G protein gamma domain-containing protein

Overview
NameG protein gamma domain-containing protein
Smed IDSMED30034920
Length (bp)246
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G protein gamma domain-containing protein (SMED30034920) t-SNE clustered cells

Violin plots show distribution of expression levels for G protein gamma domain-containing protein (SMED30034920) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G protein gamma domain-containing protein (SMED30034920) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G protein gamma domain-containing protein (SMED30034920) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30034920

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30034920SMESG000066557.1 SmedASXL_006695SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034920SMESG000066557.1 dd_Smed_v4_1237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30034920SMESG000066557.1 dd_Smed_v6_1237_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30034920SMESG000066557.1 SMED30020678smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30034920SMESG000066557.1 dd_Smed_v6_1237_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30034920SMESG000066557.1 dd_Smed_v6_1237_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30034920SMESG000066557.1 dd_Smed_v6_1237_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30034920SMESG000066557.1 dd_Smed_v6_1237_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G protein gamma domain-containing protein vs. Ensembl Human
Match: GNG7 (G protein subunit gamma 7 [Source:HGNC Symbol;Acc:HGNC:4410])

HSP 1 Score: 43.8986 bits (102), Expect = 5.203e-7
Identity = 23/57 (40.35%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   69 ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            I+Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    7 IAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVP-ASENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Human
Match: GNG3 (G protein subunit gamma 3 [Source:HGNC Symbol;Acc:HGNC:4405])

HSP 1 Score: 42.3578 bits (98), Expect = 2.675e-6
Identity = 21/58 (36.21%), Postives = 36/58 (62.07%), Query Frame = 3
Query:   66 GISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
             I Q +K+VEQL+ EA++ R  VS +  +++ Y D +  +D L++      +NPF+EK
Sbjct:   12 SIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT-SENPFREK 68          
BLAST of G protein gamma domain-containing protein vs. Ensembl Human
Match: GNG2 (G protein subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:4404])

HSP 1 Score: 42.3578 bits (98), Expect = 2.858e-6
Identity = 22/59 (37.29%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQL+ EA I+R  VS +  +++ Y + +  +D L++      +NPF+EK
Sbjct:    7 ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVP-ASENPFREK 64          
BLAST of G protein gamma domain-containing protein vs. Ensembl Human
Match: GNG2 (G protein subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:4404])

HSP 1 Score: 42.3578 bits (98), Expect = 2.858e-6
Identity = 22/59 (37.29%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQL+ EA I+R  VS +  +++ Y + +  +D L++      +NPF+EK
Sbjct:    7 ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVP-ASENPFREK 64          
BLAST of G protein gamma domain-containing protein vs. Ensembl Human
Match: GNG2 (G protein subunit gamma 2 [Source:HGNC Symbol;Acc:HGNC:4404])

HSP 1 Score: 42.3578 bits (98), Expect = 2.858e-6
Identity = 22/59 (37.29%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQL+ EA I+R  VS +  +++ Y + +  +D L++      +NPF+EK
Sbjct:    7 ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVP-ASENPFREK 64          
BLAST of G protein gamma domain-containing protein vs. Ensembl Celegans
Match: gpc-1 (Guanine nucleotide-binding protein subunit gamma [Source:UniProtKB/Swiss-Prot;Acc:P54406])

HSP 1 Score: 43.5134 bits (101), Expect = 2.491e-7
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
             EQL AEA I R+ VS   +E++ + ++NK  D LVSG  ++  NPFQEK
Sbjct:    8 TEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQH-NPFQEK 56          
BLAST of G protein gamma domain-containing protein vs. Ensembl Celegans
Match: gpc-1 (Guanine nucleotide-binding protein subunit gamma [Source:UniProtKB/Swiss-Prot;Acc:P54406])

HSP 1 Score: 43.5134 bits (101), Expect = 2.491e-7
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
             EQL AEA I R+ VS   +E++ + ++NK  D LVSG  ++  NPFQEK
Sbjct:    8 TEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQH-NPFQEK 56          
BLAST of G protein gamma domain-containing protein vs. Ensembl Celegans
Match: gpc-1 (Guanine nucleotide-binding protein subunit gamma [Source:UniProtKB/Swiss-Prot;Acc:P54406])

HSP 1 Score: 43.5134 bits (101), Expect = 2.491e-7
Identity = 24/50 (48.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
             EQL AEA I R+ VS   +E++ + ++NK  D LVSG  ++  NPFQEK
Sbjct:    8 TEQLCAEANIQRKKVSEVSKELLDFCEKNKTNDMLVSGPTDQH-NPFQEK 56          
BLAST of G protein gamma domain-containing protein vs. Ensembl Fly
Match: Ggamma1 (gene:FBgn0004921 transcript:FBtr0088645)

HSP 1 Score: 64.3142 bits (155), Expect = 2.290e-15
Identity = 28/61 (45.90%), Postives = 46/61 (75.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            S + QQ+ +VEQLR EAAI+R+ +S S  +M++Y+ E++ +D L++GF ++K NPF+EK  
Sbjct:    6 SSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSS 66          
BLAST of G protein gamma domain-containing protein vs. Ensembl Fly
Match: Ggamma1 (gene:FBgn0004921 transcript:FBtr0088647)

HSP 1 Score: 64.3142 bits (155), Expect = 2.290e-15
Identity = 28/61 (45.90%), Postives = 46/61 (75.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            S + QQ+ +VEQLR EAAI+R+ +S S  +M++Y+ E++ +D L++GF ++K NPF+EK  
Sbjct:    6 SSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSS 66          
BLAST of G protein gamma domain-containing protein vs. Ensembl Fly
Match: Ggamma1 (gene:FBgn0004921 transcript:FBtr0088646)

HSP 1 Score: 64.3142 bits (155), Expect = 2.290e-15
Identity = 28/61 (45.90%), Postives = 46/61 (75.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            S + QQ+ +VEQLR EAAI+R+ +S S  +M++Y+ E++ +D L++GF ++K NPF+EK  
Sbjct:    6 SSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSS 66          
BLAST of G protein gamma domain-containing protein vs. Ensembl Fly
Match: CG43324 (gene:FBgn0263029 transcript:FBtr0306907)

HSP 1 Score: 56.225 bits (134), Expect = 3.181e-12
Identity = 26/61 (42.62%), Postives = 41/61 (67.21%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            + + QQ+ +  QLR E  + R PVS +   M++YM E++++DCL+SGF  +K NPF+EK  
Sbjct:    3 ANLQQQRSINLQLRREVEMERMPVSVACSLMMKYMLEHEEEDCLLSGF-TQKVNPFREKSS 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Fly
Match: Ggamma30A (gene:FBgn0267252 transcript:FBtr0336620)

HSP 1 Score: 45.0542 bits (105), Expect = 7.948e-8
Identity = 21/54 (38.89%), Postives = 38/54 (70.37%), Query Frame = 3
Query:   81 KKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKG 242
            KK +E ++ +A++ R P+S S+ EM  +++EN+  D L++   +KK+NP+ EKG
Sbjct:    7 KKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINA-PDKKNNPWAEKG 59          
BLAST of G protein gamma domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-117i10.1 (si:dkey-117i10.1 [Source:ZFIN;Acc:ZDB-GENE-091204-371])

HSP 1 Score: 46.2098 bits (108), Expect = 5.167e-8
Identity = 22/62 (35.48%), Postives = 39/62 (62.90%), Query Frame = 3
Query:   54 Y*MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            Y  + + Q ++ VEQLR E  + R  +SA+ ++++QY  E++  D L++G A    NPF++K
Sbjct:    4 YCSNNVLQARRAVEQLRMETELQRIKISAAAEQLVQYCQEHRRADPLLTGIA-ASSNPFKDK 64          
BLAST of G protein gamma domain-containing protein vs. Ensembl Zebrafish
Match: gngt1 (guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7596])

HSP 1 Score: 45.8246 bits (107), Expect = 7.248e-8
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            M+ + + K  V QL+ E  + R  VS   +E+ +Y+    D+D LV G   +K NPF+EKGG
Sbjct:    9 MTDLDKAKMEVTQLKTEVKLERAKVSKCCEEITEYIQGGADEDPLVKGIPEEK-NPFKEKGG 69          
BLAST of G protein gamma domain-containing protein vs. Ensembl Zebrafish
Match: gngt1 (guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7596])

HSP 1 Score: 45.8246 bits (107), Expect = 7.248e-8
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            M+ + + K  V QL+ E  + R  VS   +E+ +Y+    D+D LV G   +K NPF+EKGG
Sbjct:    9 MTDLDKAKMEVTQLKTEVKLERAKVSKCCEEITEYIQGGADEDPLVKGIPEEK-NPFKEKGG 69          
BLAST of G protein gamma domain-containing protein vs. Ensembl Zebrafish
Match: gngt1 (guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7596])

HSP 1 Score: 45.8246 bits (107), Expect = 7.248e-8
Identity = 24/62 (38.71%), Postives = 36/62 (58.06%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            M+ + + K  V QL+ E  + R  VS   +E+ +Y+    D+D LV G   +K NPF+EKGG
Sbjct:    9 MTDLDKAKMEVTQLKTEVKLERAKVSKCCEEITEYIQGGADEDPLVKGIPEEK-NPFKEKGG 69          
BLAST of G protein gamma domain-containing protein vs. Ensembl Zebrafish
Match: gng7 (guanine nucleotide binding protein (G protein), gamma 7 [Source:ZFIN;Acc:ZDB-GENE-040718-93])

HSP 1 Score: 44.669 bits (104), Expect = 1.725e-7
Identity = 23/57 (40.35%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   69 ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            I+Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    7 IAQARKLVEQLRIEAGIERIKVSKAAADLMSYCEQHARSDPLLVGVPT-SENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Xenopus
Match: gngt2 (guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 [Source:NCBI gene;Acc:100124867])

HSP 1 Score: 47.7506 bits (112), Expect = 1.363e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            VEQL+ E    R P+S S+ EM  Y++ +  +D L+ G  + + NPF+EKGG
Sbjct:   15 VEQLKKEVKTERAPISTSLSEMKTYIESHATEDPLIKGVPDDR-NPFKEKGG 65          
BLAST of G protein gamma domain-containing protein vs. Ensembl Xenopus
Match: gng7 (guanine nucleotide binding protein (G protein), gamma 7 [Source:NCBI gene;Acc:549887])

HSP 1 Score: 44.669 bits (104), Expect = 3.021e-7
Identity = 23/59 (38.98%), Postives = 37/59 (62.71%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    5 NNIAQARKLVEQLRLEAGIERIKVSKAAADLMNYCEQHAKNDPLLVGVPT-SENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Xenopus
Match: hsd11b2 (hydroxysteroid (11-beta) dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-1012826])

HSP 1 Score: 43.8986 bits (102), Expect = 5.674e-7
Identity = 24/52 (46.15%), Postives = 31/52 (59.62%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            VEQLR E    R  VS S+ E+  Y++ +  +D LV G    K NPF+EKGG
Sbjct:   15 VEQLRKEVKTERIMVSKSIPEIKSYIESHMSEDPLVKGVPEDK-NPFKEKGG 65          
BLAST of G protein gamma domain-containing protein vs. Ensembl Xenopus
Match: kdm1a (lysine (K)-specific demethylase 1A [Source:Xenbase;Acc:XB-GENE-5816927])

HSP 1 Score: 42.3578 bits (98), Expect = 1.872e-6
Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 3
Query:   60 MSG---ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            MSG   +S  KK+V QLR EA++NR  VS +  ++ Q+  +N   D L++G ++   NPF+ +
Sbjct:    1 MSGPANVSAMKKVVHQLRLEASLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSS-STNPFRPQ 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Xenopus
Match: gng2 (guanine nucleotide binding protein (G protein), gamma 2 [Source:NCBI gene;Acc:448567])

HSP 1 Score: 42.3578 bits (98), Expect = 2.591e-6
Identity = 22/59 (37.29%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQL+ EA I+R  VS +  +++ Y + +  +D L++      +NPF+EK
Sbjct:    7 ASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVP-ASENPFREK 64          
BLAST of G protein gamma domain-containing protein vs. Ensembl Mouse
Match: Gm5741 (predicted gene 5741 [Source:MGI Symbol;Acc:MGI:3645690])

HSP 1 Score: 44.2838 bits (103), Expect = 2.554e-7
Identity = 24/59 (40.68%), Postives = 33/59 (55.93%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            S I Q ++ VEQLR EA INR  VS +  +++Q+  E    D  + G      NPF+EK
Sbjct:    9 SDIGQARRAVEQLRMEAGINRIKVSKAATDLLQFCTEQAKSDPFLVGIP-AATNPFKEK 66          
BLAST of G protein gamma domain-containing protein vs. Ensembl Mouse
Match: Gng7 (guanine nucleotide binding protein (G protein), gamma 7 [Source:MGI Symbol;Acc:MGI:95787])

HSP 1 Score: 43.1282 bits (100), Expect = 7.638e-7
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 3
Query:   60 MSG---ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            MSG   ++Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    1 MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVP-ASENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Mouse
Match: Gng7 (guanine nucleotide binding protein (G protein), gamma 7 [Source:MGI Symbol;Acc:MGI:95787])

HSP 1 Score: 43.1282 bits (100), Expect = 7.638e-7
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 3
Query:   60 MSG---ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            MSG   ++Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    1 MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVP-ASENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Mouse
Match: Gng7 (guanine nucleotide binding protein (G protein), gamma 7 [Source:MGI Symbol;Acc:MGI:95787])

HSP 1 Score: 43.1282 bits (100), Expect = 7.638e-7
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 3
Query:   60 MSG---ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            MSG   ++Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    1 MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVP-ASENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Mouse
Match: Gng7 (guanine nucleotide binding protein (G protein), gamma 7 [Source:MGI Symbol;Acc:MGI:95787])

HSP 1 Score: 43.1282 bits (100), Expect = 7.807e-7
Identity = 25/63 (39.68%), Postives = 39/63 (61.90%), Query Frame = 3
Query:   60 MSG---ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            MSG   ++Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    2 MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVP-ASENPFKDK 63          
BLAST of G protein gamma domain-containing protein vs. UniProt/SwissProt
Match: sp|P38040|GBG1_DROME (Guanine nucleotide-binding protein subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=Ggamma1 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.296e-14
Identity = 28/61 (45.90%), Postives = 46/61 (75.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            S + QQ+ +VEQLR EAAI+R+ +S S  +M++Y+ E++ +D L++GF ++K NPF+EK  
Sbjct:    6 SSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSS 66          
BLAST of G protein gamma domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4VT26|GBG_CAEBR (Guanine nucleotide-binding protein subunit gamma OS=Caenorhabditis briggsae OX=6238 GN=gpc-1 PE=3 SV=1)

HSP 1 Score: 45.4394 bits (106), Expect = 6.835e-7
Identity = 24/53 (45.28%), Postives = 34/53 (64.15%), Query Frame = 3
Query:   81 KKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            K   EQLR EA I R+ VS   ++++++ ++NK  D LVSG  +   NPFQEK
Sbjct:    5 KTTTEQLRTEANIQRKKVSEVAKDLVEFCEKNKATDMLVSGPLD-AHNPFQEK 56          
BLAST of G protein gamma domain-containing protein vs. UniProt/SwissProt
Match: sp|P43425|GBG7_RAT (Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 OS=Rattus norvegicus OX=10116 GN=Gng7 PE=2 SV=2)

HSP 1 Score: 45.0542 bits (105), Expect = 8.071e-7
Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 3
Query:   60 MSG---ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            MSG   ++Q +KLVEQLR EA I R  VS +  E++ Y +++   D L+ G     +NPF++K
Sbjct:    1 MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVP-ASENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NFZ3|GBGE_DROME (Guanine nucleotide-binding protein subunit gamma-e OS=Drosophila melanogaster OX=7227 GN=Ggamma30A PE=1 SV=1)

HSP 1 Score: 45.0542 bits (105), Expect = 9.312e-7
Identity = 21/54 (38.89%), Postives = 38/54 (70.37%), Query Frame = 3
Query:   81 KKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKG 242
            KK +E ++ +A++ R P+S S+ EM  +++EN+  D L++   +KK+NP+ EKG
Sbjct:   15 KKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINA-PDKKNNPWAEKG 67          
BLAST of G protein gamma domain-containing protein vs. UniProt/SwissProt
Match: sp|P30671|GBG7_BOVIN (Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 OS=Bos taurus OX=9913 GN=GNG7 PE=1 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 1.220e-6
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   69 ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            I+Q +KLVEQLR EA I R  VS +  E++ Y +++   D L+ G     +NPF++K
Sbjct:    7 IAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVP-ASENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. TrEMBL
Match: Q8IT61 (Guanine nucleotide-binding protein subunit gamma; Trimeric G-protein gamma subunit OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.799e-28
Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            MS +SQQ+KLVEQLR EA +NRRPVS  VQEMI YM++N+DKDCLVSGFA+KKDNPFQEKGG
Sbjct:    1 MSTLSQQRKLVEQLRQEANLNRRPVSECVQEMIVYMEQNRDKDCLVSGFASKKDNPFQEKGG 62          
BLAST of G protein gamma domain-containing protein vs. TrEMBL
Match: A0A183WBU9 (G protein gamma domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS9602 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.949e-28
Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            MS +SQQ+KLVEQLR EA INRRPVS  VQ+MI YM++N+DKDCLVSGFA+KKDNPFQEKGG
Sbjct:    1 MSTLSQQRKLVEQLRQEANINRRPVSECVQDMIVYMEQNRDKDCLVSGFASKKDNPFQEKGG 62          
BLAST of G protein gamma domain-containing protein vs. TrEMBL
Match: A0A183JX55 (G protein gamma domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7300 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.917e-28
Identity = 48/62 (77.42%), Postives = 56/62 (90.32%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            MS +SQQ+KLVEQLR EA +NRRPVS  VQEMI YM++N++KDCLVSGFA+KKDNPFQEKGG
Sbjct:    1 MSTLSQQRKLVEQLRQEANLNRRPVSECVQEMIVYMEQNREKDCLVSGFASKKDNPFQEKGG 62          
BLAST of G protein gamma domain-containing protein vs. TrEMBL
Match: A0A183N8Z7 (G protein gamma domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS24772 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 7.917e-28
Identity = 48/62 (77.42%), Postives = 56/62 (90.32%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            MS +SQQ+KLVEQLR EA +NRRPVS  VQEMI YM++N++KDCLVSGFA+KKDNPFQEKGG
Sbjct:    1 MSTLSQQRKLVEQLRQEANLNRRPVSECVQEMIVYMEQNREKDCLVSGFASKKDNPFQEKGG 62          
BLAST of G protein gamma domain-containing protein vs. TrEMBL
Match: G4M241 (G protein gamma domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_205760 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.215e-27
Identity = 48/62 (77.42%), Postives = 55/62 (88.71%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            MS +SQQ+KLVEQLR EA +NRRPVS  VQEMI YM++N+DKDCL SGFA+KKDNPFQEKGG
Sbjct:    1 MSTLSQQRKLVEQLRQEANLNRRPVSECVQEMIVYMEQNRDKDCLFSGFASKKDNPFQEKGG 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Cavefish
Match: gng7 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 [Source:NCBI gene;Acc:103035574])

HSP 1 Score: 45.4394 bits (106), Expect = 7.290e-8
Identity = 23/57 (40.35%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   69 ISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            I+Q +KLVEQLR EA I R  VS +  +++ Y +++   D L+ G     +NPF++K
Sbjct:    7 IAQARKLVEQLRIEAGIERIKVSKAAADLMSYCEQHARSDALLVGVPT-SENPFKDK 62          
BLAST of G protein gamma domain-containing protein vs. Ensembl Cavefish
Match: gngt1 (guanine nucleotide-binding protein G(T) subunit gamma-T1 [Source:NCBI gene;Acc:103023645])

HSP 1 Score: 45.4394 bits (106), Expect = 9.484e-8
Identity = 22/62 (35.48%), Postives = 38/62 (61.29%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            ++ + + K  V QL+ E  + R  VS   +E+++Y+    ++D LV G + +K NPF+EKGG
Sbjct:    9 LTDLDKAKMEVTQLKVEVKLEREKVSKCCEEVMEYIQAGVEEDILVKGISEEK-NPFKEKGG 69          
BLAST of G protein gamma domain-containing protein vs. Ensembl Cavefish
Match: gngt1 (guanine nucleotide-binding protein G(T) subunit gamma-T1 [Source:NCBI gene;Acc:103023645])

HSP 1 Score: 45.4394 bits (106), Expect = 9.484e-8
Identity = 22/62 (35.48%), Postives = 38/62 (61.29%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            ++ + + K  V QL+ E  + R  VS   +E+++Y+    ++D LV G + +K NPF+EKGG
Sbjct:    9 LTDLDKAKMEVTQLKVEVKLEREKVSKCCEEVMEYIQAGVEEDILVKGISEEK-NPFKEKGG 69          
BLAST of G protein gamma domain-containing protein vs. Ensembl Cavefish
Match: gng2 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 [Source:NCBI gene;Acc:103030920])

HSP 1 Score: 43.1282 bits (100), Expect = 6.908e-7
Identity = 23/59 (38.98%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQL+ EA I+R  VS +  +++ Y + +  +D L+S      +NPF+EK
Sbjct:    7 ASIAQARKLVEQLKMEANIDRIKVSKAAADLMSYCEAHAKEDPLLSPVP-ASENPFREK 64          
BLAST of G protein gamma domain-containing protein vs. Ensembl Cavefish
Match: gngt2b (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 [Source:NCBI gene;Acc:103025140])

HSP 1 Score: 42.3578 bits (98), Expect = 1.413e-6
Identity = 21/52 (40.38%), Postives = 32/52 (61.54%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            ++QL+ E   +R  VSA+  ++I Y++    +D LV G    K NPF+EKGG
Sbjct:   15 LDQLKIEVKTSRTAVSATAPDIISYVEARSGEDPLVKGVPEDK-NPFKEKGG 65          
BLAST of G protein gamma domain-containing protein vs. Ensembl Sea Lamprey
Match: gngt2b (guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2b [Source:ZFIN;Acc:ZDB-GENE-091020-4])

HSP 1 Score: 39.2762 bits (90), Expect = 4.891e-6
Identity = 20/51 (39.22%), Postives = 29/51 (56.86%), Query Frame = 3
Query:   93 EQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            EQLR E  + R  +S    +++ +++ N   D LV G    K NPF+EKGG
Sbjct:   17 EQLRIEVKLTREKISKVAPDILAHVESNMADDPLVKGVPEDK-NPFKEKGG 66          
BLAST of G protein gamma domain-containing protein vs. Ensembl Medaka
Match: si:dkey-117i10.1 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12-like [Source:NCBI gene;Acc:110015484])

HSP 1 Score: 47.7506 bits (112), Expect = 9.122e-9
Identity = 24/58 (41.38%), Postives = 37/58 (63.79%), Query Frame = 3
Query:   66 GISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
             + Q +KLVEQLR EA++ R  +S +  +++QY  E++  D L+ G A    NPF+EK
Sbjct:   12 SVIQAQKLVEQLRLEASMVRFKISLTAADLVQYCQEHRCSDPLLMGIA-ASSNPFKEK 68          
BLAST of G protein gamma domain-containing protein vs. Ensembl Medaka
Match: gng2 (G protein subunit gamma 2 [Source:NCBI gene;Acc:101157742])

HSP 1 Score: 44.669 bits (104), Expect = 1.732e-7
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I+Q +KLVEQL+ EA I+R  VS +  E++ Y + +  +D L+S      +NPF+EK
Sbjct:   14 ASIAQARKLVEQLKMEANIDRIKVSKAAAELMSYCEAHAKEDPLLSPVP-ASENPFREK 71          
BLAST of G protein gamma domain-containing protein vs. Ensembl Medaka
Match: gng5 (guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 [Source:NCBI gene;Acc:110016922])

HSP 1 Score: 43.8986 bits (102), Expect = 2.849e-7
Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQ 233
            S I   KK+V+QLR EA+INR  VS +  E+ Q+   N  +D L++G ++   NPF+
Sbjct:    5 SSIVAMKKVVQQLRYEASINRVKVSQAAAELQQFCMNNATQDPLLTGMSS-STNPFR 60          
BLAST of G protein gamma domain-containing protein vs. Ensembl Medaka
Match: gngt1 (guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7596])

HSP 1 Score: 43.8986 bits (102), Expect = 3.660e-7
Identity = 22/52 (42.31%), Postives = 32/52 (61.54%), Query Frame = 3
Query:   90 VEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            V QL+ E  + R   S   +EM +Y+ E  ++D LV G + +K NPF+EKGG
Sbjct:   19 VNQLKLEVKLERWLTSKCCEEMKEYIQERVEEDTLVKGISEEK-NPFKEKGG 69          
BLAST of G protein gamma domain-containing protein vs. Ensembl Medaka
Match: GNG5 (G protein subunit gamma 5 [Source:NCBI gene;Acc:111947358])

HSP 1 Score: 42.3578 bits (98), Expect = 1.083e-6
Identity = 21/59 (35.59%), Postives = 38/59 (64.41%), Query Frame = 3
Query:   63 SGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEK 239
            + I   KK+++QLR EA+INR  VS +  ++ Q+  +N   D L++G ++  +NPF+ +
Sbjct:    3 ANIVTMKKIIQQLRLEASINRVKVSQAATDLQQFCLQNAQHDPLLTGMSS-SNNPFRPQ 60          
BLAST of G protein gamma domain-containing protein vs. Planmine SMEST
Match: SMESG000066557.1 (SMESG000066557.1)

HSP 1 Score: 128.257 bits (321), Expect = 9.024e-41
Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = 3
Query:   60 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 245
            MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG
Sbjct:    1 MSGISQQKKLVEQLRAEAAINRRPVSASVQEMIQYMDENKDKDCLVSGFANKKDNPFQEKGG 62          
The following BLAST results are available for this feature:
BLAST of G protein gamma domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNG75.203e-740.35G protein subunit gamma 7 [Source:HGNC Symbol;Acc:... [more]
GNG32.675e-636.21G protein subunit gamma 3 [Source:HGNC Symbol;Acc:... [more]
GNG22.858e-637.29G protein subunit gamma 2 [Source:HGNC Symbol;Acc:... [more]
GNG22.858e-637.29G protein subunit gamma 2 [Source:HGNC Symbol;Acc:... [more]
GNG22.858e-637.29G protein subunit gamma 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gpc-12.491e-748.00Guanine nucleotide-binding protein subunit gamma ... [more]
gpc-12.491e-748.00Guanine nucleotide-binding protein subunit gamma ... [more]
gpc-12.491e-748.00Guanine nucleotide-binding protein subunit gamma ... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ggamma12.290e-1545.90gene:FBgn0004921 transcript:FBtr0088645[more]
Ggamma12.290e-1545.90gene:FBgn0004921 transcript:FBtr0088647[more]
Ggamma12.290e-1545.90gene:FBgn0004921 transcript:FBtr0088646[more]
CG433243.181e-1242.62gene:FBgn0263029 transcript:FBtr0306907[more]
Ggamma30A7.948e-838.89gene:FBgn0267252 transcript:FBtr0336620[more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-117i10.15.167e-835.48si:dkey-117i10.1 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
gngt17.248e-838.71guanine nucleotide binding protein (G protein), ga... [more]
gngt17.248e-838.71guanine nucleotide binding protein (G protein), ga... [more]
gngt17.248e-838.71guanine nucleotide binding protein (G protein), ga... [more]
gng71.725e-740.35guanine nucleotide binding protein (G protein), ga... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gngt21.363e-842.31guanine nucleotide binding protein (G protein), ga... [more]
gng73.021e-738.98guanine nucleotide binding protein (G protein), ga... [more]
hsd11b25.674e-746.15hydroxysteroid (11-beta) dehydrogenase 2 [Source:X... [more]
kdm1a1.872e-638.10lysine (K)-specific demethylase 1A [Source:Xenbase... [more]
gng22.591e-637.29guanine nucleotide binding protein (G protein), ga... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm57412.554e-740.68predicted gene 5741 [Source:MGI Symbol;Acc:MGI:364... [more]
Gng77.638e-739.68guanine nucleotide binding protein (G protein), ga... [more]
Gng77.638e-739.68guanine nucleotide binding protein (G protein), ga... [more]
Gng77.638e-739.68guanine nucleotide binding protein (G protein), ga... [more]
Gng77.807e-739.68guanine nucleotide binding protein (G protein), ga... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38040|GBG1_DROME2.296e-1445.90Guanine nucleotide-binding protein subunit gamma-1... [more]
sp|Q4VT26|GBG_CAEBR6.835e-745.28Guanine nucleotide-binding protein subunit gamma O... [more]
sp|P43425|GBG7_RAT8.071e-741.27Guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
sp|Q9NFZ3|GBGE_DROME9.312e-738.89Guanine nucleotide-binding protein subunit gamma-e... [more]
sp|P30671|GBG7_BOVIN1.220e-642.11Guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q8IT611.799e-2879.03Guanine nucleotide-binding protein subunit gamma; ... [more]
A0A183WBU92.949e-2879.03G protein gamma domain-containing protein OS=Trich... [more]
A0A183JX557.917e-2877.42G protein gamma domain-containing protein OS=Schis... [more]
A0A183N8Z77.917e-2877.42G protein gamma domain-containing protein OS=Schis... [more]
G4M2411.215e-2777.42G protein gamma domain-containing protein OS=Schis... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gng77.290e-840.35guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
gngt19.484e-835.48guanine nucleotide-binding protein G(T) subunit ga... [more]
gngt19.484e-835.48guanine nucleotide-binding protein G(T) subunit ga... [more]
gng26.908e-738.98guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
gngt2b1.413e-640.38guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gngt2b4.891e-639.22guanine nucleotide binding protein (G protein), ga... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G protein gamma domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-117i10.19.122e-941.38guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
gng21.732e-740.68G protein subunit gamma 2 [Source:NCBI gene;Acc:10... [more]
gng52.849e-742.11guanine nucleotide-binding protein G(I)/G(S)/G(O) ... [more]
gngt13.660e-742.31guanine nucleotide binding protein (G protein), ga... [more]
GNG51.083e-635.59G protein subunit gamma 5 [Source:NCBI gene;Acc:11... [more]
back to top
BLAST of G protein gamma domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000066557.19.024e-41100.00SMESG000066557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30034920 ID=SMED30034920|Name=G protein gamma domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=246bp
GTTCTTACTTACACTTAATCATGCATAATTAATTCAACAATTCAATTAAA
AATTATTAAATGTCTGGAATTAGTCAACAGAAAAAACTAGTCGAACAATT
ACGAGCAGAAGCTGCAATTAACCGGAGACCAGTTTCAGCCAGTGTTCAAG
AAATGATTCAATACATGGATGAAAACAAAGATAAAGACTGTTTAGTAAGT
GGGTTTGCTAACAAAAAGGACAATCCTTTCCAAGAAAAAGGTGGAT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0004871signal transducer activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036284GGL_sf
IPR001770Gprotein-gamma
IPR015898G-protein_gamma-like_dom
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005834heterotrimeric G-protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01224G_gamma_2coord: 1..59
e-value: 2.0E-9
score: 47.3
NoneNo IPR availablePANTHERPTHR13809:SF48GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT GAMMA-RELATEDcoord: 1..61
IPR015898G-protein gamma-like domainSMARTSM00224GGL_4coord: 4..62
e-value: 2.0E-10
score: 50.6
IPR015898G-protein gamma-like domainPFAMPF00631G-gammacoord: 6..60
e-value: 8.4E-12
score: 44.9
IPR015898G-protein gamma-like domainPROSITEPS50058G_PROTEIN_GAMMAcoord: 1..62
score: 19.095
IPR015898G-protein gamma-like domainCDDcd00068GGLcoord: 4..61
e-value: 7.41626E-15
score: 59.6102
IPR036284G-protein gamma-like domain superfamilyGENE3DG3DSA:4.10.260.10coord: 2..60
e-value: 4.0E-22
score: 79.9
IPR036284G-protein gamma-like domain superfamilySUPERFAMILYSSF48670Transducin (heterotrimeric G protein), gamma chaincoord: 2..61
IPR001770G-protein, gamma subunitPANTHERPTHR13809GUANINE NUCLEOTIDE-BINDING PROTEIN GAMMA SUBUNITcoord: 1..61