLQ+C K   +K + ++CNR Y  K C+ H+ IE +CIYEK NCRCVK C+ +  GPC+C+RLNKC +KC+ N ++++C  +K GR  C KS+    I EKC   KI+CKSCS+++NNG+++ C  T++ Y NC+CV+K +   +LCKC  D  +RP C+ NRK I+T SFY +KNHCV RKRQ F+ I+C  P ++    KCST Y L Y+ ++ CKCVK  I + NSKCC KP   K C K HW  T   F Q+PT +KLFP IKS + ATFC+  KK W K + C   Y    C+ K +RL IK ++Y V  CKC+LKV+ K + C  CPK K+IRS CGP    GRRY ++TI+ +R+ + NKC   I +R EVC CEK+K  + C  G+R+F TIWYNI TKP CKP++ K++ISI C+N GRKNKWI  + V CR  G +T+K+FER  +N K C+CK++ KS K+ ICCKP  F   CRNN  EHI I +  + LKC    S K   + C KP  EVVGNC+GKVIRYR  ++R V C+CV+ V YR  +K  D  +CV++ +W+ + IPYKLI+G+C     +I      C  L++FVD++I+ CTFKR +IGK  K+C C D V +T+ILNY+CC+K++V  +C  ++ KV T  SYRL+ FKC+PV K+ K  ++C L+  ER STG CTY I  YSVFIR CKCYRKL KVIKK  CC  KKP     CD+  G KI +  S+ H KDD C+K  +  S  INC R+ C+K E +C+K T+ + ++C  RK CKC++ KVKE + CCG  F WIK+ +C Q+++ +IR RYY LK     K C+AV+VKE + RC+CP   + M CV +    ++R  Y+LK  +C L  S+K++ +  CP+K   K+++ C++KTGW+ +VYRI YPK+CKC++K  + KEICICS+AFP+ KE+  CK    +V++KR+A CT+ +VKW+IIT  + I+HCKK K EIG CY+ + G A+SIRYD  VQYF K CRCQRKV+KRILKHC C+  H S +C+ N  +   +SY + +G C +++ ++  KVPC  KP I+K  C +NKYI+T+ T++ KNC+C  SI+RK+CDCKC ++RKYRKCS  Y I E+++ Y K+ C C ++KS  Q VP CPRFIV +KG C+ G    YRE+I+R+L ++ + C C VKEVK K IC C   +  +K C SN  ++E+W WK+N ++N+CE+YL SSN  P  C    I+  CN KTG  K++   YL++ C C K   V+K +CKC +  VLV+ G+C+ RP C RID YR E L   KC +   +  V CCC K + Y +CE +N+  + I + L   KCV+ EI+ S  LKCS +++    KC +NG+K   Y+++ L+NCKC+K  +    C+CRC+++  + IC  RKR ++TI   + L KCKC  K S    +I CP + S  S C+R R TNYW+ +TRT  + +N +C CV +    +KICRC+ N+K K++C+AK H  +  TKF VL+NGQC+R+  T  + ++C+GKWR+K+ SGC+P GFYG+KT+ YSKL+H+ C CKE++K+  CHCACSG   S VCV E+IH K++ YKI KCKCRQL RSE VS VKC+++RPKI KC+I++NRCV++V H+ PYTI C+C YR +    PC+TC C  +T +KC   SN  +I    C IL NG I+++V+   +E+ C  +  C+Q+TKC KK++TQ F C V +K NCKC+S+  ++ +PC CKP  ++ GKCNRKTCL+++TR  FHL+V   N+ KC ++ R Y+++CCCP N KDV+KC  NR  +K  ++ FDK +KTC+II+++ D TP+C+P V+ + GKC+K  CL       +++++C+C   + + +R+CCC +KD+ + KC+  + V   ++FVF+N KC + + + + ++ C+ S + R KCN  T  R ++ H +  +KC+C+  + VKE+ C C   TV +ICL  KGI+R I  SY+LNE+ N+CD+ ++NED+QI CN  ++  C  T     NG +++CTT W +R+GCKC EQ+ WIFSL HC K  ++ +C++N  V  KIYYVK+RS  K YDY+CV+K K++ + + LC + Y   + CI SF TYT+H++ R  CQC+P  K++RV C+C   K +  +C++  +IR T R+YKL CD K IP C+C+++D+ VD  ++CPDD+F E C+    +RTWTTYDI+NCKCVA+ +T++R DCK +IC D+L+  +C  IKK+GKC Q+N+Y QFLCP+TCGYCEKC    IKKYLS+C CK +AGK+ICSR  L+   +P G+KC    ++VE+ CDC+N L N  C KS++ G C   +I+ KCAYHCN  C+ C +N++YK CLQ G NKGKYE+LRI++FK++ +CFF RK+SYEG C+LC  +  K V SCF GKRFV+TK+V K   GTCK  E++ AYSC  CC +I+T+I  C + SRV+ I FW+N+KG C++ KV N Y C+ +C+ ++ V++ C+YNKQLV+KTWYSD +C+PH VYE+  C
Sbjct:    4 KIIKGPCENGIRIVTTIKYLEVLRKCKPIESKTTESCGRKKKRFCKCSALGDPYYKTYDGQVFHFYGSCRYTFSKYKSVQDPCSFNIEVQNGYKSDDKTFPYTKSVIIHMFGQIYELGQGKTLKVNDNPTRIPYEKDKKVKISQSRDILQFVAPKCLIRVGFDGDANAYVQVSTRYSGQMNGLCGNCNGKHDDLKTKDGTDVSRRKNKYSLVGNSYNVSTTGKACAPAKEVSYEDLCDKNWLQYFKAKKFCGGLIEEDSPFKECENKGHIVLKQFYENCLIDLCSKTKKPKRWQKARCELFSGLADVCSDNGVAVLDWRKILVCPLKCGKNSHLSVNAKLCPETCENYFFGTKNPCYESSSKEGCNCNKGYIRDGSLCVKPTHCRCISICVDREKSENCKDWKSKGHCKQFSKAMKIICPKTCGFCQVKDETCEDYLRFKRCLKFRRQGLCTSAFYKAVCGLTCNYDKCGCGKKKTIVGKCNKHKNRIKTTHIKFVRDPRGICAKVVGYTYQVCNCKKVTKKVGSCNFCTGKRIVTMNVETINGNKCVTQKKIVFEKCKKCDLKSRFTEKCIANRVIKKTTIFNRLSGCFRCVKDQKFETREIKCKNSRIEKLDKRTCLKHIKVITRRPLNCKCVESVTNRKVVWCCNKKPKVLKPFCRKGKIIHRTIFYVFRNHGCQPAPKDKIEIPKCKQNKEKNKGKCHRLLKGVHFCKATDVTRISKVNNACKCVVEKLHHTRTCCCKKPRNYTTCNRLLGILTAVKVEHSLIKKADKFECLRKAKQTSTTIKQKTEYLEIKGKCHSNCLRKNKIVKKFRDGCTVKVQFVKFQTRICCCLPKQIRTIECIADCIVTKVFRREFKSNSCRKVLISNVKKSVVCPKPTVKETKCIFRRNKKRVTKIFYVVQKCRCVRRKLVKIEKCKDCLYKETKTKEGPCNKKTCQRVIYTNFQNKYCENSVKKSHSTCCCRQRPIKSSYCDRFTSYRYHVVKFWEFNPKLRSCISKTTKKAHRPICNKDKVIKGGCGTIKKNFRKLITIREIVSPLDCKCKKTEIVTWNRCSCPVGKTTKR-CVGETLEIIEVGFKLTKDESKCVANKSVKRQSVICPRVVRRHTKVLSKCSYKSYTGYMKPKNCKCTLHWNKVVLYKCCQKPKISSKCFKN-KTIITKITKFIVSKDKKKCIPSVIRKTVAITCPRYVNVEKTKCKKGIYWVTTTKYAVVNCKCVQTRKTGTKVICKCIPGHTIKRHCTGAGIKTITTKFTLINGKCIPAAKTEFNPTRCGGAVDKPGKCNRKTGMITVNRMYFEAVKCKCVRRKSTHSVRCPCFRKDRVVKKQCIN-MKRIVEVQRHKLHKSKCIWKTIKSFSEDCKCSRNSFKTECFKHAAFRSNFVNYQLRTVSTYQIPLQRCFKSNSQKTKPLLCNRDYSEKRCINHQLIETKCIYEKINCRCVKNCRMIKIGPCQCRRLNKCLQKCVNNRKFSICLTYKPGRISCEKSQKQTLIPEKCLPTKIQCKSCSVKRNNGIFKICIKTFYEYQNCECVKKQKPIHKLCKCDRDRNNRPYCLANRKAIDTISFYPIKNHCVERKRQTFLKIDCPAPVIKTDNGKCSTKYTLIYYEVKKCKCVKKVIEKTNSKCCRKPTINKMCSKDHWTFTQIHFQQKPTTLKLFPTIKSSVLATFCQTVKKNWRKRISCPKSYTITTCHVKTDRLEIKHFYYAVNGCKCELKVTTKFETCRPCPKKKVIRSKCGPIALMGRRYFDLTIRGWRKQKNNKCTSYIKKRKEVCLCEKSKNYEQCLQGKRVFTTIWYNIKTKPACKPSIEKRSISIPCYNNGRKNKWIPTKVVTCRRHGHFTVKHFERLEFNPKACTCKKVYKSTKIGICCKPCHFKTVCRNNNYEHISICQESKNLKCVKKLSKKIRTVTCEKPLKEVVGNCNGKVIRYRITTFRKVNCKCVKSVTYRNKIKPIDRRECVKN-TWKITRIPYKLIHGVCQRGKPQIISDSTVCIMLIKFVDRKINSCTFKRLYIGKTVKNCVCVDKVIRTEILNYKCCKKNIVKLSCMKDRVKVVTTTSYRLMGFKCYPVIKIAKADIKCHLKTEERKSTGKCTYKILNYSVFIRNCKCYRKLGKVIKKAHCCSHKKPFTKRLCDSLKGFKIIIQTSFHHKKDDTCVKFDKKTSIPINCKRLACSKIEGQCVKKTRNIQVFCFKRKGCKCVKVKVKELQTCCGKRFNWIKSDSCSQNRRDFIRTRYYALKFVPKTKLCQAVVVKETYKRCRCPSIASSMRCVKDNSYLIVRTSYVLKGNSCNLITSKKIIPVKKCPKKIITKIKETCNRKTGWKTIVYRITYPKNCKCLQKTFTKKEICICSIAFPNPKEKTSCKNHYIVVKEKRLASCTKTKVKWSIITNQLPILHCKKTKTEIGRCYKSKTGNAVSIRYDVVVQYFMKNCRCQRKVLKRILKHCTCKRTHSSIKCIGNKKIETTFSYVLVKGFCIKKINRNTIKVPCSLKPKISKFPCVKNKYIITRTTFALKNCQCAKSIQRKSCDCKCPRDRKYRKCSGKYFINEITVKYQKQKCICHKKKSTVQIVPVCPRFIVVSKGACIAGTFGSYREVIKRQLQQNKQKCHCKVKEVKHKTICGCPSKLINKKLCKSNVFIIEIWAWKINSKKNKCEKYLKSSNRKPIVCKSTKIQKTCNTKTGNGKEVTEKYLLKNCICHKSRSVRKYKCKCNETPVLVKRGRCSGRPKCSRIDYYRQESLRGEKCKRIDSKKIVTCCCPKNKFYDKCEKNNLFKITIDYKLVFDKCVRKEIKKSIKLKCSDRISKITGKCQRNGYKSVAYYRKSLKNCKCIKEKIKSQNCRCRCRKSSSKTICYPRKRSLRTIITNYILAKCKCQPKISETTRTISCPRDSSVSSNCLRKRGTNYWIVSTRTITFSLNGKCKCVSKTVVVNKICRCEINKKVKILCNAKAHETVIRTKFNVLKNGQCIRIVKTASKPVKCDGKWRIKTNSGCKPHGFYGIKTIIYSKLIHNNCNCKEVTKSVSCHCACSGPGFSKVCVNEKIHHKVFYYKIEKCKCRQLTRSERVSPVKCKRVRPKITKCQIIKNRCVRIVEHKDPYTIKCKCFYRTRFEQQPCQTCPCQNFTNRKCNRRSNNIIITTKECRILSNGWIKQNVKTTTQEVPCGVLPKCKQITKCRKKTLTQTFDCLVSYKDNCKCKSRNERKIHPCVCKPVLIQRGKCNRKTCLRSITRTKFHLIVSIYNEKKCVKKSRVYRERCCCPSNAKDVIKCYKNRLTKKIRKYQFDKVKKTCNIIKQNLDITPICKPAVKFVPGKCNKSTCLVTNKYFYKQIISCRCITTKKIAIRECCCRKKDYKEKKCLGRLLVTISHKFVFENSKCSESLKKNSFVVNCKASRIERLKCNPLTRKRKVKYHSFINKKCKCLPKLVVKEILCRCPKPTVRRICLAGKGIVRIINKSYRLNEKLNKCDEIVKNEDQQIKCNNKKRYSCIATKHIHSNGLYKRCTTIWNQRIGCKCIEQLQWIFSLSHCNKAQSSTQCVKNTTVKRKIYYVKQRSSNKKYDYRCVRKEKILPALQILCKKPYIEKSKCIKSFMTYTHHFYIRTSCQCIPRMKIHRVICACGRKKEISRKCVNGRKIRKTFRTYKLNCDNKMIPNCKCMYVDSNVDLRIRCPDDQFKEACIRGKGVRTWTTYDIKNCKCVADKRTNTRTDCKNTICHDILSGKRCRIIKKYGKCKQLNVYSQFLCPITCGYCEKCQPAKIKKYLSQCECKYVAGKKICSRKALITHSVPSGRKCPAKSKVVETFCDCTNELSNKFCLKSLKQGHCNQMKIKQKCAYHCNSHCRQCGKNQLYKSCLQEGKNKGKYEVLRIRFFKLKNSCFFTRKVSYEGRCKLCDTKPYKSVLSCFNGKRFVVTKFVKKLPYGTCKLQEKKEAYSCRGCCEDILTRISSCSNNSRVITIIFWSNVKGHCKRHKVTNVYNCDKKCSNVKFVKTNCVYNKQLVVKTWYSDSVCVPHVVYEVVRC 4017          
BLAST of VWFD domain-containing protein vs. Planmine SMEST
Match: SMESG000040790.1 (SMESG000040790.1)

HSP 1 Score: 1839.31 bits (4763), Expect = 0.000e+0
Identity = 1302/3697 (35.22%), Postives = 1971/3697 (53.31%), Query Frame = 2
Query:   62 ATRYGVCQNTKVEKEPCTNGTRNIRITTYVKDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCRYTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQKGVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFVEVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSKPGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNVDLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRSQFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRGYIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICPKTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCNCGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVTKVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRRCIGNRSIKTTITFYKLKGCYLCVLERKSRTIVINCKSTKTVKRDRLTCVEYTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYYKFHRNGCVPHFKDVIEIPKCKPERKSIK-GKCVRKRHGRFFCKAIDFKLVRKLNSKCKCITRKLXXXXXXXXXXXXXXXXXNWRMGIQTVVTTRYRLVKKRHRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVIKRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCHKKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPGCQYKVLXXXXXXXXXXXXFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIKRSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKCGVERKNYIKIITTSEXXXXXXXXXXXXXXVTWKVCKCPLRKVVKKTCRGTFYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMI-AKTKRKNITKCTYKIYTGIMKPTNCRCKWVWRAEKFYECCDXXXXXXXXXXXXRFIVTKSITYQLISRRRPCIRRVKRSSIAITCKKYIRIRRT-RCKNGLYWIITNFYQVNNCKCGKVRTTRRKVICECIPSETVKRICIGAGHQKIVT-KYILI-NEKCIAHSKVTFYPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCFRKDRIVR-RRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSITRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVTKT-CVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNVRYNVCYRFKAGRKHCIKSRHDYPIREKC-PRRKIECKSCSLRKNNGVYRSCRITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRVKNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVK-ITIIRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATFCEISKKRWVKHVICKPPYKTKVCYPKHN-RLVIKTYFYVVXXXXXXXXXXXXXXXXXXXXXXXXXRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINRRIEVCECEKTKKMKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCFNKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSICCKPTKFIKRC-RNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEVVGNCHGKVIRYRTVSXXXXXXXXXXXXXXXTIMKRSDSIKCVRHMSWRRSHIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYPKHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCFPXXXXXXXXX-XXXXXXXXXISTGLCTYVIRKYSVFIRKCKCYRKLIKVIKKE-RCCKK--PKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCHRIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGS--LFKWIKTGNCG--QHKKXXXXXXXXXLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMTCVLNRYNKVIRYYYLL--KKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKKTGWRYVVYRIIYPKHCKCVEK-KHSFKEICICSVAFPSSKERIYCKKDNTIVRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIG------------------------------LCYRDRNG--------FAISIRYDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYSIKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCLVSIRRKTXXXXXXXXXXXXXXXXNYAILEVSIVYHKKHCRCVRRKSIQQFVPSCPRFIVKTKGPCVPGKTD--FYREIIRRKLVKDFKNCKCLVKEVKRKRICACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPKRTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKC-KKGLVLVEEG---KCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGHNMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRYFKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIR-KRFIKTITVTFHLKKCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNRCVCVPRVYKK-SKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRVANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISKTKRCHCACSGIPSSTVCVKERIHRXXXXXXXXXXXXRQLIRSENVSFVKCRKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCPQYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQVTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNRKTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQK-CCCPPNPKDVVKCIHNRKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKRITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKN--VSVVSKYRFVFKNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCIRSVKVKELRC-ICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRNEDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIFSLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSPRKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCS 10936
             ++  VC+   V+KEPC NG R + IT ++K+NGVC PF +KT + C  +RKDFCKCSAVG  HYRTYDGQ IHFYGDCRYTL+ +N   D CSFNIEVQN + G     +Y +S+IIHMF E YELG +  LK+      +PYEK  DVRIF S  F+QFVAP+CSVRVAF+G SNAF+ V+++YS KM+GICG+CNG  DD +TKSG+DVS  +N+++ I NSY V+  G +C  A  ISY +ICG  + R  K    C  +L   NPF KC ++  VDL++F+ DC++ +C+NKNRP + ++V+C+I  GLAE CSE+G  GI WRS F C  +CGKN HFS+K +PCPRTCENHF+GT+RPCYDLPEREGC CN+G+IRDGALCVKP+HCKC++LC DR++S+ CRKWKQ+G C++  E MN++CP+TCGFCK     CE+E+S ++CL FR KGLC+H+FY++ICGLTCN++KC CG +   VG CD +TN ITT H  + RDS+GRC K++  ++KAC+C K      RCN CTG R +     E+V  KCV R  +  E C +C +  R++ RC  ++ +   +TF +++GCY CV +++  +  + CKST  V+R    C +Y         NCRC+  +   + K CC  + K +   C+N   IH T + K  +  C P  K     P C P R +IK  +CVR R G F CKA D + +  +   CKC  + +   R CCCR+S +   CN + GI T +T  + LV     Y CVR E      I+F T++   KG C ANC R D I + FR GCK+   F  +  R CCC P++     C+    V   +KRILK NRC+ V  +  +  + CP      SKCV  R  + IT  SY++ KC+C ++  I     P C++KV+  +   C+  TC        Q E C+  TK+C  +CCCP +  + S+CN   G      K +++N+K   C  ++       KC +   +K +CG ER NY KI    E   K+ C C++   V WK CK P    V K CRG ++ ++   Y   K + KC+R   RR   V CP I  + + K I+KC +K +T   +  NC C      E  + CC +K   T     K+F V ++++Y+L S ++ C++ +  ++  I C  + R R+T R  +  Y IIT++++V NCKC K+RT  +K +  C+  +T K  CI     +  T  + L+ NEKC+          KC   Y V   C + T L +++R ++   NCKC  +K  +   C C +    VR  +C+  G RT  + + V     C W +  SY + CRC +  S T C+ H ++RT T    L+     A P  +CVK +   D  ++C R Y   T C+ HRK +V+C Y K NC+C   C+ V   PC CK L+KC  +CIKNV+Y+ C R++A    C+ ++   P+ E C   RK +C    +  N+ +Y  C   + +Y +C+CV+  +      KC     +   CVNN++ I TTSF    N CV R+ Q    I C R R R T       +++ Y+   NCKC+K I   +   K C      K+C ++ WV T  +   + T+ +L PEI + +K   C  + K   + VIC+  +K   C  +   +LV K  F  V     +  + +  + C  CP   +  +ACG     G  Y+ V  K +   ++ KC L   +  ++  C K   + +C++GQR F T  Y + +K  C+P +   AI I C+NKG+ N W  V+T  CRYPGEYTIK+FER  +N   C C+R KKS K  ICC   ++ + C R+  + +I IS  P  LKC      +   + C +    V+G+C G +IRYR  +++   CRC+++V+  +  K +D ++CV +M W+R+HI Y+LI   CVA+   IT+R I CS    + D RI+ C F RS+      +C+C     + + L+Y+CC+K + ++ C  +K     +  Y L++F+C PV++VTK  +  C +    RI TG CT+ + KY V  + CKC R L K I+   RC     PK   RC+A+TG+ + +  SY+     + I + +V +  +NC   KC    SRCI NT+T+   C  R+ C+C++  + +   CCG      W +TG CG  + K +Y   + + LK++   K C+ VL+  Q   C+ P  FT  +C+ +   K I   Y L  +   C   K + + L+  C +  KIK+    S + G+    Y+IIYP++CKC +K K    + C C    P+ +   YC K+   V + R  IC    + W I     +I +C   +I  G                                YR R G        +    RY+T +Q+F   C CQ K + +      C  +H  ++C+ +  +I  YSYSI +G CQ+ + +    +PC   P + KS C  NKY +T  +Y  +NC+C+   ++K C CKC  N++  +CSRNY + +++  Y K++CRC++ ++I+Q +P CP+++ +T G C P K++   YR++  R L K   +C+C V E  + +IC C++  EK+K C++N+ V +   W +N R+N+CE  L  S++    CPK      C  K  + K + T Y ++ C+C++   V+K +C C KK  VLV+ G    C+K    +R D Y+  ++   KCI  +++ K ICCC   +K + C   + V +  ++ L+   C K  I+ +  ++C + + V+ S+C   GFKI     + +RNCKC   +V +  C+C+C+ +   + C+   K++I+T    + L  C+CI+ K+   + IKCPS H+ VS C + +K N ++K    T Y +    +C  R ++K SKI  CK     +V C  KK   +     TV R  +CV + + +   I+C+ KWRL +   C   G +G +   Y KLV   C C  I+KT+ C C C+G      C  + I +  Y+YK+ KCKC ++++      + C     K   C     + VK V  R     NC+C      V  PCK         K+C+ ++N++VI    C +   G I     VK   + C +   C   ++CH  +  QK  C      NC C++K   +T PC C P  ++ GKCN KTCL+ + R    LV + N K KC  EK   K + CCC         C  N  I+    + F+  +K C    +  + TP C P +   +G CD+K C +RI  I+  L +C+C  +  V+++ CCC  +   + KC+ N  V+    Y       KC+  V +    I C          N   G  V +   Y  + CRC  +V     +C  C+P      C + KGI++   ++   +E    C + +  ++++I C + +  +   +  ++K G +   TTT + R+ CKCE      + L  C++     KC+ N  +  +I Y++ ++   NYDY CVKK + +     +C R+ + T   +   K+ TY   K   C+CVP   + +  C+
Sbjct:    1 MSQESVCRKASVKKEPCINGKRYVTITNFIKENGVCRPFTSKTNLYCGLERKDFCKCSAVGGLHYRTYDGQGIHFYGDCRYTLSNYNSGRDSCSFNIEVQNHFGGKQSVNSYARSIIIHMFGEKYELGPRRSLKIGNVKRSIPYEKDRDVRIFYSNDFVQFVAPKCSVRVAFNGKSNAFISVARKYSGKMSGICGNCNGRHDDLRTKSGKDVSKSKNRFARIANSYKVTNFGKNCLPAAQISYKNICGSHFYRQNKHSI-CQDILINKNPFKKCGKQAFVDLKSFYDDCLLVLCINKNRPHKIKRVQCQILEGLAEACSESGVPGIGWRSLFKCQKKCGKNQHFSQKVSPCPRTCENHFYGTQRPCYDLPEREGCECNKGFIRDGALCVKPVHCKCMSLCTDRKNSKSCRKWKQRGDCEKFQEPMNVLCPRTCGFCKIRNIACENEISTKRCLAFRRKGLCFHEFYRSICGLTCNFEKCKCGNDETIVGTCDKTTNIITTFHNSYTRDSKGRCVKLVRHTYKACDCPKDWVQTGRCNFCTGKRNVTSFYYEVVKYKCVLRSFIRYETCKRCLENARERLRCDNDKYLTKIVTFQRVQGCYDCVSDKRISSTEVKCKSTLIVRRK--GCDKYITKTMGLARNCRCQVSIRRWQEKECCLFRKKTI--HCKNKEFIHTTYFEKLIKAKCYPKTKYRFVTPAC-PVRNTIKRAECVRNRKGVFHCKADDIQEISGITKNCKCFRKFIRRPRICCCRESYKYQKCNRKFGILTTITVTFELVNSCGNYRCVRKEFSFCTRIKFTTKYTRRKGICQANCKRTDQIWKTFRDGCKIKTEFHEYSARTCCCHPERVIKKKCVFKTKVFTEFKRILKNNRCLDVQISRKETPVLCPAATEVTSKCV--RNAKTITKTSYYVHKCEC-RKLEISTVISPCCKFKVISERVLSCNLQTCLTSHITVSQGEDCEYRTKVCPVKCCCP-KPQRNSFCNPNTGQIVTSTKTFQYNKKCFKCSSKTSVKFSCIKCNKARVIKHRCGQERNNYRKITIIKEHLYKNSCSCKRTERVIWKCCKLPKSSTVTK-CRGNYFDVEITSYKFGKNKQKCIREINRRVHPVQCPPIKPQYETKPISKCKFKQFTYYYQIENCHCVKKSSHEILFSCCPKKRLITKCNAHKQF-VYRTLSYRLTSDKKKCLKYLATTTQLIQCGSHSRSRKTERKPDCTYAIITDYFKVRNCKCQKIRTKTQKKLWCCLKPKT-KFSCIANKTWRTTTIAFTLVNNEKCVKKKTNVDRVIKCQDPYSVVCPCGKWTNLKSIKRYFYNVVNCKC--KKRMIHFPCICHKVPNKVRYGKCNANGMRTARVFKSVLVGEHCKWHLFTSYQDCCRCSKNLSKTVCLAHSVWRT-TKISCLRRQAPGAYPHHQCVKSKMVYDIPVVCYRDYSYVTPCINHRKRKVQCSYRKVNCKCELSCRQVAVRPCPCKTLDKCRTQCIKNVKYSKCKRYRAEGMRCVLTKTALPLVEHCSSERKTKCTLGKVYINHCLYTLCFTKFSIYQDCRCVKDTKAISTCSKCRNPFVT-VSCVNNKQFITTTSFIPKNNKCVRRRSQTSKNIECPRWRARTTRRHGYYYHRITYYKNINCKCIKRICQEKYFRKQCPISKTKKQCIRNQWVYTFVNRQIQFTHRRLCPEIDTGMKEKICVENIKMKFQPVICRRDFKIIKCDVRRKLKLVEKHIFRPVNCQCKESTIIQTSRSCKNCPLPIVRETACGKINKNGIGYIFVYSKFWGINKEKKCVLKHEKTKKIGCCRKPHNIIVCENGQRKFKTFHYEVISK--CRPRVTVTAIPIHCYNKGQPNYWKHVKTTFCRYPGEYTIKHFERLKFNPVQCICQRQKKSVKTDICCGKDQYSRECRRDKNLVYITISHRPTNLKCVTHRRERIKNVSCPRDHRMVIGDCQGLLIRYRKTTFQTKNCRCLKKVKVYSRQKIADRVECVSNM-WQRTHIGYQLIRDRCVAKRPFITFRRITCSMAETYKDSRINNCDFWRSYYVNVVSNCRCVKKFVRKENLHYKCCKKPLEIRRCIRDKITAIYKTRYHLVNFRCHPVRRVTKIPVCCCHIPTVSRIFTGKCTFNLLKYLVIPKNCKCVRILKKTIRNLCRCADHLTPKTEQRCEAETGRHLTINTSYRCVNHKI-ITVTKVTAIPVNCDGRKCKNIYSRCIHNTQTIQQLCLRRQGCRCVKKLINQRNVCCGPRKDSTWTETGPCGIVKQKCHYRFVKTFALKLNVRTKICQPVLINHQHSICRIPNPFTVRSCLNHISIKKILVSYKLNVQNNVCDEIKKESVSLVPGCHKTIKIKLSVKVSNREGYCDAKYKIIYPRNCKCHQKIKFIRYKHCSCYKRQPTVQVNRYCLKNVIKVVETRSPICIISTINWVITKKFYRIRNCSHKQIIYGHRFRCGTSNYGGRHGSSGFTHRFFFHRSSTHSYRHRLGGRNSGRMRYCEQSRYETHLQWFVGNCVCQSKTLWQGPMCIRCLPSHEEERCMVSKKLITRYSYSIVKGTCQRSISRRTIHIPCSRSPRVVKSSCHNNKYTLTNISYFYRNCQCMSQAKKKVCHCKCPSNKQTIRCSRNYFLNKITTKYRKQNCRCIKSETIKQILPICPQYVPQTIGNC-PRKSNEHSYRKVTTRHLRKHESSCRCSVAEDVKLKICRCKEREEKQKLCINNNFVHQTLKWIINERKNKCELRLSKSHTEFVTCPKSFSSRSC--KKDIVKIVTTFYKLKNCRCIEHQNVEKFKCSCNKKASVLVKTGHCPSCSKFRDSIRFDTYKRSLVRGNKCIGIMEKRKEICCCRLPRKVRFCRLDHFVNLHFTYKLEGQTCRKERIKRNDFVRCQNGIRVEHSECRPRGFKIIYSIGQVVRNCKCHDHVVKQRYCKCKCRDSKVVRKCDCSGKQYIET-HYRYELSNCQCIKMKTKRFIPIKCPSSHTEVSKCKKGKKANEYVKIITETFYVIE---LCKCRQHQKRSKIICCKIEESKEVFCDTKKQVEVRRHFRTVFRYDKCVHLRDEKRVPIKCDEKWRLVNNPICHSDGQFGKENRIYQKLVFKNCGCSVITKTRICDCKCTGPSVIDRCGGDFILKHYYEYKLHKCKCMRILKKIERKPIHCDDKPSKKSPCIFNHGKYVKYVEKRRGVVSNCKCSINPITVIKPCKVECGDPIVKKRCKRATNQWVITTERCEVSECGCISYYNHVKTSLVFCEAKEECTPRSECHPVTNIQKIDCETTFLENCLCQTKREPKTGPCVCGPSSIQYGKCNVKTCLQEVFRVENKLVSIKNGKTKCHPEKTQIKDRVCCCVKKSATTETCTKNILIQTIKTYTFNDQEKQCEESTKINNRTPECGPEIETKRGLCDRKTCKRRIREIRSSLTDCKCNVKESVQVKLCCCDPEVKSEEKCVGNQLVTFFYTYSLSKDEEKCYVKVTKNAKEIPCPEDSTATSYIN---GHTVCQKTSYTLKNCRCEPTVTNVGCKCDDCRPRPETSYCDEAKGILQTTKSTANFDE-SGYCVRNVHEDEKEIKCLERKVVDLLASHIKDK-GFYDVTTTTSQRRIKCKCETDTFVQYKLRKCQESLEEVKCVNNKFIGKRISYIQTKTANSNYDYDCVKKEEKVEK-EVICPRNSSKT---VGGEKSLTYFVIKN--CECVPQYYIPKPSCN 3658          
The following BLAST results are available for this feature:
BLAST of VWFD domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZAN1.013e-3129.70zonadhesin (gene/pseudogene) [Source:HGNC Symbol;A... [more]
ZAN1.071e-3129.70zonadhesin (gene/pseudogene) [Source:HGNC Symbol;A... [more]
ZAN1.335e-3129.70zonadhesin (gene/pseudogene) [Source:HGNC Symbol;A... [more]
ZAN1.666e-3129.94zonadhesin (gene/pseudogene) [Source:HGNC Symbol;A... [more]
ZAN1.666e-3129.94zonadhesin (gene/pseudogene) [Source:HGNC Symbol;A... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T01D3.64.550e-1623.43pep chromosome:WBcel235:V:13716824:13720402:1 gene... [more]
T01D3.69.865e-1021.83pep chromosome:WBcel235:V:13716849:13720402:1 gene... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cv-24.646e-2028.81gene:FBgn0000395 transcript:FBtr0071610[more]
Hml4.147e-1526.09gene:FBgn0029167 transcript:FBtr0333020[more]
Hml4.586e-1526.09gene:FBgn0029167 transcript:FBtr0075753[more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zanl2.401e-3831.40zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-... [more]
si:dkey-239b22.14.566e-3527.43si:dkey-239b22.1 [Source:ZFIN;Acc:ZDB-GENE-131119-... [more]
si:ch211-39f2.34.147e-3426.88si:ch211-39f2.3 [Source:ZFIN;Acc:ZDB-GENE-131126-5... [more]
si:dkey-65b12.64.852e-3128.29si:dkey-65b12.6 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
si:dkey-65b12.61.849e-3028.80si:dkey-65b12.6 [Source:ZFIN;Acc:ZDB-GENE-060526-3... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000000752.13.416e-3830.83Fc fragment of IgG binding protein [Source:NCBI ge... [more]
ENSXETT00000000563.13.857e-3830.83Fc fragment of IgG binding protein [Source:NCBI ge... [more]
ENSXETT00000000615.14.004e-3830.83Fc fragment of IgG binding protein [Source:NCBI ge... [more]
ENSXETT00000000905.14.983e-3530.84IgGFc-binding protein-like [Source:NCBI gene;Acc:1... [more]
ENSXETT00000000951.16.447e-3530.84IgGFc-binding protein-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
9530053A07Rik3.093e-3529.71RIKEN cDNA 9530053A07 gene [Source:MGI Symbol;Acc:... [more]
9530053A07Rik3.093e-3529.71RIKEN cDNA 9530053A07 gene [Source:MGI Symbol;Acc:... [more]
Zan1.903e-3130.11zonadhesin [Source:MGI Symbol;Acc:MGI:106656][more]
Zan1.903e-3130.11zonadhesin [Source:MGI Symbol;Acc:MGI:106656][more]
Fcgbp1.544e-2828.90Fc fragment of IgG binding protein [Source:MGI Sym... [more]
back to top
BLAST of VWFD domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28983|ZAN_PIG7.037e-3228.72Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1[more]
sp|O88799|ZAN_MOUSE1.264e-3030.11Zonadhesin OS=Mus musculus OX=10090 GN=Zan PE=1 SV... [more]
sp|Q6ZWJ8|KCP_HUMAN1.493e-3029.12Kielin/chordin-like protein OS=Homo sapiens OX=960... [more]
sp|Q9Y493|ZAN_HUMAN1.719e-3029.94Zonadhesin OS=Homo sapiens OX=9606 GN=ZAN PE=2 SV=... [more]
sp|Q9Y6R7|FCGBP_HUMAN1.471e-2828.90IgGFc-binding protein OS=Homo sapiens OX=9606 GN=F... [more]
back to top
BLAST of VWFD domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1C9ZZN49.337e-17530.20Uncharacterized protein (Fragment) OS=Dugesia japo... [more]
A0A1I8HAX62.652e-10539.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JEH94.885e-10539.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GW138.969e-10340.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G0002.011e-10039.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053976.11.652e-3528.24pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zanl1.973e-3430.23zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-... [more]
zanl2.050e-3430.23zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-... [more]
zanl2.050e-3430.23zonadhesin, like [Source:ZFIN;Acc:ZDB-GENE-060131-... [more]
ENSAMXT00000034930.18.151e-3129.52pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000981.11.178e-3126.61pep scaffold:Pmarinus_7.0:GL476384:615201:646381:-... [more]
ENSPMAT00000005510.13.720e-3125.94pep scaffold:Pmarinus_7.0:GL476588:620363:669144:-... [more]
tecta7.004e-3129.02tectorin alpha [Source:ZFIN;Acc:ZDB-GENE-110411-12... [more]
ENSPMAT00000000971.11.318e-2825.35pep scaffold:Pmarinus_7.0:GL476384:436886:486709:1... [more]
ENSPMAT00000004575.14.356e-2726.88pep scaffold:Pmarinus_7.0:GL480782:524:24919:1 gen... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO418765.346e-2627.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330617.176e-2329.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441993.437e-1927.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418772.760e-924.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of VWFD domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006964.27.251e-3729.81alpha-tectorin-like [Source:NCBI gene;Acc:10535871... [more]
FCGBP4.630e-3528.03Fc fragment of IgG binding protein [Source:NCBI ge... [more]
ENSORLT00000044715.19.358e-3529.54alpha-tectorin-like [Source:NCBI gene;Acc:10535871... [more]
zanl9.265e-3429.82zonadhesin [Source:NCBI gene;Acc:101162078][more]
ENSORLT00000006984.29.379e-3228.46pep primary_assembly:ASM223467v1:19:4974111:498661... [more]
back to top
BLAST of VWFD domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040823.10.000e+099.46SMESG000040823.1[more]
SMESG000040823.10.000e+099.28SMESG000040823.1[more]
SMESG000040791.10.000e+048.57SMESG000040791.1[more]
SMESG000040791.10.000e+048.61SMESG000040791.1[more]
SMESG000040790.10.000e+035.22SMESG000040790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034930 ID=SMED30034930|Name=VWFD domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=12236bp
CATGTGGCGTCAATGGTTAACTTTGTTAATCATTACACTATCGTTTTATC
AATTTGCCAAAGCGACTCGATATGGAGTTTGTCAAAATACAAAAGTAGAA
AAAGAACCTTGTACAAATGGAACTCGAAATATTAGGATTACAACATACGT
TAAAGACAATGGAGTTTGTACACCATTTAGAACGAAAACACAAGTTAATT
GTGAATCGAAACGAAAAGATTTCTGCAAATGCAGCGCCGTTGGTGATCCT
CATTATCGAACATATGATGGCCAAGTCATTCATTTTTACGGCGACTGTAG
ATATACTTTGACGCAACACAACAGAGAAGATGATCCATGCTCCTTCAACA
TTGAAGTTCAAAATGAATACCGTGGAGACAATAAATATTTCACTTACACA
AAAAGTGTCATCATTCATATGTTCCGAGAGGTTTATGAACTAGGACAGAA
AGGAGTATTGAAGGTCAATGGTCAATTGAGTCGAGTACCGTATGAGAAAA
GTGATGACGTTCGGATATTTAAATCTCGTAAATTTTTGCAATTTGTTGCA
CCAAGATGTTCAGTCCGGGTGGCCTTCGACGGTGATTCTAACGCCTTTGT
AGAAGTGTCAAAACGATATTCTAAAAAAATGAACGGAATTTGCGGTGATT
GTAACGGAGTACGAGATGATTTTAAAACCAAATCTGGCCGAGATGTATCA
AATAAAAGGAACAAATACTCTTTGATTGGAAACAGCTATCACGTATCAAA
ACCTGGCCATCACTGTAAAAAAGCCAAAGATATTTCATACCACAGCATTT
GTGGTAAAGACTGGATAAGAAGTTTAAAAGCAAAGAAACATTGTGGAGTT
TTGTTGGAACCCAATAACCCTTTTAGCAAATGTGCTCGAAAGGGCAATGT
GGATTTAAGGAACTTCTTTCAGGATTGTGTTATTGATATGTGTGTAAACA
AAAACAGACCAAGTCGATGGCAAAAGGTGCGATGCGAAATATTTTCTGGT
TTAGCTGAAGTCTGTTCTGAAGCTGGTTTTGAGGGAATCAAATGGAGATC
GCAATTTAACTGTCCTCTTCAATGCGGTAAAAACGCACACTTTTCAGAAA
AAGCCAACCCCTGTCCAAGAACTTGTGAAAATCACTTTTTCGGTACGAAA
CGTCCATGCTACGATCTTCCCGAACGAGAAGGTTGTGCTTGCAATAGAGG
ATACATCAGAGACGGAGCTTTGTGTGTCAAACCAATGCATTGTAAATGTA
TAAATCTTTGTGTTGATAGAGAAAGTTCAGAAAAATGTAGAAAATGGAAA
CAGCAAGGACAGTGCAAAGAATTATCGGAAGCAATGAACATTATCTGCCC
AAAAACTTGTGGATTCTGTAAAGCAACAGCTGGACACTGTGAAGATGAGT
TAAGTGCGAGAAAATGCTTAGAATTCAGAAATAAAGGTTTGTGTTATCAC
GACTTCTATAAGGCAATTTGCGGACTTACTTGTAATTACGATAAATGTAA
TTGTGGCAAAGAGAGAATTTTTGTCGGAAAATGTGACATGTCAACAAATC
GCATTACAACAACTCATTATAAATTTGCCCGTGATTCCCAAGGAAGATGT
GCAAAAATAATCACCCAATCCCACAAGGCATGCAACTGCAATAAGGTAAC
AAAAGTAAGGAAGCGTTGCAATTTATGCACAGGAATTCGCAAAATAATAC
TCCACATCAAAGAAATTGTAGCGAACAAATGCGTTCGACGAAAAAGAGTA
ATTGTAGAAAAGTGCAACAAATGTCACAAAAGAATTCGCAAACAACGTCG
ATGCATTGGAAATAGGTCAATTAAAACAACAATAACCTTTTACAAACTCA
AAGGATGTTACCTATGCGTACTTGAAAGAAAATCCAGAACTATTGTAATA
AATTGCAAAAGCACTAAAACTGTTAAACGAGATAGACTAACCTGTGTTGA
ATATACAAAAATAATAAGAAGACGACCAGTTAATTGCAGATGTCGTGAAG
ACGTTATAAACCGCAGAAGAAAATGGTGCTGTAACAAGAAACCGAAACAT
TTGCCACCGAAATGTCAAAATGGAAGAATTATTCATCGGACTATTTATTA
CAAATTTCATCGAAATGGTTGTGTACCCCATTTCAAAGACGTCATTGAAA
TTCCAAAATGCAAACCAGAACGAAAAAGTATAAAAGGCAAATGCGTTCGT
AAAAGACATGGAAGATTTTTCTGTAAAGCCATTGATTTCAAACTTGTTCG
AAAGTTGAACAGTAAATGCAAATGTATCACTCGAAAATTAACATGCATGA
GAACATGCTGTTGCAGAAAATCTAAACGATGCACAACGTGCAATTGGAGA
ATGGGTATACAGACAGTTGTCACTACCAGATATCGCCTAGTAAAGAAAAG
ACATAGATACGTTTGTGTCCGATTCGAAAAAAGAGTTTCAAAAACAATAA
GATTTAAAACGCAATTCATCGTTATAAAGGGAAAATGTGGAGCAAATTGT
TTAAGAAAGGACACAATAATTCGAAAGTTTCGATACGGATGCAAAGTAAT
TAAGCGATTTTCTCGCCATGAAGTGCGATTGTGCTGTTGTCGGCCGAAAC
AACGAAAATTCATTTGTTGCATTGGAAATGATATAGTTGTGAAGGTTTAT
AAAAGAATCCTTAAAGCCAACCGATGTGTAAGAGTTGTGAAAACGTGTCA
CAAAAAGAGAATTCGCTGTCCTCCTAAAGTTGTCAAAGAATCCAAATGCG
TTTATAGAAGACGTAGGAGGAAAATAACAACAATTTCATATTTCTTGAAA
AAATGTAAATGTTTCAAACGAACAAGGATCTGCTACAAAAGATGCCCTGG
GTGTCAATACAAAGTACTTGGAACCAAAACAGGAAAATGTGATAAAACCA
CTTGTTTCAGAAGAACCTATATTTTCTTTCAAAACGAAAAGTGTCAAAAA
GGAACGAAGATCTGTGATTATAGATGTTGTTGTCCATTCCGAAAAATAAA
GCGATCTTATTGCAACAGATGCAACGGAATACGATATGATATTCTAAAAT
GGTGGGAATTCAATGAGAAATTGCGAACTTGTATACCTAGATCAAAACGA
ATTGCGTTTGTTCCGAAATGCAAAAGAGGCATCAAAGTGAAAGGAAAATG
TGGTGTCGAAAGAAAAAATTACATCAAAATTATTACAACGAGTGAAAGGT
TTTCCAAATCTAAATGCAAATGCCGAAAATTCCGTTGTGTTACTTGGAAA
GTTTGTAAATGTCCACTTCGAAAAGTAGTCAAAAAGACATGCAGAGGAAC
CTTTTATCAAATCAAAGAATACGAGTATCATTTAGATAAAATCCGAAATA
AATGCTTGAGAAGAACGATTCGTAGAAGAGATGGAGTGTTATGCCCAATG
ATTGCCAAAACTAAAAGAAAAAATATTACCAAATGCACTTATAAGATATA
CACGGGTATTATGAAACCCACAAATTGCCGTTGCAAATGGGTTTGGAGAG
CAGAAAAATTCTATGAATGTTGTGATGAAAAATCATCTGAAACTACCAAA
TGTAAAAAGAAGAGGTTCATCGTCACAAAGTCTATTACATACCAATTGAT
ATCAAGGAGGAGACCTTGCATCCGCAGAGTGAAACGATCTTCTATTGCAA
TCACGTGTAAAAAATACATCAGAATAAGAAGGACTCGATGCAAAAACGGA
TTATATTGGATAATTACAAATTTTTACCAAGTAAATAATTGCAAATGTGG
TAAGGTTCGAACGACAAGGAGAAAGGTTATTTGCGAATGTATTCCTTCGG
AAACCGTCAAACGGATTTGCATTGGCGCAGGACATCAAAAGATTGTCACA
AAATACATTTTGATCAATGAAAAATGCATAGCCCATTCGAAAGTTACTTT
CTATCCAAAAAAATGTCCTCCATCGTATGATGTTCGAAGCAAATGTGATC
GCAAAACTGGTCTCATAACTGTTCGTAGAATTTACCATGTCTCCAAAAAT
TGTAAATGTGTTCGAGAAAAGCTGACTCTTACTGTTCGTTGTCCTTGCTT
CCGAAAAGATCGAATTGTACGCCGCCGATGTGATAAGAAAGGTCGAAGAA
CGATAGAAATTCAAAGACGAGTGTCCTCAAAACGAAAATGCATTTGGAAA
GTTATCAAATCTTATTGGGAAGATTGCCGATGCCCACGACCTAGATCAAT
TACACGATGCGTTGAACATGGAATTTATCGAACAAAAACTACATTTTATC
TCTTGAAAGTTACTTTTACTCATGCAATTCCCCTTCAGAAATGTGTAAAA
TTTGAAAGAGAAAAAGACAGGAAAATTATATGCAATCGAGGCTATGTCAC
AAAAACTTGTGTTAGACATCGTAAAATAGAGGTAAGGTGCATATATGAAA
AACGAAATTGCCGATGCGTCAAATACTGCAAAACTGTAATTACGGGACCA
TGCAAATGCAAAAGGCTAAATAAATGCAGTGAAAAATGTATCAAGAATGT
CCGATACAATGTCTGCTATAGGTTTAAAGCCGGTCGAAAGCATTGTATAA
AATCTCGACACGATTATCCAATTCGTGAAAAATGTCCAAGACGCAAAATT
GAATGTAAATCTTGCTCGCTGAGAAAAAATAATGGAGTCTACCGATCCTG
TCGAATTACATATTTTGTGTACCATAATTGCAAGTGCGTTGAAAAACATA
GATATCGGCTACGATTGTGCAAATGTGGAGGAGACATAACTTCACGCCCA
AGATGCGTTAACAATAGAAAGGTAATTGAAACGACCAGCTTTTACAGAGT
TAAGAATCATTGTGTTGGAAGAAAACGACAACATTTTATTCTGATTAATT
GCTTCCGACCTCGTCTCCGAATTACTGAGTTGAAGTGTTCCACCAGTTAC
AAGCTAGAATATTTCTACCTTAGAAATTGTAAATGTGTCAAAATAACAAT
AATTCGGAAAAATTCAAAGTGCTGCATAAAACCAATTTTCACCAAGAAAT
GCAAAAAACATCATTGGGTTTTGACCATAAAATCATTCCATCAACGACCA
ACAAACATAAAACTATTTCCTGAAATAAAAAGTCGAATAAAAGCAACTTT
CTGTGAAATATCCAAAAAAAGGTGGGTGAAACACGTTATCTGTAAACCGC
CTTACAAAACCAAAGTCTGCTATCCAAAGCACAACAGACTCGTCATCAAA
ACCTATTTCTATGTCGTTATCAATTGCAAATGCAAGTTGAAAGTGTCGAA
AAAAGTTAAAATATGTGTGAAATGCCCAAAAACAAAAATTATTCGATCTG
CTTGCGGACCCAGAGGCGATAAAGGTCGCCGATACCTGAATGTGACCATT
AAAAGATACAGACAAACAAGGCAAAACAAATGTAAACTTATTATTAATCG
ACGAATTGAAGTATGCGAATGCGAAAAAACTAAAAAAATGAAATTATGCA
AAAGCGGACAAAGAATATTTATTACAATATGGTACAACATTGCCACAAAG
CCAGTTTGTAAGCCAACGTTGATAAAGAAAGCGATATCTATTTCATGCTT
CAATAAAGGACGTAAGAATAAATGGATTCTAGTAAGGACTGTCAGGTGCA
GGTACCCGGGTGAATACACAATAAAATATTTTGAACGAGATGTGTACAAC
TCTAAAACATGTTCTTGTAAAAGGATAAAAAAATCAAGAAAGGTCAGTAT
ATGTTGTAAACCAACAAAATTCATAAAACGATGCCGAAACAATGCAATCG
AACACATAAGAATATCAGAAGTACCCCGAGCTCTCAAATGCAACATTGTT
TCTTCAACCAAACGATTTCCTATAATTTGCCGAAAACCAAGAACAGAGGT
CGTTGGCAATTGTCACGGTAAAGTGATCCGATATCGAACTGTTAGCTACC
GAATTGTAAAGTGCCGATGTGTAAGAAGAGTGAGATATCGCACTATAATG
AAACGATCCGACAGCATAAAGTGCGTCAGACATATGAGCTGGAGGCGATC
ACACATTCCGTATAAGTTGATCAATGGTCTATGTGTCGCTCAACCAGCAA
GAATTACATATAGATACATTGGGTGCTCCAAGTTAGTAAGGTTCGTTGAC
AAGAGAATAGATGAATGCACATTTAAACGATCCTTCATTGGCAAATATCC
GAAACACTGTAAATGCACTGATTTTGTTAAGAAGACAAAAATACTGAATT
ACAGATGCTGCCAAAAAAGTGTTGTTATGAAAACTTGTGAGCATAACAAA
ACGAAAGTCACCACGAGAATCAGCTATAGGCTTTTGGATTTCAAATGCTT
CCCAGTGAAAAAAGTGACAAAACGTAAATTGAGATGCCGTCTTAGACGAA
GGGAACGAATATCAACTGGACTCTGTACATATGTTATCAGGAAATATTCT
GTCTTCATTCGAAAATGCAAATGCTACAGAAAGCTTATAAAAGTCATCAA
AAAGGAAAGATGCTGCAAAAAACCTAAAGTATCATATCGTTGTGATGCTA
AAACCGGCAAAAAAATATTTGTAACCATCAGTTACCAACATACCAAGGAT
GACGTCTGTATCAAACTGAGAAGAGTAGTATCCAACTTGATCAACTGTCA
CAGGATCAAATGTACAAAAACTGAAAGCCGTTGTATCAAAAACACGAAAA
CGGTATACATGTACTGCCATTTACGAAAAGCCTGTAAATGTATCAGGACA
AAAGTCAAGGAATTCCGACATTGTTGTGGATCGCTTTTCAAGTGGATCAA
AACCGGAAATTGTGGTCAACATAAAAAGTATTACATTCGCCGACGATATT
ATCGCTTGAAAATGGACAAAGCCGGCAAACGGTGTCGAGCTGTGCTGGTA
AAGGAACAATTCGTTCGTTGCAAGTGTCCAAAGTCATTTACGAAAATGAC
GTGCGTATTAAACCGATACAATAAGGTTATCAGATATTATTATCTTCTGA
AAAAAGGAACATGCTTTTTGAAAAAGTCCCAAAAACTTGTTTTGATTTCA
TCTTGTCCAGAAAAAACTAAAATTAAAGTCCGTGACCATTGCAGTAAGAA
AACTGGATGGCGTTACGTTGTGTACAGAATCATATATCCGAAACACTGCA
AGTGTGTGGAAAAGAAGCACTCATTCAAAGAAATTTGCATTTGTTCAGTT
GCTTTTCCAAGTTCAAAGGAACGAATATATTGCAAAAAGGATAATACAAT
TGTCCGAGATAAGCGAGTGGCGATATGCACCAGAAAACGAGTGAAATGGA
CAATTATAACGATTAGCATAAAGATCGTTCATTGTAAAAAGGTGAAAATA
GAAATTGGACTCTGCTATCGTGACAGAAACGGATTTGCTATTAGCATAAG
ATACGACACGAAGGTTCAATATTTCACCAAAAAGTGCCGTTGTCAAAGAA
AGGTTATCAAGAGAATATTGAAACATTGCGCTTGCCGTGCCAACCATCGC
AGCAAACAATGTGTTGCAAACTCTATAGTGATCAAAAATTACAGCTACTC
AATTAAACGTGGCCGATGTCAACAACGAGTCCGTAAATCCGTACGCAAAG
TTCCATGTCCAAATAAACCCAGCATTACCAAGTCTAAATGCAGAAGAAAC
AAGTACATCGTCACGAAACGAACATATAGCCGCAAAAATTGTCGCTGCCT
TGTGTCTATTCGTCGCAAAACTTGTGACTGTAAATGCCGTAAAAATAGAA
AATACAGGAAATGTTCCAGAAATTATGCAATTTTGGAGGTATCAATTGTA
TATCACAAAAAGCATTGCAGATGTGTGAGAAGGAAATCTATTCAACAGTT
TGTGCCAAGTTGTCCAAGATTTATTGTCAAAACCAAAGGTCCATGTGTAC
CTGGAAAGACTGATTTCTACCGAGAAATTATCCGAAGGAAATTGGTGAAA
GATTTCAAAAACTGCAAATGTCTAGTGAAAGAAGTAAAACGAAAACGAAT
TTGTGCATGCCGTAAAACTATCGAAAAACGAAAGCGCTGTGTAAGTAATC
ACAAAGTTGTCGAAGTATGGGGATGGAAAGTCAACAGACGCCGAAACCGA
TGCGAACGATATCTAGTCTCGTCTAATTCCGTACCTAAACGTTGTCCGAA
ACGAACTATTAGAATAATTTGCAATCCTAAAACTGGAGTGGAAAAGAAAA
TCATTACGACTTATCTAATAAGACAGTGTAAATGCTTGAAAAGGATCCGC
GTCAAAAAATCTCGATGCAAATGTAAGAAGGGTCTTGTACTAGTTGAGGA
AGGTAAATGTGCCAAACGTCCCGTGTGTGTACGAATCGACAAATATCGGT
ATGAGATTTTAGTGAAAGGAAAATGTATTAAGAAGTTAAAGGAGGTAAAA
GTCATTTGCTGTTGTGCTAAAAAGCAAAAATATAAGAGATGTGAAGGACA
TAACATGGTAACTGTCATTATCTCATTCACTTTAAAGTTGGGAAAATGTG
TGAAAAGCGAAATACGTACTTCAGCACATCTAAAATGTTCGTCAAAAGTG
ACAGTAAAGGAAAGCAAATGTGGTAAGAATGGCTTCAAAATAAGACGATA
CTTTAAAGAGAAACTCAGAAACTGTAAATGTGTCAAAAGAATGGTTGATG
AAGACAGATGTCAATGCCGATGTCAAAGAAATTTCAAACGAAAGATTTGC
AACATAAGGAAGCGATTTATTAAAACAATAACAGTAACTTTCCATTTGAA
AAAATGCAAATGTATAAGAAAAAAATCCACTGAAATCCTTTCAATTAAGT
GTCCAAGCGAGCATTCAAGCGTATCATTGTGTATCCGAATAAGAAAAACG
AACTACTGGTTGAAAACAACGAGAACGACAAGATATTTCGTCAACAACCG
ATGCGTTTGCGTTCCAAGAGTCTACAAAAAATCTAAAATTTGCCGATGCA
AGCGAAACAGAAAAACAAAAGTTATTTGCAGCGCTAAAAAACATGCATTA
ATATATGTAACAAAATTTACAGTTTTGAGGAATGGACAATGTGTGAGAGT
TGCTAATACGAGGATTCAAAGAATCAGATGTAATGGAAAATGGAGATTAA
AAAGTGAATCTGGATGTCAACCACGGGGATTCTATGGAGTGAAAACATTA
ACCTACAGCAAGCTGGTTCACGATAAATGTCGATGCAAAGAAATCTCGAA
AACAAAAAGATGCCATTGTGCATGCTCTGGAATTCCATCATCAACTGTAT
GTGTCAAGGAAAGAATCCATCGAAAGATATACAAATATAAAATAATTAAA
TGCAAATGTCGACAACTGATACGGTCAGAGAATGTTTCATTTGTGAAATG
CAGGAAAATACGCCCGAAAATTGGAAAATGCAAAATAGTACGCAATAGAT
GTGTAAAAGTCGTTGTCCACAGAATTCCTTACACAATCAACTGCCGATGC
CATTACAGAAGAAAGTTGGTGTACGTACCTTGCAAAACTTGTCGATGTCC
CCAATATACAACTAAAAAATGCCAGGCCTCCTCAAATAGATTTGTTATCA
AACGTCACATCTGTCATATACTTGGAAACGGTTTGATCCAAAAGAGCGTG
GAAGTTAAAATGAAAGAAATTCATTGCGTGTCAATTATGACTTGTCGACA
AGTGACAAAGTGCCACAAAAAATCAATGACCCAGAAATTCCTATGTCGGG
TGCCTCATAAAACAAACTGTAAATGCAGATCAAAAGAAGTTAAAAGAACA
TATCCATGCAAATGTAAACCGGATGAAATGAAAATCGGAAAATGCAACAG
GAAAACTTGTCTGAAAACCCTAACAAGAAAGATTTTCCACTTAGTTGTTT
TGACGAATAACAAAGTAAAATGTCAAGAGGAAAAACGATTTTACAAACAG
AAATGCTGCTGTCCACCCAATCCAAAAGATGTTGTTAAATGTATCCATAA
TAGAAAGATTCGAAAGACTGTCCGATTTGTATTCGACAAATCCCAAAAGA
CTTGCAGTATTATTCGAAGAAGCTTCGATGAAACGCCATTATGTCAACCA
CCAGTCAGAAAGATTAAGGGAAAATGTGACAAAAAGAGATGCTTAAAACG
AATAACCTCTATCAAAAGGAGACTGGTCAATTGTCAGTGTAGAAAACGAA
GAGATGTCAAACTACGAAAATGTTGTTGTTTGAGAAAAGATCATATCAAA
GTGAAATGCATTAAAAACGTTTCAGTCGTATCAAAATATAGATTTGTGTT
CAAAAATGGAAAATGTCATAAATTTGTCAATAGAATAAATCACATCATCA
AATGTCGAAGGTCCCATGTACATCGTGGAAAGTGTAATCTTCGAACTGGA
TTCCGAGTTCTTAGAATACACAAATATCGAAAGGAGAAATGCCGATGCAT
TCGATCAGTAAAGGTCAAAGAACTCCGTTGCATATGTAAGCCCAACACAG
TCAATCAAATCTGCCTCAAAGACAAAGGAATTATCCGAAAAATTTTCACG
TCATATAAACTCAACGAAAGACGAAACAGGTGTGACAAGTTTATCAGAAA
TGAAGATCGACAAATTTCCTGTAATAAAAATGAAAAAACCGAATGTTCTC
CAACGACACGTAGAGAAAAAAATGGAGCTTTTAGAAAATGCACAACGACT
TGGAAAGAAAGAGTCGGATGTAAATGTGAAGAACAAATACATTGGATCTT
TTCTTTGTTGCATTGCAAAAAACCCACAACGACAAGGAAATGCATAGAGA
ACAATATCGTTTCAACAAAAATATACTATGTCAAAGAACGATCACTAGTA
AAGAATTACGACTACAAATGCGTGAAAAAACGAAAAGTCATTGTTTCACC
GAGAAAGCTTTGTACAAGGTCATACACAACCACCACGGATTGCATCGATT
CCTTCAAAACTTATACTTATCATTATCATAAGCGGATCATGTGTCAATGC
GTTCCAATGACCAAAGTTTATCGAGTTAAATGTTCATGTGAAGGCCCAAA
AGTAGTCCAAACTCAATGCATAGACGACATTAGAATCAGAACAACAATTC
GATCCTATAAACTTCAATGCGACAGGAAACGAATCCCGACTTGCCGATGC
GTGTTTATTGATACTCAAGTTGATAAAGACGTCAAATGTCCGGATGATAA
ATTCAATGAGAAATGTGTACATGAAGCAATGATCAGAACATGGACAACAT
ATGACATCCAAAACTGTAAGTGCGTTGCGGAGTCTCAGACAGATTCTCGT
CCCGATTGTAAAGAATCAATTTGCAAAGATGTTTTGACAAATAATAAATG
CCACAAAATTAAAAAGTTTGGAAAATGCAATCAAATGAATATTTATTATC
AATTTTTGTGCCCATTGACTTGTGGTTATTGCGAAAAATGTGACAAACCG
GCAATTAAGAAATACCTCAGTGAATGTTCATGTAAAATGATTGCAGGAAA
AAGAATTTGCTCAAGATCTGTGCTCGTTATTGAATTTATTCCCGATGGAA
AGAAATGCAGAAAGGTCAAAAGAATTGTTGAAAGCTTATGTGACTGCTCG
AATATCTTACCGAACTCTGTTTGCGAGAAATCAATGAGAGACGGCCGTTG
TGGCAATCCACGAATTAGAGCCAAGTGCGCATATCATTGCAACCCTAAAT
GTCAGCATTGTGAAAGAAATAGAGTTTATAAAATCTGTTTACAAAGCGGG
CCAAACAAAGGAAAATATGAGATTTTACGAATCAAATATTTCAAAATTGA
AGGAGCATGTTTCTTTATAAGAAAAATTTCATATGAAGGAAGCTGTGAAC
TTTGCAGTAAGCGACGAACCAAAATTGTTACAAGTTGCTTTGAAGGGAAA
CGGTTTGTGATAACGAAATATGTTGTAAAACGTCGAGATGGCACATGCAA
AAATATGGAAAGAAGAGTCGCTTATTCATGCACTGATTGTTGTAATGAAA
TAATCACGAAAATTGGTGTTTGTGGTAGTCGATCAAGAGTTGTTATCATC
ACGTTTTGGGCTAACATTAAAGGATGTTGCCGCAAACAAAAAGTAGTGAA
CAAATACGCTTGCAATAATCGTTGCGCAAGAATTGAATCTGTCCAATCAA
GATGCATGTACAACAAACAGCTCGTCATTAAAACTTGGTATAGCGATAAA
ATGTGCCTGCCACATACTGTCTATGAACTCGCAGACTGCCATCCATGAAA
ATTCGGAAAACATTTACTTACTTTTATTTAACAACTTGATTAACTGTTAA
TAAATTTCTTGCAATAAAAAAAAAAGATCGGAAGAG
back to top

protein sequence of SMED30034930-orf-1

>SMED30034930-orf-1 ID=SMED30034930-orf-1|Name=SMED30034930-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4049bp
MWRQWLTLLIITLSFYQFAKATRYGVCQNTKVEKEPCTNGTRNIRITTYV
KDNGVCTPFRTKTQVNCESKRKDFCKCSAVGDPHYRTYDGQVIHFYGDCR
YTLTQHNREDDPCSFNIEVQNEYRGDNKYFTYTKSVIIHMFREVYELGQK
GVLKVNGQLSRVPYEKSDDVRIFKSRKFLQFVAPRCSVRVAFDGDSNAFV
EVSKRYSKKMNGICGDCNGVRDDFKTKSGRDVSNKRNKYSLIGNSYHVSK
PGHHCKKAKDISYHSICGKDWIRSLKAKKHCGVLLEPNNPFSKCARKGNV
DLRNFFQDCVIDMCVNKNRPSRWQKVRCEIFSGLAEVCSEAGFEGIKWRS
QFNCPLQCGKNAHFSEKANPCPRTCENHFFGTKRPCYDLPEREGCACNRG
YIRDGALCVKPMHCKCINLCVDRESSEKCRKWKQQGQCKELSEAMNIICP
KTCGFCKATAGHCEDELSARKCLEFRNKGLCYHDFYKAICGLTCNYDKCN
CGKERIFVGKCDMSTNRITTTHYKFARDSQGRCAKIITQSHKACNCNKVT
KVRKRCNLCTGIRKIILHIKEIVANKCVRRKRVIVEKCNKCHKRIRKQRR
CIGNRSIKTTITFYKLKGCYLCVLERKSRTIVINCKSTKTVKRDRLTCVE
YTKIIRRRPVNCRCREDVINRRRKWCCNKKPKHLPPKCQNGRIIHRTIYY
KFHRNGCVPHFKDVIEIPKCKPERKSIKGKCVRKRHGRFFCKAIDFKLVR
KLNSKCKCITRKLTCMRTCCCRKSKRCTTCNWRMGIQTVVTTRYRLVKKR
HRYVCVRFEKRVSKTIRFKTQFIVIKGKCGANCLRKDTIIRKFRYGCKVI
KRFSRHEVRLCCCRPKQRKFICCIGNDIVVKVYKRILKANRCVRVVKTCH
KKRIRCPPKVVKESKCVYRRRRRKITTISYFLKKCKCFKRTRICYKRCPG
CQYKVLGTKTGKCDKTTCFRRTYIFFQNEKCQKGTKICDYRCCCPFRKIK
RSYCNRCNGIRYDILKWWEFNEKLRTCIPRSKRIAFVPKCKRGIKVKGKC
GVERKNYIKIITTSERFSKSKCKCRKFRCVTWKVCKCPLRKVVKKTCRGT
FYQIKEYEYHLDKIRNKCLRRTIRRRDGVLCPMIAKTKRKNITKCTYKIY
TGIMKPTNCRCKWVWRAEKFYECCDEKSSETTKCKKKRFIVTKSITYQLI
SRRRPCIRRVKRSSIAITCKKYIRIRRTRCKNGLYWIITNFYQVNNCKCG
KVRTTRRKVICECIPSETVKRICIGAGHQKIVTKYILINEKCIAHSKVTF
YPKKCPPSYDVRSKCDRKTGLITVRRIYHVSKNCKCVREKLTLTVRCPCF
RKDRIVRRRCDKKGRRTIEIQRRVSSKRKCIWKVIKSYWEDCRCPRPRSI
TRCVEHGIYRTKTTFYLLKVTFTHAIPLQKCVKFEREKDRKIICNRGYVT
KTCVRHRKIEVRCIYEKRNCRCVKYCKTVITGPCKCKRLNKCSEKCIKNV
RYNVCYRFKAGRKHCIKSRHDYPIREKCPRRKIECKSCSLRKNNGVYRSC
RITYFVYHNCKCVEKHRYRLRLCKCGGDITSRPRCVNNRKVIETTSFYRV
KNHCVGRKRQHFILINCFRPRLRITELKCSTSYKLEYFYLRNCKCVKITI
IRKNSKCCIKPIFTKKCKKHHWVLTIKSFHQRPTNIKLFPEIKSRIKATF
CEISKKRWVKHVICKPPYKTKVCYPKHNRLVIKTYFYVVINCKCKLKVSK
KVKICVKCPKTKIIRSACGPRGDKGRRYLNVTIKRYRQTRQNKCKLIINR
RIEVCECEKTKKMKLCKSGQRIFITIWYNIATKPVCKPTLIKKAISISCF
NKGRKNKWILVRTVRCRYPGEYTIKYFERDVYNSKTCSCKRIKKSRKVSI
CCKPTKFIKRCRNNAIEHIRISEVPRALKCNIVSSTKRFPIICRKPRTEV
VGNCHGKVIRYRTVSYRIVKCRCVRRVRYRTIMKRSDSIKCVRHMSWRRS
HIPYKLINGLCVAQPARITYRYIGCSKLVRFVDKRIDECTFKRSFIGKYP
KHCKCTDFVKKTKILNYRCCQKSVVMKTCEHNKTKVTTRISYRLLDFKCF
PVKKVTKRKLRCRLRRRERISTGLCTYVIRKYSVFIRKCKCYRKLIKVIK
KERCCKKPKVSYRCDAKTGKKIFVTISYQHTKDDVCIKLRRVVSNLINCH
RIKCTKTESRCIKNTKTVYMYCHLRKACKCIRTKVKEFRHCCGSLFKWIK
TGNCGQHKKYYIRRRYYRLKMDKAGKRCRAVLVKEQFVRCKCPKSFTKMT
CVLNRYNKVIRYYYLLKKGTCFLKKSQKLVLISSCPEKTKIKVRDHCSKK
TGWRYVVYRIIYPKHCKCVEKKHSFKEICICSVAFPSSKERIYCKKDNTI
VRDKRVAICTRKRVKWTIITISIKIVHCKKVKIEIGLCYRDRNGFAISIR
YDTKVQYFTKKCRCQRKVIKRILKHCACRANHRSKQCVANSIVIKNYSYS
IKRGRCQQRVRKSVRKVPCPNKPSITKSKCRRNKYIVTKRTYSRKNCRCL
VSIRRKTCDCKCRKNRKYRKCSRNYAILEVSIVYHKKHCRCVRRKSIQQF
VPSCPRFIVKTKGPCVPGKTDFYREIIRRKLVKDFKNCKCLVKEVKRKRI
CACRKTIEKRKRCVSNHKVVEVWGWKVNRRRNRCERYLVSSNSVPKRCPK
RTIRIICNPKTGVEKKIITTYLIRQCKCLKRIRVKKSRCKCKKGLVLVEE
GKCAKRPVCVRIDKYRYEILVKGKCIKKLKEVKVICCCAKKQKYKRCEGH
NMVTVIISFTLKLGKCVKSEIRTSAHLKCSSKVTVKESKCGKNGFKIRRY
FKEKLRNCKCVKRMVDEDRCQCRCQRNFKRKICNIRKRFIKTITVTFHLK
KCKCIRKKSTEILSIKCPSEHSSVSLCIRIRKTNYWLKTTRTTRYFVNNR
CVCVPRVYKKSKICRCKRNRKTKVICSAKKHALIYVTKFTVLRNGQCVRV
ANTRIQRIRCNGKWRLKSESGCQPRGFYGVKTLTYSKLVHDKCRCKEISK
TKRCHCACSGIPSSTVCVKERIHRKIYKYKIIKCKCRQLIRSENVSFVKC
RKIRPKIGKCKIVRNRCVKVVVHRIPYTINCRCHYRRKLVYVPCKTCRCP
QYTTKKCQASSNRFVIKRHICHILGNGLIQKSVEVKMKEIHCVSIMTCRQ
VTKCHKKSMTQKFLCRVPHKTNCKCRSKEVKRTYPCKCKPDEMKIGKCNR
KTCLKTLTRKIFHLVVLTNNKVKCQEEKRFYKQKCCCPPNPKDVVKCIHN
RKIRKTVRFVFDKSQKTCSIIRRSFDETPLCQPPVRKIKGKCDKKRCLKR
ITSIKRRLVNCQCRKRRDVKLRKCCCLRKDHIKVKCIKNVSVVSKYRFVF
KNGKCHKFVNRINHIIKCRRSHVHRGKCNLRTGFRVLRIHKYRKEKCRCI
RSVKVKELRCICKPNTVNQICLKDKGIIRKIFTSYKLNERRNRCDKFIRN
EDRQISCNKNEKTECSPTTRREKNGAFRKCTTTWKERVGCKCEEQIHWIF
SLLHCKKPTTTRKCIENNIVSTKIYYVKERSLVKNYDYKCVKKRKVIVSP
RKLCTRSYTTTTDCIDSFKTYTYHYHKRIMCQCVPMTKVYRVKCSCEGPK
VVQTQCIDDIRIRTTIRSYKLQCDRKRIPTCRCVFIDTQVDKDVKCPDDK
FNEKCVHEAMIRTWTTYDIQNCKCVAESQTDSRPDCKESICKDVLTNNKC
HKIKKFGKCNQMNIYYQFLCPLTCGYCEKCDKPAIKKYLSECSCKMIAGK
RICSRSVLVIEFIPDGKKCRKVKRIVESLCDCSNILPNSVCEKSMRDGRC
GNPRIRAKCAYHCNPKCQHCERNRVYKICLQSGPNKGKYEILRIKYFKIE
GACFFIRKISYEGSCELCSKRRTKIVTSCFEGKRFVITKYVVKRRDGTCK
NMERRVAYSCTDCCNEIITKIGVCGSRSRVVIITFWANIKGCCRKQKVVN
KYACNNRCARIESVQSRCMYNKQLVIKTWYSDKMCLPHTVYELADCHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005509calcium ion binding
GO:0030246carbohydrate binding
Vocabulary: biological process
TermDefinition
GO:0006334nucleosome assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036084Ser_inhib-like_sf
IPR014853Unchr_dom_Cys-rich
IPR003582ShKT_dom
IPR001846VWF_type-D
IPR002919TIL_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001846von Willebrand factor, type D domainSMARTSM00216VWD_2coord: 66..229
e-value: 4.6E-23
score: 92.6
IPR001846von Willebrand factor, type D domainPFAMPF00094VWDcoord: 77..229
e-value: 1.6E-24
score: 87.0
IPR001846von Willebrand factor, type D domainPROSITEPS51233VWFDcoord: 76..297
score: 26.833
IPR014853Uncharacterised domain, cysteine-richSMARTSM00832c8_acoord: 274..355
e-value: 1.1E-4
score: 31.6
IPR003582ShKT domainSMARTSM00254ShkT_1coord: 462..500
e-value: 30.0
score: 4.7
coord: 419..457
e-value: 1.5E-5
score: 34.4
coord: 3740..3778
e-value: 2.7
score: 16.5
IPR003582ShKT domainPFAMPF01549ShKcoord: 420..456
e-value: 2.9E-6
score: 27.7
coord: 3741..3777
e-value: 0.14
score: 12.7
coord: 463..496
e-value: 4.6
score: 7.9
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 3741..3777
score: 8.378
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 420..456
score: 9.863
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 463..499
score: 7.769
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 357..414
e-value: 1.9E-7
score: 33.2
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 53..546
NoneNo IPR availablePANTHERPTHR11339:SF373coord: 53..546
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.91
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 354..416